US09376974B2
A method and system for controlling fuel injection for vehicles controls fuel injection amount according to change in kinetic energy of the vehicle or performs fuel cut control so as to improve fuel economy. The method may include setting a first energy line corresponding to energy loss due to running resistance when deceleration, setting a second energy line corresponding to energy loss due to engine friction, determining whether kinetic energy of the vehicle is above the first energy line after a predetermined time has elapsed, and injecting fuel by an amount generating energy corresponding to a sum of engine friction energy and braking energy in a case that the kinetic energy of the vehicle is above the first energy line.
US09376972B1
Methods and systems are provided for adjusting the opening of a scroll valve of a binary flow turbine. Scroll valve adjustments are used at different engine operating conditions to improve engine performance and boost response. Scroll valve adjustments are coordinated with wastegate and EGR valve adjustments for improved engine control.
US09376964B2
A control system for at least one of steam turbines, gas turbines or power plants includes a sensor system configured to monitor predefined operating parameters, the sensor system including redundant sensors. A central processor arrangement of the control system has an input side configured to receive measurement data from the sensor system and an output side configured to communicate with operation control elements of the turbines or power plants. A sensor side processor circuit is assigned at least to the redundant sensors, the processor circuit being configured to continuously check the sensors for error-free operation, to protect or block the input side of the central processor arrangement from erroneous signals, and to only respectively forward or further process signals from a sensor that has been identified as error-free in one channel.
US09376953B2
A cooling air bypass prevents premature failure of an engine in the event that cooling air from an external blower is somehow obstructed or shut off. The cooling air bypass includes a normally-closed valve in a wall of a conduit. During proper operation of the blower, the conduit conducts cooling air from the blower to the engine. If the blower malfunctions, however, such that airflow from the blower is impeded or stops, the valve opens to provide an auxiliary airflow path through the valve in the wall of the conduit and into the engine.
US09376947B2
A hybrid valve assembly for an exhaust system includes an exhaust tube having a bore defining an exhaust flow path. A vane is mounted within the bore and is moveable between an open position and a closed position. A resilient member biases the vane toward the closed position. A valve actuator has an ON position where movement of the vane is actively controlled by the valve actuator and an OFF position where movement of the vane is passively controlled by exhaust gas flow.
US09376945B2
A two circuit manually adjustable PCV valve has threaded control means for adjusting the blow by gas flow in idle (high) and cruise (low) vacuum conditions. A third adjustment means for controlling the crossover flow rate between the channels in certain modes of operation renders the vacuum pressure transition point susceptible to manual control. The three adjustment means create a control system for more efficient vehicle engine operation.
US09376942B2
A baffle plate structure includes an oil pan, an oil pump, a baffle plate, and a resin oil strainer. The baffle plate is to separate an interior of the oil pan into a crank case side and a oil chamber side. The resin oil strainer includes an inlet portion and a parallel portion. The inlet portion extends toward a bottom surface of the oil pan. The inlet portion has an inlet port for lubricant at a lower part of the inlet portion. The parallel portion extends from the inlet portion in a direction substantially parallel to the baffle plate to introduce the lubricant from the inlet portion to the oil pump. The baffle plate has an opening corresponding to the parallel portion of the resin oil strainer. The parallel portion of the resin oil strainer is disposed so as to close the opening.
US09376938B2
The waste heat power generator (G) includes: an evaporator (1) configured to produce steam of a working medium; a power-generating device (2, 2a, 2b) configured to generate electric power while expanding the steam; a condenser (3) configured to condense the steam which has passed through the power-generating device (2, 2a, 2b); and a pump (5) configured to send the condensed working medium to the evaporator (1). A bottom portion (BT) of the power-generating device (2, 2a, 2b) is provided with a discharge port (8) configured to discharge the working medium liquefied inside the power-generating device (2, 2a, 2b), to the outside thereof. A discharge pipe (6) is provided in which one end thereof is connected to the discharge port (8) and the other end thereof is disposed in a channel for the working medium between the condenser (3) and the pump (5).
US09376932B2
A system for cleaning gas turbine engines is described. More specifically, methods and apparatuses for cleaning stationary gas turbines and on-wing turbofan engines found on aircraft are disclosed that includes a trailer-mounted, automated low-pressure water delivery system, additive and detergent injection system, nozzle and manifold technology, and active waste water effluent collector system. The system will deliver the liquid cleaning medium at a specific pressure, temperature, and flow rate to optimize the atomization that occurs at the nozzles.
US09376930B2
A waste gate valve which is installed on a turbocharger to selectively discharge a part of exhaust gas while allowing the part of the exhaust gas to bypass the turbocharger, may include a layer which is formed between a valve seat and a valve body that comes into contact with the valve seat.
US09376929B2
A turbine generator includes a bearing device configured to rotatably support a rotor inside a housing. The bearing device separates an internal space of the housing from its outside. Communicating portions are formed in the bearing device. The communicating portions are formed in regions which are out of contact with lubricant. Each communicating portion establishes communication between the internal space of the housing and its outside.
US09376926B2
A gas turbine engine fan blade lock assembly includes a fan hub that has blade slots each configured to receive a root of a fan blade. The fan hub includes circumferentially spaced first slots. A lock ring is configured to move between unlocked and locked positions. The lock ring includes circumferentially spaced second slots aligned with the first slots in the locked position, and multiple discrete pins. Each pin is configured to be slidably received in paired first and second slots in the locked position to prevent rotational movement of the lock ring relative the fan hub.
US09376920B2
A gas turbine engine component includes a structure having an exterior surface. A cooling hole extends from a cooling passage to the exterior surface to provide an exit area on the exterior surface that is substantially circular in shape. A gas turbine engine includes a compressor section and a turbine section. A combustor is provided between the compressor and turbine sections. A component in at least one of the compressor and turbine sections has an exterior surface. A film cooling hole extends from a cooling passage to the exterior surface to provide an exit area that is substantially circular in shape. A method of machining a film cooling hole includes providing a component having an internal cooling passage and an exterior surface, machining a film cooling hole from the exterior surface to the internal cooling passage to provide a substantially circular exit area on the exterior surface.
US09376917B2
A fan rotor blade includes a blade body constructed of a composite material, a blade root constructed of the composite material, and a sheath attached to a leading edge of the blade body. The sheath includes a sheath main body and a pair of joint flanges, and is segmented into a sheath base segment and a sheath top segment. The sheath top segment has a longer length than a length of the sheath base segment along a span direction. A sheath length of the sheath main body at an assumed impact position with an obstacle is not shorter than 10% chord and not longer than 60% chord. A sheath length of the sheath along an end edge of the fan rotor blade is not shorter than 40% chord. The fan rotor blade possesses sufficient impact resistance and can be simplified and light-weighted.
US09376915B2
An air motor and an electric painting device improves driving efficiency, and includes a housing, a main shaft inserted inside of the housing, an impeller fixed concentrically with the main shaft to an inserted portion of the main shaft and having a plurality of turbine blades formed on the outer periphery, bearings for rotatably supporting the main shaft and the impeller, and a nozzle having a tubular or hole-shaped channel for ejecting compressed air to the respective turbine blades for rotating the impeller along the circumference. When M1=ve/a0 where ve denotes flow velocity of the compressed air in an entrance of the channel of the nozzle, and a0 denotes acoustic velocity, the length of the channel of the nozzle is set to a dimension of a calculated value or greater using a predetermined expression.
US09376905B2
Systems and methods are provided for expert systems for well completion using Bayesian decision networks to determine well completion recommendations. The well completion expert system includes a well completion Bayesian decision network (BDN) model that receives inputs and outputs recommendations based on Bayesian probability determinations. The well completion BDN model includes a treatment fluids section, a packer section, a junction classification section, a perforation section, a lateral completion section, and an open hole gravel packing section.
US09376899B2
An RF antenna assembly is positioned within a wellbore in a subterranean formation for hydrocarbon resource recovery. The RF antenna assembly includes first and second tubular conductors to be positioned within the wellbore, and having adjacent joined together ends, and first and second RF transmission line segments extending within the first and second tubular conductors and having adjacent joined together ends aligned with the joined together adjacent ends of the first and second tubular conductors. The RF antenna assembly includes a tubular sheath surrounding the first RF transmission line segment and having an outer surface, and a spacer received on the outer surface of the tubular sheath and extending between the tubular sheath and adjacent portions of the first tubular conductor.
US09376898B2
A system for heating hydrocarbon resources in a subterranean formation having a wellbore therein includes a coaxial transmission line, a balun, and a radio frequency (RF) antenna coupled together in series and configured to be positioned in the wellbore so that the RF antenna heats the hydrocarbon resources in the subterranean formation. The coaxial transmission line includes an inner conductor and an outer conductor surrounding the inner conductor. The balun includes an outer conductive sleeve having a proximal end coupled to the outer conductor of the coaxial transmission line and a medial portion coupled to the inner conductor of the coaxial transmission line. The balun also includes an inner tubular conductor extending longitudinally within the outer conductive sleeve between the outer conductor of the coaxial transmission line and the RF antenna.
US09376890B2
A flow restrictor includes resilient flaps that can flex outward to an open position in response to fluid flow pressure and return to an initial position at which the resilient flaps restrict fluid flow more than in the open position. The resilient flaps can overlap and variably restrict fluid flow based on fluid flow pressure. The flow restrictor can be used on a transport tube to avoid a need for a packing tube in an alternative path system to deliver gravel packing slurry.
US09376875B2
A system and method include pumping drilling fluid through a drill string extended into a wellbore extending below the bottom of a body of water, out the bottom of the drill string and into the wellbore annulus. Fluid is discharged from the annulus into a riser and a discharge conduit. The riser is disposed above the top of the wellbore and extends to the water surface. The discharge conduit couples to the riser and includes a controllable fluid choke. A fluid return line is coupled to an outlet of the choke and extends to the water surface. Gas under pressure is pumped into the return line at a selected depth below the water surface. The controllable fluid choke may be operated to maintain a selected drilling fluid level in the riser, the selected fluid level being a selected distance below the water surface.
US09376868B1
In an embodiment, a polycrystalline diamond compact (“PDC”) comprises a substrate and a pre-sintered polycrystalline diamond (“PCD”) table including a plurality of bonded diamond grains defining a plurality of interstitial regions, an upper surface, and a back surface that is bonded to the substrate. The pre-sintered PCD table includes a first thermally-stable region extending inwardly from the upper surface, and a second region located between the first thermally-stable region and the substrate. The second region exhibits a thermal stability that is less than that of the first thermally-stable region, and includes at least one interstitial constituent disposed interstitially between the bonded diamond grains thereof. The at least one interstitial constituent may include at least one silicon-containing phase.
US09376867B2
A method of drilling a subterranean bore hole includes engaging subterranean formation material with a cutting element comprising a superabrasive table having a substantially planar recessed surface in a cutting face thereof.
US09376865B2
Rotational locking mechanisms for drill string assemblies, bottom hole assemblies, and drilling motors are presented herein. A fluid-driven motor assembly is disclosed for use in a drill string to drill a borehole in an earth formation. The drill string includes a drill pipe and a drill bit. The motor assembly includes a housing that is configured to operatively connect to the drill pipe of the drill string to receive drilling fluid therefrom. A stator, which is disposed within the housing, is configured to rotate at a stator speed. A rotor is disposed within the stator and coupled to the drill bit. The rotor is configured to rotate at a rotor speed. The motor assembly also includes a rotational locking assembly operatively coupled to the rotor and the housing. The rotational locking assembly is configured to prevent the stator speed of the stator from exceeding the rotor speed of the rotor.
US09376861B2
A winding device for a cordless roller blind includes a mounting seat, a winding unit and a connecting mechanism. The mounting seat is mountable on a supporting structure. The connecting mechanism is for connecting removably the winding unit to the mounting seat in such a manner that the winding unit is upright when connected to the mounting seat. The connecting mechanism includes a first connecting set that is disposed on one of a casing of the winding unit and the mounting seat, and at least two second connecting sets that are disposed on the other of the casing and the mounting seat. The first connecting set is removably engageable with one of the second connecting sets so as to connect removably the winding unit to the mounting seat.
US09376842B2
The invention is directed to a lock for a door arrangement, wherein a catch and a pawl are provided. The catch can be in an open or closed position. The catch may be brought into holding engagement. The pawl may be brought into an engagement position. The pawl may be deflected into a release position. A pawl actuation lever is provided for deflecting the pawl. A switchable coupling arrangement comprises a first coupling lever, a second coupling lever and a spring biased coupling element. A control spring arrangement is provided that is engageable with the coupling element, which control spring arrangement acts against the spring bias of the coupling element, and that the pawl actuation lever is coupled to the control spring arrangement such that a predefined movement of the pawl actuation lever changes or eliminates the resulting force acting from the control spring arrangement onto the coupling element.
US09376838B2
In a cylinder lock having a pivot member pivoted in response to pivoting by a legitimate mechanical key inserted into a key hole, a first rotor is linked to an outer cylinder relatively non-pivotably but movably along an insertion direction of a mechanical key, and a second rotor abuts against the first rotor from a side opposite to a rotor-receiving part provided on a housing and the outer cylinder and is linked to a pivot member relatively non-pivotably but movably along the insertion direction, and during pivoting of the outer cylinder in response to an unauthorized pivoting operation of an inner cylinder, the first rotor and the second rotor move so as to detach from the rotor-receiving part due to a cam mechanism provided between the first rotor and the housing, thereby releasing engagement of the inner cylinder with the second rotor linked to the pivot member relatively non-pivotably.
US09376837B2
A system includes a multisided key with three or more sides, where all the sides of the multisided key are identical. Further, the system includes a cylindrical lock with inner and outer cylinders and a locking vane residing radially outward in a void spanning the inner and outer cylinders. The locking vane includes an inner portion including a first protrusion and a second protrusion corresponding to two levels of the multisided key and an outer portion separated from the inner portion by a gap, wherein at least a part of the outer portion is disposed in the outer void. When the multisided key is inserted into the lock, the gap of the locking vane aligns with an interface between the inner and outer cylinders, allowing the inner cylinder to rotate within the outer cylinder.
US09376827B2
A method produces a mast arm with a mast arm body and with at least one pipe holder for a concrete-distributing mast for use on stationary and mobile concrete pumps with a plurality of mast arms which are connected to one another so as to be pivotable on articulated joints about an axis of articulation and which hold a concrete-conveying line which has at least one rotary joint which has an axis of rotation aligned with an axis of articulation of an articulated joint. The at least one pipe holder here has a pipe support section which serves for receiving the concrete-conveying line at a holding point which has a location predetermined by the position of the axis of articulation. The mast arm body is premanufactured with a receiving intersection and the at least one pipe holder is premanufactured with a fastening section which has a connecting intersection.
US09376823B1
Hard panels formed from a wood-based material and having a decorative layer for floor coverings are provided, at least on two opposite edges, with coupling devices made in one piece with the panels wherein similar panels may be coupled together to form a floor covering, wherein these coupling devices provide for an interlocking in a direction perpendicular to the plane of coupled panels, as well as in a direction perpendicular to the edges concerned and parallel to the plane of coupled panels. These coupling devices are constituted of a tongue and a groove. The top side of the tongue has a protrusion that cooperates with a meshing recess located in the lower side of the upper lip of the groove of the coupling devices, and a portion extending generally parallel with the plane of the panel to form a contact surface cooperating with the lower side of the upper lip of the groove.
US09376818B1
The apparatus of the invention in conjunction with the spraying unit will unroll the fabric, form it to the shape of the existing profile, and embed the fabric in the applied coating. Not only does the method greatly enhance the quality of the installation providing fewer wrinkles and bubbles, but also its construction greatly protects the roof deck against the effects of the environment. The apparatus of the invention requires fewer workers to operate and sequentially organizes every step reducing safety issues.
US09376815B1
A structural concrete panel preferably includes six connector boxes, a plurality of conduits, a plurality of rebar rods, a plurality of insulation blocks, a plurality of rebar mesh sheets and a concrete outer layer. Four corner connector boxes are located in each corner of the structural concrete panel. A side connector box is located between two corner connector boxes on each side of the structural concrete panel. Each end of a plurality of rebar rods are secured to two adjacent connector boxes. Two bottom rebar mesh sheets are retained on a bottom of the structural concrete panel. The plurality of insulation blocks are laid on the two bottom rebar mesh sheets. Two top rebar mesh sheets are retained on a top of the structural concrete. Concrete is molded around the plurality of rebar mesh sheets, the plurality of rebar rods and the plurality of insulation blocks.
US09376806B2
A portable aisle protection system is provided. The system includes interlocking rectangular plate members capable of interconnecting in an aisle forming relationship. Each of the plate members has a smooth non-compressible top rolling surface, bottom and four sides. The four sides define peripheral edges. Three of the peripheral edges have interlocking formations. Non-compressible ramp rails have an inclined leading portion and a trailing edge. The inclined portion establishes an upward inclined plane, and the trailing edge includes interlocking formations adapted for interfitting butting engagement of the trailing edge with the respective peripheral edges of the plate members so that the ramp rails are capable of providing ingress and egress to the load protecting aisle formed by the plate members.
US09376804B2
Enhanced structural insulated panels, related processes, and related structures and systems provide several improvements over conventional structural panels. Some embodiments of the enhanced structural insulated panels comprise at least one exterior surface that is configured to provide a high degree of spectral reflectivity, such as comprising but not limited to a stainless steel or other material having a mirrored exterior surface. The outer surface may preferably be imparted with a series of waves, such as within a lay pattern, wherein the series of waves may preferably comprise varying wavelengths and wave heights.
US09376800B2
An expandable building assembly is provided, the building assembly having a retracted condition, in which the roof of the building has a first area, and an extended condition, in which the roof of the building has a second area, the second area being greater than the first, the assembly comprising a roof portion; and means for displacing and rotating the roof portion between the retracted condition and the expanded condition; whereby in the retracted condition, the roof portion is in a first position and at a first orientation, and in the extended condition, the roof portion is in a second position and at a second orientation, wherein the second position is displaced from the first position and the second orientation is rotated with respect to the first orientation. A building comprising one or more of the building assemblies is also provided.
US09376798B1
An improved W-column provides flange tabs on the top-and-bottom outside corners of the W-column flanges, and vertical bolt-on connections to temporarily mount one column positioned by a crane on top of another by bolting the bolt-on connections to the corresponding flange tabs to properly align one W-column above another W-column. The improved W-column further allows the two vertically positioned W-columns also to be connected together by bolting the web of the upper W-column to the web of the lower W-column before permanently welding the two vertical W-columns together. Once positioned, these vertically aligned W-columns are can be permanently joined together with the Arcmatic® VertaSlag® ESW-NG welding process. In this manner all vertical W-column elements of a steel framed high rise building can be quickly erected.
US09376793B2
Disclosed is a single use foldable dispenser for storing, and dispensing a quantity of an adhesive laboratory treatment composition.
US09376785B2
A shovel includes a lower traveling body; an upper rotating body provided on the lower traveling body; an electrical energy storage device provided on the upper rotating body; a converter connected to the electrical energy storage device; and a controller that controls the converter. The controller applies a current to the electrical energy storage device and the converter at the time of starting up the shovel, detects the status value after having applied the current, and controls the converter based on a comparison result between the detected status value and a predetermined value to restrict an output of the electrical energy storage device.
US09376782B1
The present invention is a method for strengthening a vertical column, such as piles under piers and docks and for columns in bridges and buildings. A coiled FRP laminate is provided and wrapped in a helical fashion around the column, with the laminate overlapping itself. An epoxy resin coating is applied between the overlapping portions. The epoxy resin will then cure to form a substantially water tight shell. A plurality of spacers may be fixed to the column and adapted to hold the laminate a set distance away from the column. A plurality of sealing means is provided to seal the space between the shell and the column. A filler material may be pressurized to fill the space, penetrate cracks in the column, and displace water. Also, a plurality of rigid strengthening rods may be added between the column and the shell to further strengthen the column.
US09376781B2
A ground anchor having an elongated shaft with upper and lower ends, a grooved locking post on the upper end; an threaded auger fixed to the lower end, an engagement area for engaging an external tool, a sleeve mounted over the main shaft, which spins freely, and an attachment member configured to secure one or more of an external lock, chain, rope or cable attached to an external object to thereby anchor the external object when the main shaft is screwed into the ground, and a lock device configured to cover and lock onto the grooved locking post so the attachment member and sleeve cannot be removed, whereby the sleeve covers the main shaft and obstructs access to the main shaft to prevent unwanted persons from removing it.
US09376767B2
A plastic tub for a washing machine includes a cylindrical casing; and an end face wall sealing the cylindrical casing. The end face including a bearing mount for a shaft of a laundry drum and radially-aligned reinforcing ribs molded into the end face wall. The reinforcing ribs begin at the bearing mount and branch in a Y-shape along their radial extent.
US09376765B2
A carbon fiber having a lattice spacing (d002) of 0.336 nm to 0.338 nm and a crystallite size (Lc002) of 50 nm to 150 nm as measured and evaluated by X-ray diffraction and a fiber diameter of 10 nm to 500 nm, the carbon fiber having no branched structure.
US09376756B2
Aminoethers are used as corrosion inhibitors in boiler systems in which a working fluid comprising water with an aminoether corrosion inhibitor is circulated from a heater to a utilization site at which the working fluid gives up energy and decreases in temperature. A preferred class of aminoethers are the alkoxytriethyleneglycol-tert-alkylamines such as methoxy triethyleneglycol-tert-butylamine.
US09376750B2
Inorganic materials are deposited onto organic polymers using ALD methods. Ultrathin, conformal coatings of the inorganic materials can be made in this manner. The coated organic polymers can be used as barrier materials, as nanocomposites, as catalyst supports, in semiconductor applications, in coating applications as well as in other applications.
US09376749B2
Method for chemical vapor infiltration of refractory substances, wherein a porous structure is subjected in a reaction zone to the flow of a gas containing at least one gaseous precursor, wherein the partial pressure of the precursor and the dwell time of the gas are set at a given temperature in such a manner that a deposition reaction of the precursor occurs in the porous structure in the partial pressure range of the saturation adsorption and the reaction of the precursor is limited in each stage of the infiltration in such a manner that during the flow through the reaction zone no more than 50% of the precursor are deposited as a solid phase in the porous structure, and the exposure of the porous structure to the flow occurs in a stack of superimposed layers through ring-shaped vertical circumferential gaps (A, B) as well as through transverse gaps (C) which are open towards the circumferential gaps (A, B). The outer circumferential gap (A) is open both towards the inlet side and towards the outlet side of the reaction zone, while the inner circumferential gap (B) is closed towards the inlet side and towards the outlet side and has a gap width that is greater than the outer gap (A).
US09376745B2
The invention relates to a magnetron sputtering process that allows material to be sputtered from a target surface in such a way that a high percentage of the sputtered material is provided in the form of ions. According to the invention, said aim is achieved using a simple generator, the power of which is fed to multiple magnetron sputtering sources spread out over several time intervals, i.e. the maximum power is supplied to one sputtering source during one time interval, and the maximum power is supplied to the following sputtering source in the subsequent time interval, such that discharge current densities of more than 0.2 A/cm2 are obtained. The sputtering target can cool down during the off time, thus preventing the temperature limit from being exceeded.
US09376744B2
A phase difference element has a transparent substrate and a birefringent film with tantalum oxide and titanium oxide obliquely deposited on one surface of the transparent substrate. The birefringent film has a first photorefractive film and a second photorefractive film laminated to each other and having different oblique deposition directions. The ratio of titanium atoms to the total of titanium atoms and tantalum atoms in the birefringent film is 4.0 atomic % or higher to 30 atomic % or lower.
US09376731B2
An apparatus is disclosed for magneto-thermal processing of substrates comprises a work surface for supporting a substrate for processing, a source of electromagnetic radiation that delivers an intense electromagnetic field to an area of a substrate disposed on the work surface, and a magnetic assembly that delivers a magnetic field to the area of the substrate. The intense electromagnetic field typically has an energy density of at least about 0.2 J/cm2 and a cross-sectional area typically not more than about 10 cm2. The magnetic field typically has a strength at least about 0.5 T and an area not more than about 10 cm2.
US09376718B2
The present invention provides novel methods and devices that employ microfluidic technology to generate molecular melt curves. In particular, the devices and methods in accordance with the invention are useful in providing for the analysis of PCR amplification products.
US09376713B2
Provided are methods and devices for label-free detection of nucleic acids that are amplified by polymerase chain reaction. A solution containing the components necessary for a PCR is introduced to a microfluidic amplification chamber and an electric field applied to a confined region in which PCR occurs. PCR product generated in the confined region is detected by measuring an electrical parameter that is, for example, solution impedance. The devices and methods provided herein are used, for example, in assays to detect one or more pathogens or for point-of-care tests. In an aspect, the PCR product is confined to droplets and the assay relates to detecting an electrical parameter of a flowing droplet, thereby detecting PCR product without a label. In an aspect, the PCR occurs in the droplet.
US09376710B2
Methods and compositions are disclosed relating to the localization of nucleic acids to arrays such as silane-free arrays, and of sequencing the nucleic acids localized thereby.
US09376694B2
The present disclosure relates to a method for preparing an optically active amino acid using cosubstrate shuttling of transaminase. The method includes coupling a reaction of converting a keto acid to an amino acid by α-transaminase and a reaction of transferring an amino group of an amine substrate by ω-transaminase (TA) using an amino acid cosubstrate. The present disclosure allows production of various optically active amino acids with high purity and high efficiency by solving the low equilibrium constant problem of transaminase and is applicable to production of various optically active amino acids in industrial scale. Since the present disclosure allows easy production of various unnatural amino acids having high reactivity and stability, which are used as pharmaceutical precursors, it can be usefully employed in preparation of pharmaceuticals, food additives and various animal feeds.
US09376686B2
The present invention relates to a new vaccine delivery system. In particular, the present invention includes compositions and methods of integrally transformed non-pathogenic, commensal bacteria that can express a nucleic acid molecule of a foreign polypeptide, wherein the nucleic acid molecule that encodes the foreign polypeptide is stably integrated into genomic DNA of the bacteria. The foreign polypeptide includes a vaccine antigen that elicits an immunogenic response, an inhibitor of a pathogen, or an immune booster or modulator.
US09376682B2
The present invention relates generally to a method for treating or preventing or otherwise ameliorating the effects of pulmonary diseases characterized by or associated with infiltration of neutrophils and complications arising therefrom. The present invention further provides agents and pharmaceutical compositions comprising agents which inhibit the activity of G-CSF or its receptor, interfere with G-CSF signaling and/or which down-regulate expression of G-CSF or its receptor.
US09376681B2
The present invention relates to synthetic oligonucleotide mimetics of miRNAs. In particular, the present invention provides double-stranded, chemically-modified oligonucleotide mimetics of miR-29. Pharmaceutical compositions comprising the mimetics and their use in treating or preventing conditions associated with dysregulation of extracellular matrix genes, such as tissue fibrotic conditions, are also described.
US09376671B2
The invention provides novel biologically pure cultures of microorganisms high in protease activity and capable of decomposing proteins recalcitrant to proteolysis as contained in garbage, waste water, organic waste liquids, industrial wastes and the like, a protease produced by such microorganisms and capable of decomposing proteins recalcitrant to proteolysis, and a method of utilizing the same. The novel culture is of a soil-derived microorganism belonging to Streptomyces sp., or a strain derived therefrom, which produces a protease capable of efficiently decomposing proteins recalcitrant to proteolysis as contained in waste water, organic waste liquids, industrial wastes and so forth.
US09376664B2
Methods and compositions for transdifferentiation of an animal cell from (i) a first pluripotent cell fate to a second nonpluripotent cell fate or (ii) from a non-pluripotent mesodermal, endodermal, or ectodermal cell fate to a different non-pluripotent mesodermal, endodermal, or ectodermal cell fate.
US09376653B1
A cascading hops reservoir may have a series of hops or adjunct reservoirs, each having a drain and an overflow. The series of reservoirs may be used by causing flow through a first reservoir, which may cause liquid to flow through the reservoir and through the drain, as well as past an overflow. When a second set of hops or adjuncts may be added, the flow may be introduced to a second reservoir, which may flow through a drain and also overflow into the first reservoir. A series of multiple reservoirs may thus be used to introduce hops or other adjuncts into a brewing cycle in stages, with each additional stage including previous stages in the recirculating flow during the brewing cycle.
US09376652B2
[Problem] The problem to be solved by the present invention is to improve the foam properties of fatty acid soap.[Means of solving] A solid soap comprising 20 to 70 mass % of fatty acid soaps, wherein the solid soap comprises dimethyldiallylammonium chloride/acrylamide polymer and a high-molecular polyethylene glycol.
US09376649B2
The present invention relates to a process for preparing a crystalline solid from glycine-N,N-diacetic acid derivatives (e.g., MGDA) of sufficiently low hygroscopicity, which is characterized in that at least one crystalline compound of the formula I is introduced as seed, and a spray granulation is carried out with at least one compound of the formula I, preferably followed by a heat treatment.
US09376648B2
A foam manipulation stabilizing composition for use in consumer products includes a plurality of surface-modified particles in combination with at least one surfactant. The particles have an average particle size greater than 100 nm up to about 50 μm and a hydrophobicity measured by a contact angle between about 20° to 140°. The ratio of particles-to-surfactant may be between about 1:20 to about 20:1. The surface modification may include grafting pH or temperature switching functional groups to the particles or to a composition, such as a polymer, coated on the particle. A method for reducing the level of foam in a rinse solution is also described.
US09376645B2
The present invention provides a lubricating oil composition for internal combustion engines which can reduce sufficiently the friction under mixed lubricating conditions and is excellent in fuel saving properties. The lubricating oil composition comprises (A) a base oil having a 100° C. kinematic viscosity of 2 to 8 mm2/s and an aromatic content of 10 percent by mass or less, (B) a metallic detergent having a metal ratio of 1.01 to 3.3 overbased with an alkaline earth metal borate, and (C) an organic molybdenum compound with a molybdenum concentration of 0.01 to 0.2 percent by mass on the basis of the total mass of the composition, and having a 100° C. HTHS viscosity of 5.5 mPa·s or lower.
US09376639B2
The gasification of a carbonaceous material includes receiving a volume of feedstock, supplying thermal energy to the volume of feedstock to convert at least a portion of the volume of feedstock to at least one pyrolysis reaction product via at least one pyrolysis reaction, super-heating the at least one pyrolysis reaction product, providing a volume of super-heated steam, mixing the volume of super-heated steam with the super-heated at least one pyrolysis reaction product and converting at least a portion of at least one reformed product to at least one synthesis gas product via at least one water-gas-shift reaction.
US09376638B2
A process for the hydroconversion of a hydrocarbon feedstock. The process includes contacting the hydrocarbon feedstock with a catalyst in a first hydrocracking section to obtain a first hydrocarbon effluent stream which is separated into a gaseous stream, a light liquid stream and a heavy liquid stream. These liquid streams are fractioned into a number of fractions of hydrocarbons including a fraction of hydrocarbons having a boiling point above 350° C. This fraction of hydrocarbons is contacted with a catalyst in a second hydrocracking section to obtain a second hydrocarbon effluent stream that is separated to obtain a gaseous stream, a light liquid stream and a heavy liquid stream. These liquid streams are fractioned into a number of fractions of hydrocarbons including a heavy fraction of hydrocarbons having a boiling point above 350° C. This fraction of hydrocarbons is split into a major stream and a minor stream with the major stream being recycled and the minor stream is recovered.
US09376632B2
Apparatus for conducting thermolysis of plastic waste and method of thermolysis in continuous manner
An apparatus and method for thermolysis of waste plastic in which reaction residue and carbonization products are continuously removed is described. The apparatus includes a feeding system, an extruder, a reactor for thermolysis, a dual agitator housed within the reactor, a trigger system in operative connection with the reactor, a flux heater, and a collecting system in operative connection with the reactor. The reactor for thermolysis has a height at least 1.5 times bigger than a diameter. The trigger system includes a circulation pump and the collecting system has a three-way valve in an external circulation loop. The apparatus is arranged such that the extruder follows the feeding system, the reactor follows the extruder, the trigger system is at a bottom of the reactor, and the flux heater and collecting system follow the reactor.
US09376626B1
A process for producing mesophase pitch using a long tube reactor is disclosed. An aromatic rich feed, preferably a petroleum pitch having a softening point above 100° C., is preheated to a temperature above its softening point and mixed with a vapor, preferably steam, in a long tubular reactor under intense mixing conditions, preferably fully developed turbulent flow such as mist annular flow, with a residence time at least an order of magnitude less than prior art processes and preferably less than 10 seconds. Preferably the reactor is heated by electric resistance or induction heating or by immersion in a heated fluid or in a fired heater. Mesophase pitch with a high coking value and a surprisingly low quinolone insoluble content is produced. The byproducts of thermal polymerization and thermal dealkylation have less than 50% as much olefin and diene content as compared to similar byproducts from prior art processes.
US09376623B2
The present invention provides compositions, devices and methods related to the alignment of materials including polymers. In some cases, the present invention comprises the assembly of molecules (e.g., polymers) via intermolecular interactions to produce extended networks, which may have enhanced properties relative to the individual molecules. Such networks may be advantageous for use in electronics, photovoltaics, sensor applications, and the like. In some embodiments, the present invention may enhance the performance of certain optical devices, such as liquid crystal displays (e.g., color liquid crystal displays) by providing enhanced contrast ratio, faster response times, and/or lower operating voltage.
US09376617B2
A fluorescent material according to an aspect of the present disclosure mainly comprises a compound represented by AB0.5-w-x-y-zCwEuxSmyLnzW0.5O3. A is one or more elements selected from the group consisting of alkaline earth metals and mainly contains Ca. B is one or more elements selected from the group consisting of divalent metals and mainly contains Mg. C is one or more elements selected from the group consisting of alkali metals and mainly contains Li, Na, or Li and Na. Ln is one or more elements selected from the group consisting of rare earth elements excluding Eu and Sm. w, x, y, and z meet the following conditions: 0.05≦w≦0.25, 0.05≦x+y≦0.25, 0.0≦y≦0.02, and w=x+y+z.
US09376612B2
Novel TCDA/ZnO compositions in which the ZnO particles have an average particle size less than 100 nm are disclosed. Reversible thermochromatic sensors employing the TCDA nanocomposites and methods of printing TCDA/ZnO nanocomposite thin films forming the reversible thermochromatic sensors using inkjet printing techniques are also disclosed.
US09376602B2
The invention provides a process for preparing a thixotropic agent based on a urea derivative, in which the components α) comprising at least one amine and β) comprising at least one isocyanate, are supplied separately to a mixing means and are mixed with one another, the reaction mixture being discharged by spraying or squirting from the mixing means. Further disclosed is the use of the thixotropic agent in a fluid system. The process is especially suitable for preparing adhesives and sealants.
US09376600B2
A self-supporting extendable material, such as tape used for sealing, tape for adhering two surfaces together. More specifically, coated extendable self-supporting materials such as adhesive tapes, papers, and adhesive sheets may be used in the manufacture of adhesive tapes and papers, wherein a length of tape or other material extends rigidly a certain distance and does not coil or curl onto itself, or curl or coil prematurely onto the receiving substrate. Yet, the material maintains flexibility to be pliable and generally to conform to a surface to which it may be applied. The material is available in sheet form or as roll goods.
US09376599B2
The present disclosure provides an adhesive article comprising a foam layer having first and second major sides and a pressure sensitive adhesive layer associated with at least one of the major sides for the foam layer, said pressure sensitive adhesive layer comprising a cross-linked rubber and wherein the foam layer comprises an acrylic polymer obtainable by polymerization a polymerizable composition comprising one or more alkyl acrylates having an average of 3 to 14 carbon atoms in the alkyl groups, one or more polar monomers and one or more multi-functional monomers having at least two free radical polymerizable groups.
US09376597B2
The invention provides adhesives comprising at least one polymer component which contains at least 65 weight percent propylene, at least one nucleator and at least one functionalized wax. The inventive adhesives have increased heat resistance and decreased set-time, making them particularly well suited for assembly and packaging applications.
US09376596B2
There is provided an adhesive film, comprising: an insulator film; an adhesive layer formed on the insulator film; and an intermediate adhesive layer interposed between the insulator film and the adhesive layer, wherein the intermediate adhesive layer is made of a mixed resin composition of a copolyamide being a crystalline resin solvable in a non-halogen based organic solvent and having a melting point of 100° C. or more and 150° C. or less, and a non-crystalline resin, and the intermediate adhesive layer contains a non-halogen flame retardant by 100 pts. wt. or more and 250 pts. wt. or less with respect to 100 pts. wt. of the mixed resin composition.
US09376594B2
There is provided a polishing composition capable of suppressing formation of a stepped portion caused by etching of a surface of a polishing object including a portion containing a group IV material when the polishing object is polished. The present invention relates to a polishing composition for polishing of a polishing object including a portion that contains a group IV material, and the polishing composition contains an oxidizing agent and an anticorrosive agent. Preferably, the anticorrosive agent includes at least one selected from the group consisting of compounds in which two or more carbonyl groups contained in a molecule are bonded through a carbon atom in the molecule. To be more specific, preferably, the anticorrosive agent includes at least one selected from the group consisting of a 1,3-diketone compound, a 1,4-diketone compound, and a triketone compound.
US09376593B2
Disclosed herein are coating materials and methods for applying a top-layer coating that is durable, abrasion resistant, highly transparent, hydrophobic, low-friction, moisture-sealing, anti-soiling, and self-cleaning to an existing conventional high temperature anti-reflective coating. The top coat imparts superior durability performance and new properties to the under-laying conventional high temperature anti-reflective coating without reducing the anti-reflectiveness of the coating. Methods and data for optimizing the relative thickness of the under-layer high temperature anti-reflective coating and the top-layer thickness for optimizing optical performance are also disclosed.
US09376589B2
Disclosed herein are single layer transparent coatings with an anti-reflective property, a hydrophobic property, and that are highly abrasion resistant. The single layer transparent coatings contain a plurality of oblate voids. At least 1% of the oblate voids are open to a surface of the single layer transparent coatings.
US09376587B2
A pigment dispersion and a method for preparing the same are provided. The pigment dispersion comprises the following components in the following mass percentage: 10%˜20% pigment, 1.5%˜12% dispersant, 0.75%˜7.5% binder resin, 58.5%˜87.3% solvent and 0.45%˜2% nonionic surfactant, based on the total mass of the pigment dispersion. The pigment dispersion is improved in stability, and is applicable to a colored filter.
US09376586B2
Disclosed are coating compositions including (A) at least one member selected from hydroxyl-containing polyacrylate, polymethacrylate, polyurethane, polyester, polysiloxane, and combinations of two or more of the foregoing, (B) at least one compound having blocked isocyanate groups and having alkoxysilane groups,wherein (i) the hydroxyl groups of component (A) are blocked with at least one acyclic orthoester, (ii) the compound (B) has at least one structural unit (II) —N(X—SiR″x(OR)3-x)n(X′—SiR″y(OR)3-y)m (II), where R=hydrogen, cycloalkyl radical or alkyl radical, X,X′=linear and/or branched alkylene or cycloalkylene radical having 1 to 20 carbon atoms, R″=alkyl, cycloalkyl, aryl or aralkyl, n, m, x, y=0 to 2, and also m+n=2, and (i) at least 90 mol % of the alkoxysilane groups are ethoxysilane groups. Also disclosed are multistage coating processes, use of the compositions as clearcoat materials and application of the processes for automotive OEM finishing.
US09376584B2
An image transfer member (ITM) is provided with a skin over its surface in which the skin incorporates a hygroscopic agent. The hygroscopic agent is operable to make the ITM skin very hydrophilic or to provide a high surface energy. One such hygroscopic agent is glycerol that may be applied to the surface of the ITM with a carrier, such as water. In an image transfer process, the carrier is completely or partially removed, such as by drying, leaving a thin skin of the hygroscopic agent. Ink drops applied in an image pattern onto the skin spread without puddling or draw-backs, producing an optimum wet image.
US09376582B1
A method of printing with water-based inkjet inks on a water-impermeable, low-surface-energy substrate, includes: a) modifying surface properties of the substrate to increase the surface energy; b) coating the modified surface of the substrate with a first layer comprising a colorless water-based tie-layer composition; c) coating over the first layer with a second layer including a colorless and transparent water-based ink-receptive composition including: i) a water-soluble multivalent metal salt; and ii) a hydrophilic binder polymer; d) depositing directly on the surface of the second layer one or more water-based ink compositions containing an anionically stabilized pigment colorant, wherein the one or more water-based ink compositions are deposited in a predetermined pattern with an inkjet deposition system in response to electrical signals; and e) drying the first and second coated layers and the deposited inks to substantially remove the water.
US09376575B2
The present invention is directed to a water-based paint composition for concrete and masonry surfaces, a method of coating a concrete or masonry surface, and a corresponding method of preparing a coated concrete or masonry surface. The paint composition includes about 10-50% by weight water, about 5-40% by weight colloidal silica particles, about 40-85% by weight of an inorganic pigment, and about 1-10% by weight of a polymer binder. The paint composition provides the coated surfaces with excellent resistance to a wide variety of weather conditions, and alleviates health and safety concerns associated with long-term exposure to conventional organic-based paints.
US09376574B2
The present invention relates to a method for producing a multilayer coating film, which comprises steps of applying a waterborne intermediate coating composition on an electrodeposited coating film to form an intermediate coating film; applying a waterborne base coating composition on the intermediate coating film to form a base coating film; applying a clear coating composition on the base coating film to form a clear coating film; and simultaneously baking and curing the intermediate coating film, the base coating film applied thereon, and the clear coating film further applied thereon in order to form a multilayer coating film, wherein the waterborne intermediate coating composition comprises an emulsion of a hydroxyl group-containing acrylic resin comprising 27 to 65% by weight of a styrene monomer, wherein the emulsion has a water-tolerance within a range of from 0.2 to 5 and a hexane-tolerance within a range of from 5 to 25; a hydroxyl group-containing polyester resin; a melamine resin; a carbodiimide; and an associative thickener, wherein the associative thickener comprises an urethane compound (A) represented by the formula (1), and an urethane compound (B) represented by the formula (2): R—(OA)m-O—C(═O)—NH—Y—NH—C(═O)—O-(AO)n—R (1) R—(OA)a-[O—C(═O)—NH—Y—NH—C(═O)—(OA)b]c-O—C(═O)—NH—Y—NH—C(═O)—O-(AO)d—R (2) wherein R independently represents a hydrocarbon group having 8 to 24 carbon atoms, Y independently represents a residue resulted from a removal of two isocyanate groups from a diisocyanate, OA independently represents an oxyalkylene group having 2 to 4 carbon atoms, AO independently represents an alkyleneoxy group having 2 to 4 carbon atoms, O represents an oxygen atom, C represents a carbon atom, N represents a nitrogen atom, m independently represents an integer of 20 to 500, n independently represents an integer of 20 to 500, a independently represents an integer of 1 to 100, d independently represents an integer of 1 to 100, b represents an integer of 40 to 500, c represents an integer of 1 to 5, b by c (or b×c) represents an integer of 150 to 2500, and R may be the same or different, and Y may be the same or different, wherein each of the urethane compounds (A) and (B) has at least 80% by weight of oxyethylene groups and ethyleneoxy groups relative to the total weight of the oxyalkylene groups and the alkyleneoxy groups, wherein weight ratio of the hydroxyl group-containing acrylic resin emulsion to the associative thickener is within a range of from 100/0.1 to 100/50 as a basis of the solid content, in order to provide the multilayer coating film with an excellent exterior appearance by a three coating and one baking (3C1B) procedure, wherein viscosity of the intermediate coating composition is controlled, and furthermore, ratio of hydrophilicity to hydrophobicity of the resin in the intermediate coating composition is controlled, in order to significantly suppress sagging of the waterborne intermediate coating composition during the coating procedure.
US09376570B2
The present invention relates to azo dyes of formula (1), wherein R1 denotes C1-C12alkyl which is unsubstituted or substituted by one or more C1-C12alkoxy groups, hydroxyl groups, amino groups, cyano groups or halogen atoms and which may be interrupted one or more times by the radical —O—, —S—, —COO— or —OOC—: R4 is hydrogen or C1-C12alkyl; either R2 is cyano and R3 is halogen or R2 is halogen and R3 is cyano; and Ar represents a carbocyclic or heterocyclic aromatic radical, to the process for the preparation thereof, to mixtures containing said dyes and to the use thereof in dyeing or printing semi-synthetic and especially synthetic hydrophobic fiber materials, more especially textile materials.
US09376568B2
Cyanine dyes with improved fluorescence intensity and photostability.
US09376566B2
An elastomeric composition and method incorporating a hydrocarbon polymer modifier with improved permanence. The composition comprises elastomer, filler and silane-functionalized hydrocarbon polymer modifier (Si-HPM) adapted to couple the Si-HPM to the elastomer, filler or both, wherein the Si-HPM comprises an interpolymer of monomers chosen from piperylenes, cyclic pentadienes, aromatics, limonenes, pinenes, amylenes, and combinations thereof. The method comprises melt processing a mixture to form the elastomeric composition in the shape of an article, wherein the mixture comprises elastomer, Si-HPM, silica, bifunctional organosilane crosslinking agent; and curing the elastomeric composition to form the article. Also disclosed are a silylated hydrocarbon polymer modifier coupled with a bifunctional organosilane crosslinking agent, and a silica-coupled hydrocarbon polymer modifier coupled to the silica via the bifunctional organosilane crosslinking agent.
US09376562B2
A thermoplastic composition comprising from 60 percent to 99 percent by weight of one or more thermoplastic polymers; and from 40 percent to 1 percent by weight of an additive comprising a crosslinked (meth)acrylate polymer, wherein the crosslinked methylmethacrylate polymer comprises at least 99.5 percent by weight derived from methyl methacrylate units, and from greater than zero to less than 0.5 percent by weight derived from one or more multifunctional crosslinking monomers; wherein the crosslinked (meth)acrylate polymer has a volume average particle size of equal to or less than 1.0 micron; and wherein an article produced from the scratch-resistant thermoplastic composition has a hardness of greater than F is provided. Also provided are a method of making the thermoplastic composition, articles made from the polycarbonate composition, and a method of making the articles.
US09376549B2
Process for providing a polypropylene composition comprising a branched polypropylene in which a polypropylene with a melt flow rate MFR2 (230° C.) of more than 1.0 g/10 min is reacted with a thermally decomposing free radical-forming agent and optionally with a bifunctionally unsaturated monomer obtaining thereby the branched polypropylene, wherein the polypropylene composition has a F30 melt strength of more than 5.8 cN and a v30 melt extensibility of more than 200 mm/s.
US09376544B2
The invention relates to a silicon dioxide dispersion that comprises a) an outer flowable phase containing 1) polymerizable monomers, oligomers and/or prepolymers that can be converted to polymers by non-radical reaction; and/or 2) polymers, and b) a disperse phase containing amorphous silicon dioxide. The inventive dispersion is characterized in that the average particle size dmax of the silicon dioxide as measured by small angle neutron scattering (SANS) is between 3 and 50 nm at a maximum half-width of the distribution curve of 1.5 dmax. Such a silicon dioxide dispersion can be easily manufactured even at higher concentrations of the disperse phase and can be used to produce polymer materials that have advantageous properties, especially advantageous mechanical properties.
US09376523B2
Copolymers comprising a block of polyvinyl alcohol) and a block of a polyvinyl ester. Copolymers comprising a block of polyvinyl haloalkanoate) and a block of a polyvinyl ester). Methods of making copolymers comprising a block of polyvinyl alcohol) and a block of a polyvinyl ester. Methods of making copolymers comprising a block of polyvinyl haloalkanoate) and a block of a polyvinyl ester). The copolymers may be incorporated into aqueous dispersions to form micelles or hydrogels. Some copolymers are biodegradable and have surfactant properties.
US09376520B2
To produce a PTFE aqueous emulsion, whereby the environmental load is little, the stability of the aqueous emulsion is high, and a molded product having high heat resistance can be obtained. A process for producing a PTFE aqueous emulsion, which comprises emulsion-polymerizing tetrafluoroethylene (TFE) by means of at least one fluorinated emulsifier selected from the group consisting of a C4-8 fluorinated carboxylic acid having from 1 to 4 etheric oxygen atoms in its main chain, and its salts, to obtain an aqueous emulsion containing polytetrafluoroethylene (PTFE) microparticles having an average primary particle size of from 0.1 to 0.3 μm, wherein at the beginning of the emulsion polymerization of TFE, a (polyfluoroalkyl)ethylene (a) represented by “CH2═CH—Rf1”, and/or a comonomer (b) having a monomer reactivity ratio rTFE of from 0.1 to 8 in copolymerization with tetrafluoroethylene, is incorporated to the emulsion polymerization system, so as to be from 0.001 to 0.01 mass % relative to the final amount of polytetrafluoroethylene produced.
US09376517B2
Process for the polymerization of monomer in a polymerization system having at least one component attached thereto which is flushed with a flush medium which enters the polymerization system. Initially, the component is flushed with a first flush medium, and subsequently the component is flushed with a second flush medium which differs in composition from the first flush medium. A flush gas containing monomer is used as the flush medium when the polymer production rate is above 10 Te/h.
US09376516B2
A porous polymer structure may be formed by cooling a substrate to a temperature at or below a freezing point of a monomer, wherein the monomer is capable of free-radical polymerization; exposing the substrate to an initiator and the monomer, each in a vapor phase, wherein a concentration of the monomer in the vapor phase is above a saturation pressure of the monomer; converting the initiator to a free radical; crystalizing and depositing the monomer on the substrate; and polymerizing at least some of the monomer on the substrate, thereby forming a porous polymer structure on the substrate.
US09376515B2
A production method for a vinyl ether polymer of the present technology is a production method for a vinyl ether polymer, wherein a vinyl ether monomer is subjected to living radical polymerization using a polymerization initiator, a monovalent copper compound, a ligand which is coordinated to the above copper compound, and ascorbic acid in a solvent. The above solvent has a mass ratio of isopropyl alcohol to water from 30:70 to 0:100. A mass ratio of the above vinyl ether monomer to the above solvent is from 10:100 to 25:100. A molar ratio of copper in the above copper compound to the above ascorbic acid is from 1:0.5 to 1:2.
US09376510B2
A reactive emulsifier comprising a compound of formula (I), which makes polymerization stability satisfactory and is capable of improving the water resistance etc. of the polymer film to be obtained. In the formula (I), D represents a polymerizable unsaturated group represented by the chemical formula D-1 or D-2; m1 represents a number of 1 or larger; R1 represents an alkyl group having 1 to 12 carbon atoms; m2 represents a number of 0 to 4; and the sum of m1 and m2 is 1 to 5. R2 represents a hydrocarbon group having 6 to 30 carbon atoms; A represents either an alkylene group or a substituted alkylene group which has 2 to 4 carbon atoms; and n is in the range of 0 to 1,000. X represents a hydrogen atom or an anionic hydrophilic group which is —(CH2)a—SO3M etc. R3 represents a hydrogen atom or methyl.
US09376509B2
An extended anionic surfactant having the general formula: RO—(PO)n-YZ wherein R is a linear alkyl chain ranging from C6 to C36, a branched alkyl chain ranging from C6 to C36, or a mixture thereof; PO is a propyleneoxy group; Y is —SO3, —CH2CH2CH2—SO3, —CH2CH(CH3)—SO3, or —CH2COO; Z is a cation; and n is 1 to 50.
US09376494B2
The invention provides antibodies that specifically bind to Kallidin or des-Arg10-Kallidin. The invention also provides pharmaceutical compositions, as well as nucleic acids encoding anti-Kallidin or des-Arg10-Kallidin antibodies, recombinant expression vectors and host cells for making such antibodies, or fragments thereof. Methods of using antibodies of the invention to modulate Kallidin or des-Arg10-Kallidin activity or detect Kallidin or des-Arg10-Kallidin or, either in vitro or in vivo, are also provided by the invention. The invention further provides methods of making antibodies that specifically bind to des-Arg9-Bradykinin and des-Arg10-Kallidin-like peptide.
US09376492B2
The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.
US09376491B2
The present invention provides stabilized pharmaceutical formulations for anti-IL-17 antibodies, comprising e.g. citrate, sodium chloride and polysorbate-80 at pH 5.7. These stabilized anti-IL-17 antibody pharmaceutical formulations can be used to treat rheumatoid arthritis, psoriasis, ankylosing spondilitis, psoriatic arthritis or multiple myeloma.
US09376487B2
The present invention relates to methods of inducing an immune response to Staphylococcus comprising administering a composition comprising an SA2493-related polypeptide from Staphylococcus aureus as well as derivatives or fragments thereof. The present invention also encompasses methods of treating and/or reducing the likelihood of a Staphylococcus infection by administering a composition comprising an SA2493-related polypeptide or an antibody that specifically binds to an SA2493 polypeptide, derivative or fragments thereof. Compositions administered in the methods of the invention can include one or more additional antigens including, but not limited to, IsdB. Compositions used to practice the methods of the invention are also encompassed.
US09376482B2
The present invention relates to a method for producing a cell line expressing a stabilized functional single chain-antigen-recognizing genetic construct (scARC), comprising a genetic construct of the human scARC to be expressed, comprising the domains huV1/2—Li-huV2/1—C4/3 and a genetic construct comprising the corresponding hetero-/(homo-)dimeric domain C3/4, containing xenogenic, in its special case murine amino acid exchanges in the domains C4/3 and C3/4, wherein co-expression of the genetic constructs of the scARC-fragments occurs through the cell. Preferably, the scARCs are single chain-TCRs (scTCRs) or antibody-scFv-fragments, which further preferably recognize tumor associated peptide antigens (TAA). The present invention further relates to a gp100-protein-specific T-cell response mediated α/β T-cell receptor rationally mutated by means of the method of the present invention and its uses.
US09376478B1
Disclosed is a recombinant plasmid having a gene which encompasses at least the entire coding region of human fibroblast interferon messenger RNA and a method for preparing such plasmid.
US09376475B2
Disclosed are a protein encoded by a gene having a nucleotide sequence represented by any of SEQ ID NOs: 1 to 65 or a fragment thereof, an antibody recognizing the protein or antigen-binding fragment thereof, and a polynucleotide having a sequence comprising at least 12 consecutive nucleotides of a nucleotide sequence represented by any of SEQ ID NOs: 1 to 65 or a nucleotide sequence complementary thereto. The gene and the protein of the invention is useful for diagnosing and treating cancer.
US09376474B1
The present invention relates to chromatography matrices including ligands based on one or more domains of immunoglobulin-binding proteins such as, Staphylococcus aureus Protein A (SpA), as well as methods of using the same.
US09376473B2
The present invention is directed to methods and agents used for treating cancer in Toll-Like Receptor 5-expressing tissues by providing a Toll-Like Receptor agonist such as flagellin. The present invention also relates to protecting the liver from a liver toxicity using a Toll-like receptor agonist.
US09376471B2
Improved anti-HIV immunogens and nucleic acid molecules that encode them are disclosed. Immunogens disclosed include those having consensus sequences for HIV Subtype A Envelope protein, those having consensus sequences for HIV Subtype B Envelope protein, those having consensus sequences for HIV Subtype C Envelope protein, those having consensus sequences for HIV Subtype D Envelope protein, those having consensus sequences for HIV Subtype B consensus Nef-Rev protein, and those having consensus sequences form HIV Gag protein subtypes A, B, C and D. Improved anti-HPV immunogens and nucleic acid molecules that encode them; improved anti-HCV immunogens and nucleic acid molecules that encode them; improved hTERT immunogens and nucleic acid molecules that encode them; and improved anti-Influenza immunogens and nucleic acid molecules that encode them are disclosed as well methods of inducing an immune response in an individual against HIV, HPV, HCV, hTERT and Influenza are disclosed.
US09376466B2
The present invention relates to compositions, including membrane permeable complexes, comprising a Caspase 2 activation inhibitory peptide having the amino acid sequence AFDAFC as well as methods of using the same for the treatment of neurodegenerative conditions associated with apoptosis in the central nervous system, such as Alzheimer's Disease, Mild Cognitive Impairment, Parkinson's Disease, amyotrophic lateral sclerosis, Huntington's chorea, and Creutzfeld-Jacob disease.
US09376463B2
The present invention relates to a process for purification of a target biomolecule, comprising the steps: (a) contacting (i) a target biomolecule, (ii) a dual affinity polypeptide, and (iii) a solid support comprising a catching ligand, wherein the ratio between the equilibrium dissociation constants of the dual affinity polypeptide, [KD,t/KD,s], is at least 100 at standard conditions; and (b) recovering the target biomolecule by elution.
US09376462B2
Processes for preparing lanostane triterpenes from the medicinal mushroom Ganoderma lucidum, and related compounds are described. Compounds, compositions, and methods for treating cancer are also described.
US09376449B2
The present invention relates to indole carboxamide compounds of formula (I) or a salt thereof wherein R2, R3, R4, R6, R7, R8, R51 and R52 have the meanings as indicated herein, and are MT1 and/or MT2 receptor agonists useful for treating and/or preventing urological diseases.
US09376447B2
Provided herein is a process for the transfer-hydrogenation of ketone analogs of members of the jervine type of Veratrum alkaloids, such as cyclopamine. Also provided herein are novel ruthenium transfer-hydrogenation catalysts.
US09376442B2
The compounds of Formula (I), wherein R1, R2, R21, R22, R23, R24, Y and R3 have the meanings as given in the description, the salts thereof, the stereoisomers of the compounds and the salts thereof are effective inhibitors of the type 5 phosphodiesterase and are useful for treating or preventing idiopathic pulmonary lung fibrosis.
US09376439B2
The present invention provides salt forms of (R)-3-(4-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-1H-pyrazol-1-yl)-3-cyclopentylpropanenitrile that are useful in the modulation of Janus kinase activity and are useful in the treatment of diseases related to activity of Janus kinases including, for example, immune-related diseases, skin disorders, myeloid proliferative disorders, cancer, and other diseases.
US09376438B2
The present disclosure provides compounds of Formula (I)and pharmaceutically acceptable salts that are tyrosine kinase inhibitors,in particular BLK, BMX, EGFR, HER2, HER4, ITK, Jak3, TEC, Btk, and TXK and are therefore useful for the treatment of diseases treatable by inhibition of tyrosine kinases such as cancer and inflammatory diseases such as arthritis, and the like. Also provided are pharmaceutical compositions containing such compounds and pharmaceutically acceptable salts and processes for preparing such compounds and pharmaceutically acceptable salts.
US09376435B2
Aromatic diimide chromophores and methods for using the chromophores for the detection of volatile organic compounds are described. The chromophores are able to reversibly change colors in the presence or absence of volatile organic compounds.
US09376432B2
This invention is related to the use of inhibitors of vascular endothelial growth factor receptor 3 for treating hepatocellular carcinoma.
US09376428B2
Methods of producing OLED materials containing fluorene ring systems in which two alkyl substituents at the 9-position of fluorene ring are alkyl substituted through key intermediates generically represented by the formula: where X represents a substituent that increases the acidity of the hydrogen atoms on the adjoining methylene group (which is immediately adjacent the fluorene ring systems 9 -position).
US09376427B2
The present inventors have surprisingly found that rivaroxaban of formula I can be prepared in a one-pot process, in high purity and with high yield, by reacting 5-chlorothiophene-2-carboxylic acid or a salt thereof with a sulfonylating agent to produce a sulfonyl ester intermediate, which is then condensed with 4-[4-[(SS)-5-(aminomethyl)-2-oxo-1,3-oxazolidin-3-yl]phenyl]morpholine-3-one or an acid addition salt thereof to produce rivaroxaban.
US09376425B2
The present invention provides MDM2 inhibitor compounds of Formula I or II, or the pharmaceutically acceptable salts thereof, wherein the variables are defined above, which compounds are useful as therapeutic agents, particularly for the treatment of cancers. The present invention also relates to pharmaceutical compositions that contain an MDM2 inhibitor.
US09376423B2
The present invention relates to new AGC kinase inhibitors, in particular to compounds of Formula I or II or a stereoisomer, tautomer, racemic, metabolite, pro- or pre-drug, salt, hydrate, or solvate thereof, wherein Ar, Cy, R1, R3, p and n have the meaning defined in the claims. In particular, the present invention relates to more specifically AGC kinases inhibitors, compositions, in particular pharmaceuticals, comprising such inhibitors, and to uses of such inhibitors in the treatment and prophylaxis of disease.
US09376410B2
This invention disclose (2R)-2-deoxy-2,2-disubstituted-ribono-1,4-lactone in a single configuration and preparation method and use thereof. The (2R)-2-deoxy-2,2-disubstituted-ribono-1,4-lactone, or a pharmaceutically acceptable salt, an ester, a prodrug or a solvate thereof according to the invention are important intermediates of a variety of anti-viral and anti-tumor active ingredients. A compound obtained from (2R)-2-deoxy-2,2-disubstituted-ribono-1,4-lactone via an acylation reaction can be directly used for preparing various anti-viral and anti-tumor drugs. The Chiral synthesis method and the spontaneous resolution method of the compound of (2R)-2-deoxy-2,2-disubstituted-ribono-1,4-lactone according to the invention have the following advantages: the reaction routes are short and simple with high yield and low cost, which are suitable for industrial application.
US09376400B2
The present invention relates to processes for the preparation of triazoles. These compounds are useful as anti-infective, anti-proliferative, anti-inflammatory, and prokinetic agents.
US09376398B2
The present disclosure concerns at least one entity chosen from compounds of Formula (I) and pharmaceutically acceptable salts thereof: (I) wherein the variable groups X, R1, R2, R3 m, n and p are as defined herein. The present disclosure also relates to methods for the preparation of at least one such entity, and intermediates useful in the preparation thereof, to pharmaceutical compositions containing at least one such entity, to the use of at least one such entity in the preparation of medicaments, and to the use of at least one such entity in the treatment of conditions such as, for example, allergic diseases, autoimmune diseases, viral diseases, and cancer.
US09376397B2
The present invention relates in general to the field of organic chemistry and in particular to the preparation of N-(4-(4-fluorophenyl)-6-isopropyl-5-methylpyrimidin-2-yl)-N-methylmethanesulfonamide (I), N-(4-(4-fluorophenyl)-5-(bromomethyl)-6-isopropylpyrimidin-2-yl)-N-methylmethanesulfonamide (II) and N-(4-(4-fluorophenyl)-5-(hydroxymethyl)-6-isopropylpyrimidin-2-yl)-N-methylmethanesulfonamide (III), key intermediates in preparation of Rosuvastatin.
US09376391B2
The present invention relates to novel difluoromethyl-nicotinic indanyl carboxamides, to processes for preparing these compounds, to compositions comprising these compounds, and to the use thereof as biologically active compounds, especially for control of harmful microorganisms in crop protection and in the protection of materials.
US09376382B2
The present invention provides an N-substituted isopropyldimethyl azulene sulfonamide derivative as represented by formula (I), and preparation method and uses thereof, wherein R1 is an alkyl, cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, amino, or a substituted alkyl, cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, and amino. The N-substituted isopropyldimethyl azulene sulfonamide derivative can be used in treating gastric ulcer.
US09376378B2
A carbamate-functional material is prepared by reacting a carbamate compound with a hydroxy-functional material using zirconium acetylacetonate as catalyst.
US09376374B2
The present invention relates to a novel process for preparing cis-alkoxy-substituted spirocyclic phenylacetylamino acid esters and cis-alkoxy-substituted spirocyclic 1H-pyrrolidine-2,4-dione derivatives, and also to novel intermediates and starting materials which are produced and/or used in the process according to the invention.
US09376370B2
A purification method of 1,4-diaminobutane, 1,4-diaminobutane purified using the purification method, and a polyamide prepared using the purified 1,4-diaminobutane are provided. The purification method of 1,4-diaminobutane includes: concentrating a fermentation solution including at least one of 1,4-diaminobutane and a salt thereof to obtain a concentrate; adding a base to the concentrate of the fermentation solution to prepare an basic composition having a pH 12 or higher; and recovering 1,4-diaminobutane from the basic composition.
US09376366B2
The invention relates to a method for preparing a compound of formula (I), wherein n is an integer from 1 to 21, said method comprises reacting a light olefin fraction, in the presence of a metathesis catalyst, with a compound having from 10 to 24 carbon atoms, of the following formula (II): wherein, n is an integer from 1 to 21, R corresponds to a hydrogen atom or an alkyl or alkenyl chain from 1 to 20 carbon atoms optionally substituted by at least one hydroxyl group, said compound of formula (II) being used alone or in a mixture of compounds of formula (II).
US09376363B2
The present invention provides a method to effectively inhibit the oxidization of VO(acac)2 in solution for months. It is believed that VO(acac)2 forms a π-complex with as many as three allylic alcohols which precludes reaction with any oxygen in the system. Although saturated and homo-allylic alcohols were also tested, this effect appears only in the allylic-alcohol based solutions. This ability to inhibit oxidation of VO(acac)2 allows these solutions to be used for making thermochromic VO2 film much more easily and economically as it avoids the requirement of operating under low oxygen level conditions. Thus the present invention provides a method of stabilizing vanadium oxyacetylacetonate (VO(acac)2) in solution against oxidation for extended periods of time, comprising the steps of mixing the oxyacetylacetonate precursor in an allylic alcohol prior to spin-coating for VO2 film formation. The allylic alcohol may be β-methallyl alcohol. Alternatively, the allylic alcohol may be any one of 4-buten-2-ol, 2-buten-1-ol, 1-penten-3-ol, 2-hexen-1-ol and 1-hexen-3-ol.
US09376360B2
A method for starting up a DME synthesis reactor in which methanol is converted by dehydration to dimethyl ether on a solid catalyst, wherein the catalyst is heated up with condensing methanol vapor, possibly in several steps. In a final treatment step with superheated methanol vapor, the catalyst is dried and its temperature is raised to the starting temperature of the methanol dehydration.
US09376355B2
Digestion of cellulosic biomass solids may be complicated by release of lignin therefrom. Methods for digesting cellulosic biomass solids may comprise: providing cellulosic biomass solids in the presence of a digestion solvent, molecular hydrogen, and a slurry catalyst capable of activating molecular hydrogen; at least partially converting the cellulosic biomass solids into a phenolics liquid phase comprising lignin, an aqueous phase comprising a glycol derived from the cellulosic biomass solids, and an optional light organics phase; wherein at least a portion of the slurry catalyst accumulates in the phenolics liquid phase as it forms; combining the glycol with the phenolics liquid phase, thereby forming a combined phase; and heating the combined phase in the presence of molecular hydrogen; wherein heating the combined phase reduces the viscosity of the phenolics liquid phase and transforms at least a portion of the glycol into a monohydric alcohol.
US09376352B2
A start-up method of a bubble column slurry bed reactor for producing hydrocarbons includes: a first step that fills into a reactor a slurry in which a Fischer-Tropsch synthesis reaction catalyst particles are suspended in a slurry preparation oil with a 5% distillation point of 120 to 270° C., a 95% distillation point of 330 to 650° C., and a sulfur component and an aromatic component of 1 mass ppm or less, and a second step that, in a state where synthesis gas that is primarily hydrogen and carbon monoxide is introduced into the slurry filled into the reactor, raises the temperature of the reactor and starts the Fischer-Tropsch synthesis reaction. As the slurry preparation oil, one containing predetermined components in preset amounts is used. In the first step, the slurry is filled into the reactor in an amount in which airborne droplets do not flow out.
US09376348B2
A process for obtaining granules for manufacturing a silicon carbide based sintered product, includes a) mixing a powder of silicon carbide SiC particles, whose average diameter d50 is at least about 2 micrometers with a powder of a boron compound particles, whose average diameter d50 is at least about 2 micrometers, the SiC particles content being more than 90% by weight of the powder mixture; b) co-milling the powder mixture until the overall average diameter d50 of the resulting particles is between 0.3 and 1 micrometers; c) chemically treating the powder mixture by base solution and acid wash; d) mixing the powder mixture of c) with 1 to 10% by weight, based upon the silicon carbide content, of a carbon containing resin having a water miscibility of more than 10:50, as measured according to the ISO8989 standard, and e) spray-drying the resulting mixture of d), to generate the granules.
US09376342B2
The present invention relates to an admixture for a cementitious composition and a method using said admixture for manufacturing a durable cementitious composition, in particular a concrete, in cold weather conditions, such as in winter time or in cold geographical areas.
US09376337B2
Provided is a method capable of producing a glass sheet with a bent portion in which a flattened portion has high flatness and high smoothness. A flat glass sheet 20 is radiationally heated with a first portion 21 thereof held between first and second heat-insulating members 31, 32. And then, a second portion 22a, 22b of the flat glass sheet 20 not held between the first and second heat-insulating members 31, 32 is bent.
US09376329B2
A method oxidizes ferrous iron to ferric iron. The method includes providing a liquid, which includes the ferrous iron, and a gas, which includes an oxidizing agent, such as oxygen and/or chlorine; providing two separate mixes, with both mixes including the gas and the liquid; and colliding the separate mixes, thereby obtaining the ferric iron.
US09376328B2
Methods of making iron-based ferrite nanocrystals are provided. In such methods the ferrite may include iron oxides and iron/cobalt or iron/manganese mixed salts. The method may include thermal decomposition of one or more precursors of the ferrite, consisting of an organic salt of the metal or metals constituting the ferrite of interest, comprising the operation of heating a solution comprising said precursor(s) in the presence of a surfactant and of a non-aqueous organic solvent comprising an ether, at temperature sufficient to cause thermal decomposition of said precursor, wherein the solvent may further comprise a saturated or unsaturated, linear or branched aliphatic hydrocarbon, liquid at temperatures above 45° C. and having a boiling point above the boiling point of the ethereal solvent.
US09376324B2
Compositions and methods for introducing mesoporosity into zeolitic materials employing sequential acid, surfactant, and base treatments are disclosed herein. Mesopores can be introduced into zeolitic materials, such as zeolites, by treatment with an acid and surfactant followed by treatment with a base. The resulting mesoporous zeolitic materials can have a total 20 to 135 Å diameter mesopore volume of at least 0.05 cc/g. Additionally, the resulting mesoporous zeolitic materials can have a total 0 to 20 Å micropore volume of at least 0.10 cc/g.
US09376314B2
A method for manufacturing a micromechanical system includes forming in a Front-End-of-Line (FEOL) process transistors in a transistor region; after the FEOL-process, forming a sacrificial layer; structuring the sacrificial layer to form a structured sacrificial layer; forming a functional layer at least partially covering the structured sacrificial layer; and removing the sacrificial layer to create a cavity.
US09376313B2
According to an aspect of the invention, a functional element includes a substrate which is provided with a concave section; a stationary section connected to a wall section that defines the concave section of the substrate; an elastic section which extends from the stationary section and is capable of stretching and contracting in a first axis direction; a movable body connected to the elastic section; a movable electrode section which extends from the movable body. The concave section includes a cutout section which is provided on the wall section. The stationary section includes an overlap section which is spaced with the substrate, and overlaps the concave section when seen in a plan view. At least a portion of the overlap section overlaps the cutout section when seen in the plan view, and the elastic section extends from the overlap section.
US09376309B2
According to an aspect of the inventive concept, there is provided a nozzle boot arrangement for supporting a nozzle of a fuel dispensing unit, the nozzle comprising a spout and a base portion including a grip, the arrangement comprising: a nozzle boot including means for supporting the nozzle at the base portion thereof, and a second for receiving at least a portion of the spout, and a stopper provided at said receiving section and formed separately from said nozzle boot, wherein the stopper is arranged to cooperate with the spout to prevent the nozzle from falling about from the nozzle boot arrangement by rotation of the nozzle about said supporting means. According to further aspects, there is provided a fuel dispensing unit, a nozzle boot module and method of manufacturing a nozzle boot arrangement.
US09376308B2
This invention relates to a flexible membrane separation valve, comprising a housing (120), the lateral surfaces of which are provided with slits (121), within which housing (120) a flexible membrane (122) with cylindrical symmetry is housed, within which an insert (130) having a body (131) with cylindrical symmetry is in turn housed, the insert (130) comprising a proximal end (132) having a proximal apex (133) spaced along the longitudinal axis of the insert (130) from a base (134) with cylindrical symmetry, through which the proximal end (132) joins to the body (131), the proximal apex (133) being joined to the base (134) through a continuous surface, the valve being characterized in that the proximal end (132) has an axial section such that tangent lines to the proximal apex (133) form an angle containing the longitudinal axis of the insert that is lower than or equal to 90°.The invention further relates to an apparatus for mixing a liquid comprising such a flexible membrane separation valve.
US09376303B2
A temperature-controlled beverage dispenser is disclosed, which provides a cold plate having disposed therein beverage lines and refrigerant lines. The refrigerant lines may be connected to a cooling system, such as a heat exchanger, which is configured to remove heat from the cold plate. The beverage lines may be connected to a beverage supply for dispensing a desired beverage. Valves and a pressure sensor in the refrigerant line are connected to a microprocessor. At regular intervals, the microprocessor closes the valves, waits a short time, and then takes a pressure reading, which corresponds to a temperature. If the temperature falls below a desired value, then the cooling system is shut off. This permits the microprocessor to closely control the temperature of the beverage being dispensed.
US09376299B2
In some embodiments, a lift actuator is added to a pallet truck to effect initially lifting a load and a traction command effects fully raising the load while a pallet truck moves. In other embodiments, an electronic controller is programmed to effect initially lifting a load when a lift actuator is engaged and to effect fully lifting the load while a pallet truck moves when a traction actuator is engaged.
US09376297B2
Reach truck 1 with a control system 2 for controlling the lowering movement of a fork 10, the control system 2 comprising a height sensor 20, for determining the lifting height h of the fork 10 of the reach truck 1, a proportional electrical hydraulic valve 50 connected to a lifting cylinder 70 of the reach truck 1, for controlling an oil flow of the lifting cylinder 70, and a control unit 30, connected to the height sensor 20 for receiving the actual lifting height h signal and controlling the proportional electrical hydraulic valve 50, wherein the control unit 30 automatically decreases the maximum lowering speed v of the fork 10, by controlling the proportional electrical hydraulic valve 50, according a predetermined maximum speed v curve depending on the lifting height h of the fork 10, and in some embodiments only on the lifting height h of the fork 10, such that the fork 10 is softly stopped at the ground.
US09376292B2
A mobile telescopic crane has a telescopic jib with at least four part-jibs. Each of the part-jibs is constructed from at least two part-jib portions so as to be telescopic in a longitudinal direction. Part-jib portions arranged at a spacing from one another transverse to the longitudinal direction each form a jib portion with at least one flexurally rigid connecting element. A construction of this type of the jib means that an increase in the bearing load is easily achieved by increasing the area moment of inertia of the jib.
US09376291B2
A crane apparatus and method are described for lifting a heavy load such as a wind-turbine generator unit 46 on to a wind-turbine tower 1. The crane is designed to climb up cables 3 attached to the top of the tower, carrying with it the cables 45 and lifting gear 31 which will be required for the main lifting operation. The crane comprises a pair of jib-frames 20 with boom arms 26, 27 which can be retracted during lifting and then deployed to a pivotable, loadbearing position once the crane is mounted at the top of the tower 1. Hydraulic strand jacks 31 and heavy-duty strands 45 are preferably used for the heavy lifting. In a preparation step, a load-bearing bracket assembly 13, 14, to which the jib-frames 20 will be secured, is hoisted up and fitted to the top of the tower 1. Once the lifting operations are complete, the crane assembly and the bracket assembly 13, 14 are lowered from the tower 1 and removed from site.
US09376265B2
There is disclosed a unit for forming a layer of a batch of groups of articles, comprising a first conveyor adapted to convey a plurality of groups in an abutting relationship; and a second conveyor adapted to separate batch from the remaining groups for a gap; unit further comprises manipulating means adapted to manipulate separated batch on an area defined by second conveyor, so as to form layer.
US09376263B2
A system for monitoring an endless belt conveyor, comprising a sensor for sensing a vibration of an idler roller and generating a signal corresponding to the sensed vibration, at least one of the frequency and amplitude of the generated signal being indicative of a condition of the idler roller, the sensor being integral with the endless belt conveyor.
US09376262B2
The present invention relates to screw conveyors, in particular a screw conveyors with a separated drive and sealing device. In an aspect of the invention, the screw conveyor is part of an auger. An embodiment of the invention employs tapered bearings, which can withstand both radial and directional forces. A sealing member can also be included to aid in preventing debris from contacting the bearings.
US09376260B2
A conveyor body for conveying mineral material includes a middle section having a first end and a second end, and a first pivot axis passes through the first end of the middle section, and the middle section is arranged to be pivoted around the first pivot axis from an operation position of the conveyor to a transport position and back to the operation position, and a second pivot axis passes through the second end of the middle section to pivot a head section sideways around the second pivot axis from the operation position of the conveyor which head section is connectable to the middle section through the second pivot axis, wherein the middle section includes a top plate, a bottom plate, and vertical side plates which are fixed between the top plate and the bottom plate. A mineral material processing plant is also disclosed.
US09376257B2
A belt tracking system for controlling the lateral position of a movable belt entrained about a plurality of generally parallel rollers for moving in a trans-axial direction perpendicular to an axial direction in which the rollers extend parallel to each other includes a roller shaft, a slidable member, and a rotation restrictor. The roller shaft extends outward in the axial direction from an axial end of a specific one of the plurality of generally parallel rollers. The slidable member is slidably disposed around the roller shaft to move along the roller shaft as the belt moves laterally outward in the axial direction. The rotation restrictor is disposed adjacent to the slidable member to restrict rotation of the slidable member around the roller shaft.
US09376245B2
This invention relates to a package of a plurality of containers unitized with a flexible carrier. The carrier is constructed from a plastic planar sheet having a plurality of container receiving apertures and a panel or handle positioned with respect to the planar sheet. The panel or handle are preferably cut or printed to form a removable functional or decorative object, such as a bookmark or a wristband.
US09376243B2
A one-piece closure can mount on a container having an aperture. The one-piece closure includes a base portion that inwardly defines an opening centered about a base portion longitudinal axis and that is intended to be mounted on the container neck. The one-piece closure includes a hinged cap that is linked to the base portion by an outside hinge member. The hinge member has two opposite ends that are respectively connected to the base portion and the cap, the cap being movable between a closed position in which it closes the aperture of the base portion and an open position in which the aperture is left clear. The two opposite ends of the hinge member are aligned along an axis that is inclined with respect to the base portion longitudinal axis when the cap is in the closed position.
US09376235B2
A container for beverages has a hollow container body, an electronic device attached to the hollow container body and provided with a display for displaying a running light message, a microprocessor operative for generating a running light message on the display, and a control unit for controlling the microprocessor for carrying out the generation of the running unit message on the display.
US09376224B2
A fluid transfer device for transferring fluid between a supply reservoir and a fill reservoir includes a metering reservoir and a manifold that forms at least part of a first channel that is fluidly connected with the metering reservoir. The first channel comprises a first cannula extending from the manifold. The manifold forms at least part of a second channel fluidly connected with the metering reservoir. The second channel comprises a second cannula extending from the manifold. A third channel extends through the manifold and comprises a third cannula having a first end proximate a distal end of the first cannula and a second end proximate a distal end of the second cannula. A first check valve is disposed within the first channel and a second check valve is disposed within the second channel.
US09376221B1
Methods and Apparatus to point a payload at a target are disclosed herein. An example method includes estimating a first orientation of a base of a payload to point the payload at a target. The base is coupled to a satellite via a pivot joint and a linear actuator. The linear actuator is to enable adjustment of an azimuth angle and an elevation angle of the base. The example method further includes communicating a command to actuate the actuator to move the base to the first orientation and determining a base orientation error. The base orientation error is a difference between the first orientation and a second orientation of the base to which the actuator moves the base in response to the command. The example method also includes determining a stroke position error of the actuator based on the base orientation error.
US09376217B2
To provide a jig for forming a sealant layer for a lightning protection fastener which enables to quickly and accurately obtain a sealant layer having a required thickness. A guide jig 30 is used to form a sealant layer 29 around a fastener member 24 that passes through and fastens a plurality of members constituting an airframe of an aircraft, the jig including: a cup 31 including a cavity 33 to be filled with an uncured sealant 28; and a guide that is provided within the cavity 33 and engaged with the fastener member 24 so as to match a center axis of the cavity 33 with a center axis of the fastener member 24.
US09376215B2
A gas turbine engine includes an engine core, a core cowl extending circumferentially around the engine core, and a pressure actuated latch assembly. The core cowl includes a first cowl section on a first side of the engine core and a second cowl section on a second side of the engine core. The pressure actuated latch assembly connects the first cowl section to a support structure and is actuatable between an unlatched position when pressure within the core cowl is relatively low and a latched position when pressure within the core cowl is relatively high.
US09376203B2
A device for mechanically connecting a control surface to a fixed structural element of an aircraft, including a rotary actuator for driving an element that is securely connected to the control surface in rotation in relation to an element securely connected to the fixed structural element, around an articulation axis, as well as articulation elements for articulating this control surface around this axis. These articulation elements are able to support the control surface independently of the rotary actuator. This arrangement permits taking benefit from the advantageous properties of rotary actuators while allowing removal of the rotary actuator without having first to remove the control surface.
US09376194B1
Idle relief mufflers are configured to discharge exhaust gases from an outboard motor to atmosphere surrounding the outboard motor when an internal combustion engine of the outboard motor is operated at idle and at low speeds. The idle relief mufflers comprise a housing having an open interior, an inlet port configured to convey the exhaust gases to the open interior, and an outlet port configured to discharge the exhaust gases from the open interior. An exhaust grommet is connected to the outlet port. The exhaust grommet comprises a body that is configured to engage with a cowl of the outboard motor and an extension that extends through the outlet port and protrudes into the open interior. The extension and the body together define a through-bore that is configured to convey the exhaust gases from the open interior to the atmosphere.
US09376192B2
A trim and tilt device includes: a cylindrical cylinder; a partition member provided in contact with the cylinder so as to be movable in an axial direction of the cylinder and partitioning a space inside the cylinder; a rod member to which the partition member is attached on one end side of the rod member and which moves relatively in the axial direction of the cylinder together with the partition member thereby adjusting a tilt angle of a marine vessel propelling machine body with respect to a hull; and a rod guide member electrically connected to a sacrificial anode and having a hole so that the rod member passes through the hole, and the rod guide member has a conductive portion disposed at a position, where the hole is formed, so as to electrically connect the rod member and the rod guide member.
US09376190B1
An improved oarlock system having a sleeve that is attached to an oar, a set of cam blocks installed in the sleeve that can be moved to adjust the inboard of an oar, an oarlock that is positioned over the sleeve so that it contacts the cam blocks. There are several combinations of sleeve type and cam block available for use. The oarlock can be fitted to different sized pins. Pitch of the oar can be easily adjusted using the oarlock and sleeves. Improvements in the use of the sleeves, cam blocks and oarlock permit replacement of worn parts and increased stability of the components when in use as well.
US09376186B2
Marine tunnel thruster includes a duct, within which at least a propeller is fitted that is operatively connected to a rotational drive system. The duct is composed of three sections, which include a first central section and two end sections. The first central section has a specific length and a specific diameter, while the two end sections have a specific length and a specific diameter greater than the diameter of the central section.
US09376184B2
A method and system for providing ground mobility for a dock is provided. The system includes at least one wheel assembly. Each wheel assembly includes a base element configured to be secured to a bottom portion of a dock, and at least one wheel rotatably coupled to the base element. Each wheel assembly is configured such that when the base element is secured to the bottom portion of the dock, the dock is at least partially supported by and rolls along ground on the wheels. The at least one wheel assembly is buoyant in water.
US09376178B2
A device for traversing water is disclosed that has a left and a right-foot hull and a pair of propulsion poles with attached propulsion pontoons. The propulsion poles are shaped and sized so that a person standing upright can use them to propel themselves across water. The underside of each hull has kick-forward plates that allow the hull to move unimpeded in one direction but not the other. A rail is connected near the inner edge of one hull, and a the rail follower fixed to the other hull, and slidably connected to the rail allow the hulls to more relative to each other in a direction parallel to their long axis.
US09376175B1
An apparatus for transferring assets to and from a water vessel. A water vessel having an integrated buoyancy bulb and stern ramp for transferring, launching and recovering assets such as wheeled or tracked amphibious vehicles. The integrated buoyancy bulb and stern ramp is configurable into different orientations to accommodate for different operational requirements, such as ship-to-water transfers, ship-to-ship transfers, or ship-to-dock transfers. The integrated buoyancy bulb and stern ramp is also configurable into a stowage orientation in which the ramp is folded and stored when not deployed.
US09376174B2
Provided a LNG ship that is manufactured in a short construction period by assembling a LNG tank on land and mounting the LNG tank in a hold of the ship.A cold insulator and a membrane are affixed on an inner side of a prismatic tank to fabricate a LNG tank, which is mounted in a hold having a double hull structure. In order to prevent the prismatic tank from deforming at the time of the mounting, strength members are welded to an outer surface of the prismatic tank before a thermal insulation work for the purpose of sufficient reinforcement. After the tank is mounted in the hold, the strength members of the prismatic tank are coupled to the inner hull of the ship to integrate the LNG tank and the hull, so that the weight of a liquid cargo is supported by the prismatic tank and the hull together.
US09376168B2
The invention relates to a ship, in particular a cargo ship, having a power supply system. The invention relates in particular to a ship having a plurality of diesel electric systems for providing electrical power that are disposed within the ship, wherein a plurality of diesel electric systems are each associated with a common opening for removing the diesel electric systems. The invention further relates to a power supply system for a ship and to a method for controlling the power supply system of a ship.
US09376166B2
The present disclosure relates to a sponson for a pontoon boat. The sponson has integrated chines and integrated splash guards. The sponson also includes a keel and deadrise surfaces on opposite sides of the keel. The sponson further includes an integrated keel reinforcement stringer within the sponson.
US09376161B2
System and apparatus for a linkage protector comprising a linkage arm and a shield element. The linkage arm comprises a front mounting portion rotatably coupled to the frame mount and a pair of arms depending from opposite ends of the front mounting portion. Each arm comprises a rear mounting portion coupled to a linkage mount at an end opposite the front mounting portion. The shield element depends from a lower portion of the front mounting portion at a distance from the arm and is configured to protect a lower rear suspension linkage.
US09376154B2
A vehicle capable of preventing the vehicle from making any movement that is not intended by a rider without performing any complicated control is provided. A vehicle includes a step plate on which a rider puts his/her feet to get on the vehicle, and a handle that extends upward from a front of the step plate and is grasped by the rider, the vehicle being configured to move by performing inversion control, in which the vehicle further includes a power-on operation section for instructing the vehicle to at least start the inversion control, the starting operation section being disposed on a surface on the side opposite to a step plate side of the handle.
US09376153B1
A control device of the height adjustment for a bicycle seat post is a pull-down control device secured to the bottom end of the lower outer tube of the seat post. A linkage mechanism is managed by a controlling wire driving the main pin of the oil hydraulic mechanism to axially move upwards to adjust the height of the seat post. Besides, the control device includes the linkage mechanism instead of an oil hydraulic mechanism, so it requires less elements and avoids oil leaking as well as working hours consumed occurring in the prior art control mechanism of the height adjustment for a bicycle seat post. Consequently the control device increases the stability in operation and the speed in assembling.
US09376144B2
An apparatus turns a front wheel of a vehicle inward during an offset frontal impact. The apparatus includes a first frame rail and a second frame rail spaced from each other. A bumper is supported by the first and second frame rails. A beam extends between and engages the first and second frame rails. The beam includes an extension extending from the first frame rail away from the second frame rail to a first end spaced from the first frame rail for being positioned forward of the front wheel and for being forced into the front wheel during the offset frontal impact.
US09376143B2
A deflector assembly for a vehicle having a bumper and a frame rail that are connected by a crush-can. The deflector assembly absorbs impact forces in a small overlap rigid barrier test by directing the impact from the barrier in a lateral direction toward the frame rail. A guide and follower, such as a wheel-shaped roller, a ball-shaped roller, a sliding shoe, or a fastener is received in a guide member that defines a guide surface extending longitudinally to guide a back end of the deflector assembly in a full frontal impact in a longitudinal direction.
US09376139B2
The invention relates to a ball screw (20) comprising a ball nut (21), a roller bearing (22) and a belt pulley (23) arranged on the roller bearing (22). The ball nut (21) is arranged in the roller bearing (22) such that there is no reduction in tension between that of the belt pulley (23) and an assisting engine arranged to the side of the ball screw (20).
US09376136B2
A steering device includes: a steering shaft a column jacket that are telescopically adjustable in an axial direction; a lock plate provided with a plurality of holes and a plurality of partition portions arranged in the axial direction; and a tooth that advances to and retreats from the lock plate, and that is engaged with one of the holes of the lock plate. The steering shaft includes a first end to which a steering member is mounted and a second end. The partition portions are provided such that a height of a first end-side partition portion in a direction toward the tooth retreated from the lock plate is greater than that of a second end-side partition portion positioned on a second end side of the first end-side partition portion.
US09376131B2
A modular cart for transporting and securing femtosecond lasers and other highly sensitive equipment to medical facilities by truck transit and within medical facilities by rolling the modular cart is disclosed. The modular cart includes a cart base member with rollers, a sub plate attached to the top portion of the cart base member, a control box attached to a top end portion of the cart base member, and an adaptable interface plate attached thereto the top portion of the sub plate for selectively receiving and securing highly sensitive equipment. The adaptable interface plate may be modified by size, shape, and receiving means in order to receive and secure various specific types of highly sensitive equipment. Different adaptable interface plates may be used for receiving and securing different highly sensitive equipment.
US09376128B2
A method for remotely controlling a vehicle system includes selectively identifying, among two or more consists in the vehicle system, a selected consist to remotely control. Each of the two or more consists including a propulsion-generating vehicle. The method also includes initiating remote control of the propulsion-generating vehicle in the selected consist and remotely controlling at least one of tractive effort or braking effort provided by the propulsion-generating vehicle in the selected consist using a remote control device. The at least one of tractive effort or braking effort provided by the propulsion-generating vehicle in the selected consist is controlled without remotely controlling tractive effort or braking effort provided by the propulsion-generating vehicle in at least one other consist in the vehicle system.
US09376125B2
The present document describes a heat resistant floor assembly for a rail vehicle. The heat resistant floor assembly comprising: a floor structure and a fire protection panel made of a composite material connected underneath the floor structure.
US09376122B2
A urea solution after-treatment system may include a controller which receives urea solution detection information of a urea solution storage tank (20) storing a urea solution supplied to an SCR (Selective Catalytic Reduction) (10) for removal of NOx, the controller classifying the urea solution detection information into urea solution state information and then classifying the classified urea solution state information into output signals corresponding thereto, the controller outputting the classified output signals as pattern signals of urea solution shortage, urea solution exhaustion, and urea solution failure, and an accelerator pedal (40) which generates touch recognition patterns varying according to the pattern signals when the pattern signals are input, and transfers the touch recognition patterns using a touch felt by a driver's foot.
US09376115B2
A method for the control of a two-speed transmission with an electric machine in a vehicle that is operating in overdrive. The motor torque (M) produced by the electric machine is at first controlled independently of a driver's indication (F) in such manner that an approximately constant vehicle speed is reached.
US09376114B2
An accessories drive system, including: a accessory device; and a clutch assembly including: an electric machine; a drive shaft connected to the machine and accessory device; at least one clutch; and a control unit to: connect, using the clutch, the drive shaft to the crankshaft or the input shaft; rotate the drive shaft with the crankshaft or the input shaft; disconnect, using the clutch, the drive shaft from the crankshaft or the input shaft; accelerate or decelerate, using the machine, rotation of the drive shaft at a first absolute rate less than a second absolute rate of acceleration or deceleration of the engine or the input shaft; and when a speed of rotation of the drive shaft is within a predetermined range of a speed of rotation of the crankshaft or the input shaft, close the clutch to engage the drive shaft with the crankshaft or the input shaft.
US09376113B2
A vehicle control device that sets a target drive force based on a vehicle speed and an accelerator opening degree, in which if a running mode is switched from a normal mode to an acceleration requirement mode, the target drive force is set based on the accelerator opening degree and the vehicle speed at the time of mode switching.
US09376105B2
An apparatus and a method for controlling an engine clutch of a hybrid electric vehicle may include a driving information detector to detect demand information for driving and state information of the hybrid electric vehicle, an engine clutch selectively connecting an engine and a motor generating power, and a controller receiving information from the driving information detector and changing a driving mode of the hybrid electric vehicle by controlling an operation of the engine clutch, in which the controller controls standby hydraulic pressure of the engine clutch differently according to a mode changing condition when the driving mode of the hybrid electric is changed from an Electric Vehicle (EV) mode to a Hybrid Electric Vehicle (HEV) mode.
US09376104B2
A vehicle includes an engine, a transmission, and an electrical system. The electrical system has an auxiliary starter motor connected to a crankshaft of the engine, a high-voltage motor generator unit (MGU) connected to the crankshaft, and a controller. Execution of instructions by a processor causes the controller to determine a set of powertrain conditions in response to a requested autostart of the engine, e.g., state of charge and/or power limits of a high-voltage energy storage system (HV-ESS), torque limits of the MGU, and/or a crank angle of the engine. The controller determines whether the requested autostart may not succeed relative to a time or noise standard using the set of powertrain conditions, and transmits an autostart command to the MGU when the requested autostart may succeed. The controller transmits the autostart command to the auxiliary starter motor when the requested autostart will not succeed.
US09376101B2
A control system to generate a yaw torque of an all-wheel drive vehicle comprises a brake control module 18. The brake control module 18 determines the desired powertrain torque 44 for the vehicle 10 based upon a plurality of factors including available torque from the powertrain. The brake control module 18 determines a first torque 44 and a second torque 26, wherein the first torque 44 and the second torque 26 are combined to provide the total desired yaw torque 49 of the vehicle 10. The first torque 44 is generated between wheels of the vehicle 10 by applying torque 44 from the powertrain 14 to different wheels 21 of the vehicle 10 and the second torque 26 is generated by applying different braking torque from a braking system 16 of the vehicle 10.
US09376099B2
A method and system for the cancellation of transmission shift delay as a function of an optimum target temperature is disclosed. Once the pre-selected optimum target is achieved, the shift delay is cancelled and the transmission is upshifted. Thus the disclosed inventive concept is based on the cancellation of the shift delay on achieving climate control air conditioning comfort targets. Such comfort targets could include one or more of the measured HVAC evaporator temperature, the HVAC discharge temperature, or the in-vehicle cabin temperatures. When a temperature sensor measuring the selected temperature reaches the pre-selected target temperature the shift delay may be cancelled and the transmission may be upshifted, thus maximizing passenger comfort while minimizing fuel consumption. Having the shift delay based upon the achievement of specific measurable comfort targets in the form of target temperatures rather than on a set time period allows optimization between cabin comfort and fuel efficiency.
US09376091B2
A conveyor system is described. The conveyor system includes a lower platform for supporting chain driven rollers. Lower rails are also included for supporting the chain driven rollers in a bypass configuration. Upper rails included for supporting the chain driven rollers in a call-up configuration. In operation, a roller take up section receives the chain driven rollers and directs the chain driven rollers toward a roller call-up section. The roller call-up section includes a call-up mechanism that is operable for selectively directing the chain driven rollers from the lower rails to the upper rails when in the call-up configuration.
US09376090B2
The invention relates to a method for authenticating a driver (2) in a motor vehicle (1) by means of a recognition device (10) disposed in the motor vehicle (1) for collecting actual data (50) of the driver (2) which are transmitted during the authentication to a checking device (20) disposed in an external station (3) outside the motor vehicle (1), wherein the checking device (20) compares the actual data (50) with the target data (60) and in the event of conformity of the actual data (50) with the target data (60) an enabling signal (70) is sent from the external station (3) to the motor vehicle (1), thus enabling the driver (2) to start the motor vehicle (1).
US09376084B2
An airbag can include a first cushion portion that defines a first inflatable chamber and a second cushion portion that is connected to the first cushion portion and defines a second inflatable chamber. The first inflatable chamber can receive inflation gas from an inflator to expand the first cushion portion and the second cushion portion can receive inflation gas from the first inflatable chamber to expand the second cushion portion. In some arrangements, a temporary fastener may maintain the second cushion portion in a compact state during expansion of the first cushion portion.
US09376079B2
An automated vision inspection system detects whether a cushion of a side curtain airbag assembly system is twisted. The cushion is provided a plurality of markings arrayed along a longitudinal extent of the cushion. Each marking can be defined by a group of four distinct characters or indicia. Each indicium can be defined by polygonal shaped pixels which allow the inspection system to find clear edges of the marking and thereby determine marking orientation. By determining orientation, the inspection system can compare the inspected marking to a master image of the marking to determine if the cushion is in a twisted state or non-twisted state.
US09376066B2
A vehicular camera has a lens assembly, a housing and an image sensor. The lens assembly has at least one adjustable lens and a lens adjustment structure. The lens assembly has an effective focal length and an optical axis associated therewith and an effective distance from the image sensor. A controller may be operatively connected to the lens adjustment structure for controlling the operation of the lens adjustment structure. The lens adjustment structure is controllable to adjust at least one of an effective focal length and an effective distance of the lens assembly to the image sensor, so as to control the distance at which an object in the field of view of the camera appears in focus on the image sensor.
US09376064B2
A securement device with a protecting element which engages, at least in part, a surface of the item secured and provides shock absorption, vibration lessening and surface protection to the item secured. The securement device may include a strap adjustably coupled to a bicycle rack so as to secure a wheel of a bicycle to the rack and provide shock absorption, vibration lessening and surface protecting to the wheel and wheel rim.
US09376063B2
A carrier that mounts to a vehicle. In some embodiments, the carrier may include a pair of arms to support a bicycle. Each arm may include one or more securing devices each including a strap to contact a frame region of a bicycle and a pair of buckles to fasten the strap over the frame region. In some embodiments, the carrier may include a mount for a vehicle hitch. The mount may include a pair of user-actuated coupling members, such as a wedge member and a retractable retainer, each configured to attach the mount to the hitch. One of the coupling members (e.g., the retainer) may serve as a backup for the other coupling member to improve safety. In some embodiments, the carrier may include a mast that is releasable for backward pivotal motion away from the vehicle.
US09376061B2
An accessory system of a vehicle includes a rearward viewing camera, a forward viewing camera and a video display screen disposed in the interior cabin of the vehicle at a location separate from the location of an interior rearview mirror assembly. When the vehicle is executing a reversing maneuver, the video display screen displays images captured by the rearward viewing camera to assist the driver in reversing the vehicle. The video display screen is operable to display other information. During forward travel of the vehicle and responsive to information pertaining to the location of the vehicle and a route to a destination, the video display screen displays forward video images captured by the forward viewing camera and the video display screen displays a graphic overlay on the displayed forward video images that highlights a highway on/off ramp to follow the route to the destination and/or a building of the destination.
US09376060B2
A driver assist system suitable for use in a vehicle includes a plurality of vehicular cameras disposed at the vehicle and a plurality of non-video sensors disposed at the vehicle. The cameras capture image data and at least one non-video sensor captures sensor data. A video processor module receives image data captured by the cameras and receives sensor data captured by the at least one non-video sensor. The received image data is fused with received sensor data at the video processor module. The video processor module communicates with other vehicle systems via a vehicle bus of the vehicle. Received image data is processed at the video processor module to generate a synthesized image, which is displayed by a display screen. Responsive at least in part to fusing of image data and sensor data at the video processor module, a driver assistance system of the equipped vehicle is controlled.
US09376059B2
A motor vehicle virtual vanity mirror display system includes an a input device that provides a virtual vanity mirror control signal, and a camera that is adapted to capture an image of an occupant sitting on a seat of the vehicle in response to the virtual vanity mirror control signal. An image processing unit receives the image and processes the image to provide a processed image, and a display receives and displays the processed image to the occupant, in the absence of a vehicle mounted vanity mirror.
US09376057B2
A lighting structure for a vehicle includes a first portion and a second portion. The first portion includes a retaining structure configured to retain an elongated lighting element, and a fastening structure configured to attach the lighting structure to an interior vehicle panel. The second portion is attached to the first portion at a location spaced from the retaining structure, with a distal end of the second portion being spaced from the retaining structure such that the second portion conceals the retaining structure in a longitudinal direction of a vehicle when the lighting structure is attached to the interior vehicle panel.
US09376051B1
A method for notifying a first driver of a first vehicle that a first responder is ahead of the first driver on a road and that the first responder is stopped on the road. The method employs an optical emitter and optical detector apparatus. The optical emitter may be in or on a police car and may be turned on when the police car is on the shoulder of a road, such as when an officer has pulled a motorist over. The optical detector apparatus is in or on a vehicle traveling toward the police car that is stopped on the shoulder of the road. The optical detector apparatus communicates with a warning device to sound or display a warning to the driver of the approaching vehicle.
US09376047B2
A tray arrangement is provided. The tray arrangement includes a tray element with a first side and a second side. The tray arrangement also includes a bearing arrangement for the tray element. The tray element is supported on the bearing arrangement and the second side comprises a holding arrangement for a mobile device. The bearing arrangement is configured to pivot the tray element about at least an axis which lies in a plane of the tray element or parallel thereto.
US09376040B2
To obtain a vehicular seat with which the expansion and deployment of expanding portions can be completed in a short amount of time. A vehicular seat has: a seat cushion; a first expanding portion that is provided in the seat cushion on one side thereof with respect to a seat width direction center and which, upon receiving a supply of gas, is expanded and deployed; a second expanding portion that is provided in the seat cushion on the other side thereof with respect to the seat width direction center and which, upon receiving a supply of gas, is expanded and deployed in such a way as to oppose the first expanding portion across a central space portion in the seat width direction; and gas supplying device which, when actuated at the time of a frontal impact of the vehicle, supplies gas to the first expanding portion and second expanding portion.
US09376037B1
A car configured to support a child is provided that includes a seat bottom, a seat back, and a harness to secure a child in the car seat. The seat bottom and seat back are blow molded. The seat bottom includes a cup holder received within an aperture formed in the blow-molded seat bottom.
US09376025B2
A charging apparatus and an electric vehicle including the same are disclosed. The charging apparatus includes a converter for, in a charging mode, converting an input alternating current (AC) voltage into a direct current (DC) voltage, and a controller for controlling the converter. The converter includes a motor, and a switching unit for supplying the input AC voltage to the motor by performing a switching operation. The converter also includes an inverter for, in a motor operation mode, converting a DC voltage from a battery into an AC voltage by performing a switching operation of three-phase switching elements and driving the motor. In the charging mode, the inverter operates switching elements of at least one phase of the three-phase switching elements and converts the voltage received from the motor into a predetermined DC voltage.
US09376024B2
A high-voltage relay system for a vehicle. The system includes a high-voltage bus, a parallel relay set and a controller. The parallel relay set includes two or more relays wired in parallel and that are electrically coupled to the high-voltage bus. The controller is programmed to adjust the power flowing through the parallel relay set when a malfunction is detected in one of the relays in the set. The system can include a high-voltage power source electrically coupled to the high voltage bus through the parallel relay set, where the controller reduces the power flowing through the parallel relay by reducing output of the high-voltage power source. The system can include a high-voltage motor electrically coupled to the high voltage bus through the parallel relay set, where the controller reduces the power flowing through the parallel relay set by reducing the motor's power demands.
US09376020B2
A combination display instrument in a vehicle has a plurality of display elements and/or display scales inserted into or attached onto a common base. A polarizing film, which is designed to correspond to the base, is arranged in the line of vision of an observer in front of the base. The polarizing film is held in position on the base in a form-fitting and/or force-fitting manner in an assembled state of the combination display instrument by corresponding molded sections in or on a housing of the combination display instrument.
US09376011B1
A method of transferring a volatile organic liquid between a railcar and a truck, comprising: providing for the flow of a volatile organic liquid through a first conduit from a liquid unloading vessel to a liquid loading vessel, wherein the liquid unloading vessel can be coupled to or part of a railcar, in which case the liquid loading vessel is coupled to or part of a truck, or the liquid unloading vessel can be coupled to or part of the truck, in which case the liquid loading vessel is coupled to or part of the railcar; providing for the flow of organic vapor through a second conduit from the liquid loading vessel to the liquid unloading vessel; and providing for the flow of organic vapor from the second conduit through a pressure relief valve upon opening of the pressure relief valve.
US09376008B2
A power plant for a vehicle of the present invention includes an electric motor attached to a transmission housing attached to an engine. The electric motor is attached to the side of the transmission housing toward the engine and is connected to the engine interposed by an anchor point. When the engine is viewed in a crankshaft direction, a line connecting the anchor point and the center of gravity of the electric motor intersects a line extending along a direction in which the electric motor vibrates due to vibration of the engine in the absence of an anchor point.
US09376003B2
A wind stop device for motor vehicles having improved stability. The wind stop device comprising a wind blocker having a wind blocker frame extending transversely to a vehicles longitudinal axis. The device further comprising a flow-hindering element closing a frame opening of the wind blocker frame, wherein the wind blocker is foldable about a wind blocker-folding axis by way of at least one hinge. The device further comprising a cover pivotally connected to the wind blocker about a pivot axis and having a cover frame extending transversely to a vehicles longitudinal axis and extending away from the pivot axis. The flow-hindering element closing a frame opening of the cover frame, wherein the cover frame is foldable about a cover folding axis by way of at least one hinge, where the hinges can have a blocking device to prevent the cover frame from folding.
US09376001B2
A sunroof device for a vehicle, includes: a guide rail provided on each edge in a width direction of a vehicle of an opening formed on a vehicle roof; a first sliding member linked with each edge in the width direction of the vehicle of a movable panel opening and closing the opening; a guide block in which an engagement groove is formed and which is provided on the guide rail; a check including an engagement protrusion capable of engaging with the engagement groove; and a regulation wall preventing deformation of the guide block when the first sliding member moves toward the rear side of the vehicle with respect to the movable panel in the fully closed state.
US09375991B2
A pressure shock absorber includes: a spring portion used for a vehicle suspension; a hydraulic jack portion which can adjust a preload of the spring portion; and a connecting portion through which a hydraulic pressure source supplying hydraulic pressure to the hydraulic jack portion is connected to the hydraulic jack portion, in which the connecting portion can be connected to and separated from the hydraulic pressure source.
US09375987B2
The embodiments may include a connector device configured to be coupled to a cord-end connector of a connection cord of a first vehicle designed to be connected to a second vehicle capable of towing the first vehicle. The connector device is configured to provide access to a power source included within the first vehicle. In some examples, the connector device is configured to receive electrical power from the power source and re-route the electrical power back to the first vehicle for activating one or more components on the first vehicle. In some examples, the connector device may be configured to be coupled to at least one external device. The connector device may be configured to power or charge the at least one external device based on the provided access.
US09375985B2
A valve stem may comprise an auxiliary port. Devices such as an air pressure gauge, a tire pressure monitoring system sensor, temperature gauges and one-way valves may be mounted to the auxiliary port. A valve stem with auxiliary port may be used in an automatic tire inflation system. A sleeve may be translatably mounted to the valve stem to cover and uncover the auxiliary port.
US09375978B2
A hub unit of the present invention includes a cap that covers an opening of a pilot portion, and the cap includes a cap body formed in a disc shape, and a cylindrical portion extending in an axial direction from an outer periphery of the cap body. The cap is removably attached to the pilot portion by screwing an external thread portion formed on an outer periphery of the cylindrical portion of the cap, to an internal thread portion formed on an inner periphery of the pilot portion.
US09375972B2
A writing instrument includes a pen point retaining member, a pen point that is attached to a first end of the pen point retaining member, an ink tank that is attached to a second end of the pen point retaining member, and an ink that is accommodated in the ink tank. The ink includes a lubricating interface layer-forming compound, and a carbonaceous film is formed on at least one of a surface of the ball or a contact portion of the ball holding portion with the ball.
US09375971B2
A security feature for use with secure booklets, especially those having a spine, for example passports, identification booklets and other types of ID3-sized documents. In one example, the security feature is printed across the spine of the booklet onto two adjacent pages. Most conventional, commercially available printers are unable to print across the spine, and therefore would be unable to reproduce the security feature. In addition, in the case of a booklet, for example a passport, that uses a stitching thread to secure the pages together, ink from the printed image bleeds into the thread. The presence or absence of ink in the thread can then act as an indicator as to whether or not the booklet is genuine or a counterfeit. Another security feature includes registration of a pre-print portion and a variable print portion that is applied during booklet personalization to form a combined image.
US09375966B2
A sensitizer particle dispersion containing stearic acid amide, a preparation method thereof, a mixed dispersion composition for a thermosensitive recording layer using the sensitizer particle dispersion, and a thermosensitive recording medium using the mixed dispersion composition are provided. The sensitizer particle dispersion can be safely prepared under atmospheric pressure by mixing stearic acid amide and another sensitizer at a mass ratio of 95:5˜51:49; co-melting the mixture by heat in emulsifier-dispersed water, whereby the mixture is unified and emulsified into particles, or emulsifying the co-melted mixture of stearic acid amide and the other sensitizer unified by co-melting the mixture by heat, into particles in emulsifier-dispersed water; and quenching the obtained emulsified dispersion, thus crystallizing sensitizer particles from the emulsified particles.
US09375963B2
Techniques related to printer calibration are disclosed herein. In an example, an actual measurement of a colorimetric parameter is performed by measuring the colorimetric parameter on a printed calibration pattern. The colorimetric parameter is associated with an ink drop number. The calibration pattern is printed with selected printing conditions. An ink drop number variation is determined from a reference measurement and the actual measurement of the colorimetric parameter. The reference measurement is a measurement of a colorimetric parameter. The reference measurement corresponds to a measurement of the colorimetric parameter on a calibration pattern printed with the selected printing conditions. An actual linearization is generated by validating a set of pre-defined linearizations with the determined ink drop number variation. Other examples of printer calibration are disclosed.
US09375949B1
A method for printing an image with authentication features, including: printing a media treatment material onto a print medium in accordance with a pattern of predefined authentication features, and printing one or more visible printing materials onto the print medium in accordance with an image pattern, thereby providing a printed visible image. The media treatment material alters lateral spreading characteristics of the visible printing materials within the print medium, so that the lateral spreading characteristics are different in image regions where the media treatment material was printed than in image regions where the media treatment material was not printed. The difference in the lateral spreading characteristics causes the pattern of authentication features to be detectable.
US09375947B2
An electrically-assisted mechanical Braille writer includes a main solenoid to apply force to emboss Braille onto a printing medium, and advance an embossing mechanism to the next cell. A second solenoid engages a mechanical stop to prevent one or more embossing keys from being fully depressed, to prevent kickback from the keys mechanically coupling to the main solenoid. In unpowered operation, the mechanical stop is disengaged, and the embossing keys may be fully depressed to apply force to emboss Braille and advance the embossing mechanism. Accordingly, with electrical power, the user may supply a lesser amount of force and still fully emboss Braille cells, while without electrical power, the Braille writer remains fully operational.
US09375942B1
A fluid level sensor is configured for identifying a fluid level in a small volume reservoir, such as a fluid reservoir in an ejector head. The reservoir includes a plurality of vertically arranged chambers. A plurality of piezoelectric transducers is distributed over the chambers in a one-to-one correspondence. At least one electrical conductor is electrically connected to each piezoelectric transducer in the plurality of piezoelectric transducers to enable each piezoelectric sensor to receive an electrical signal to a portion of a wall of the chamber to produce an acoustical wave in the chamber and to transmit an electrical signal from each piezoelectric transducer in response to a fluctuating pressure on each piezoelectric transducer produced by the acoustical wave in the chamber.
US09375938B2
The ink cartridge has a communication unit for allowing an ink storage chamber to communicate with a space outside a housing. The communication unit includes a communication port formed on an outside surface of the housing, a merging channel having an end which communicates with the communication port, and a plurality of branch channels, each having an end which communicates with the merging channel and the other end which communicates with the ink storage chamber. In the branch channel, while ink flows backward, the ink flowing from the merging channel branches into the first branch channel and the second branch channel. At the same time, a ratio (Q1/Q2) between an ink flow rate in the first branch channel and an ink flow rate in the second branch channel while the ink is supplied is smaller than that while the ink flows backward.
US09375937B2
A liquid ejecting device includes a casing, a carriage, a cartridge, an ejection unit, a conveying mechanism, an access unit, and a controller. The conveying mechanism is configured to convey the cartridge between a second position where the cartridge is mounted on the carriage and a third position where at least part of the cartridge is exposed outside the casing. The access unit is configured to access first storage to read cartridge information. The controller is configured to perform a first process to: control the access unit to read the cartridge information from the first storage; determine whether the cartridge information meets a prescribed condition; and control the conveying mechanism to convey the cartridge to the second position, if the cartridge information meets the prescribed condition.
US09375936B2
In a recording apparatus, a first casing holds a supporting portion. A second casing holds a recording head and a first tank. The second casing is connected to the first casing so as to be rotatable relative to the first casing about a prescribed axis, the second casing being configured to move between a first position and a second position by rotating relative to the first casing, the recording head being located adjacent to the first casing when the second casing is in the first position, the recording head being further apart from the first casing when the second casing is in the second position than when the second casing is in the first position. The recording head opposes the supporting portion when the second casing is in the first position. The second casing is provided with a second tank mounting portion and a liquid transferring portion.
US09375935B2
A waste liquid container includes a fitted portion, in which a discharge unit is fittable in a removable manner, a container connection terminal, which contacts a device connection terminal, an insertion restriction portion, which contacts a device contact portion and restricts movement of the waste liquid container in the insertion direction, and an engaged portion, which includes a contacted portion that contacts a removal restriction unit and restricts movement of the waste liquid container in the removal direction. The engaged portion is located toward an inner side in the lateral direction from a side wall at a position lower than both of the container connection terminal and the insertion restriction portion. The removal restriction unit is receivable in a region located toward an outer side in the lateral direction from the engaged portion.
US09375933B2
A liquid ejecting apparatus is provided with a liquid ejecting unit capable of ejecting liquid, a plurality of liquid holding portions capable of holding the liquid that is discharged from the liquid ejecting unit, and a suction mechanism which is connected to the plurality of liquid holding portions. The liquid holding portion includes a liquid reception portion which receives the liquid that is discharged from the liquid ejecting unit, a liquid reservoir portion capable of storing the liquid further down in a vertical direction than the liquid reception portion, and an atmosphere communicating portion which communicates the liquid reservoir portion with the atmosphere.
US09375929B2
An ink manifold for use with a heater chip in an inkjet printhead, including a first planar surface and a second opposite planar surface, a plurality of ink channels located on the first planar surface of the ink manifold for supplying ink to the heater chip, and a plurality of ink ports located on the second opposite planar surface of the ink manifold, each of the plurality of ink ports being in liquid communication with a respective one of the plurality of ink channels, each of the plurality of ink channels having a bottom wall defined by bottom wall portions that rise from each ink port within the ink channel to a maximum height at an angle of at least 12 degrees.
US09375925B2
A disclosed liquid-ejection head for ejecting liquid droplets includes a substrate having a diaphragm forming a part of walls of a pressure liquid chamber, and a piezoelectric element adhered to the substrate with adhesive, and configured to apply pressure to the pressure liquid chamber via the diaphragm. The piezoelectric element has a surface facing the substrate having the diaphragm, and the surface has one or more projection parts in an area in which the pressure liquid chamber is not disposed, and whereon the substrate having the diaphragm has one or more recess parts that fit in the respective projection parts.
US09375922B2
A method of manufacturing a liquid jet head includes a through hole forming step of forming through holes on a base plate, an actuator plate bonding step of bonding actuator plates to opposite sides of the base plate, and an electrode forming step of forming electrodes on the bonded base plate and the actuator plates. In the through hole forming step, the through holes are formed on the base plate and the inner surfaces of the through holes are roughened. In the electrode forming step, second extraction electrodes are routed to a principal surface of the base plate through the through holes.
US09375917B2
A liquid discharge apparatus includes: a modulation circuit that generates a modulated signal by pulse-modulating a source signal through self-oscillation; a pair of transistors that include a high-side transistor and a low-side transistor and amplify the modulated signal to generate an amplified modulated signal; a low-pass filter that includes an inductor and a capacitor and smoothes the amplified modulated signal to generate a drive signal; a piezoelectric element that is displaced by application of the drive signal thereto; a cavity that is filled with a liquid inside and has an internal volume which changes when the piezoelectric element is displaced; and a nozzle that is provided to discharge the liquid inside the cavity in response to the change of the internal volume of the cavity. A shortest distance between the low-side transistor and the capacitor is shorter than a shortest distance between the high-side transistor and the capacitor.
US09375916B2
Creating one or more printing plate segments includes exposing a printing plate segment with imaging data to form an imaged plate segment, and marking the floor of the printing plate segment or the back of the printing plate segment with one or more registration marks according to marking data. The registration marks can be within the design area defined by the imaging data marked such that the registration marks are not visible on a print made from the imaged plate segment. Printing using positioned and mounted so-marked imaged plate segments produces a print without the registration marks visible on the print. Such plate segments can be unmounted and reused with the registration marks intact.
US09375914B2
A paste supply apparatus includes a plurality of paste pots each including a bottomed tubular container storing paste and a movable inner lid provided in the tubular container and having a through hole formed in a center portion thereof, and a pot holder which holds the paste pots so as to be horizontally arranged along an arrangement direction such that the through hole of each of the paste pots is directed downward and downward movement of the inner lid thereof is regulated. The paste supply apparatus further includes a pot holder moving device which moves the pot holder along the arrangement direction and selectively positions one of the plurality of paste pots at an ejection position, and a paste ejecting device which presses the tubular container of the paste pot positioned at the ejection position and which ejects the paste in the tubular container from the through hole.
US09375913B2
A screen printer in which a photoelectric sensor and squeegees are fixed to a slider, when outward movement printing in which solder on a screen is rolled by an outward movement of the right squeegee is completed, the right squeegee is separated from a state of contacting a right end of a solder roll and a squeegee position pl at that time is input, and, subsequently, the slider is returned until the photoelectric sensor detects a left end of the solder roll and a squeegee position p2 at this time is input. An amount (a solder roll width) of solder remaining on the screen is calculated by subtracting a movement amount from the squeegee position p1 to the squeegee position p2 from a distance from the right squeegee to an optical axis position of the photoelectric sensor on the screen.
US09375911B2
A method for manufacturing of a tool for production of synthetic image devices comprises cutting (210) a surface structured plate, giving a respective first and second edge. The plate has geometrical structures—microimages or focusing elements—in a first surface. Cells comprising the geometrical structures have a predetermined period in a first direction. The first edge is brought (212) to face the second edge in a close proximity. The first direction of a first area of the plate adjacent to the first edge is positioned with a predetermined angle with respect to the first direction of a second area of the plate adjacent to the second edge. A relative translation in said same plane between the first edge and the second edge is adapted (214) for bringing a first cell border in the first area to a predetermined distance, relative a corresponding second cell border in the second area. The first and second edges are mutually fixated (216) and mounted (218) onto a cylindrical support. A tool for manufacturing of synthetic image devices is also disclosed.
US09375905B2
To prevent misalignment between substrates and distortion of surface, and to keep film thickness uniformity of thin substrate when two substrates are bonded for bonded member, bonded member manufacturing apparatus of bonding first substrate and second substrate, comprising resin film forming means for forming liquid state resin film on the first substrate, semi-curing means for maintaining outer peripheral section of resin film in uncured state and curing inner section surrounded with outer peripheral section in semi-cured state, and substrate bonding means for bonding first substrate and second substrate by bringing second substrate into contact with resin film, such that one end of outer peripheral section is determined as starting point of contact so that boundary line between contact portion and noncontact portion moves in one direction from starting point to opposite end of outer peripheral section while applying pressing force to second substrate.
US09375902B2
A polyester film includes ethylene glycol component that accounts for 60 mol % or more of the glycol components in the polyester film, containing a crystal nucleating agent up to 0.01 to 5 mass % relative to the entire polyester film that accounts for 100 mass %, and having a crystal melting energy, ΔHm, of 5 to 35 J/g.
US09375900B2
To provide laminated glass excellent in the quality and the cost, in which two glass plates differing in the plate thickness can easily be bent with good accuracy.Laminated glass 60 comprising a plurality of glass plates 12 and 14 bent into a predetermined shape, and an interlayer 40 interposed between the plurality of glass plates 12 and 14, at least two glass plates 12 and 14 among the plurality of glass plates 12 and 14 differing in the plate thickness, wherein the two glass plates 12 and 14 differing in the plate thickness have different glass compositions, and at an optional temperature between the annealing point and the softening point of the thick glass plate 12, the thick glass plate 12 has a lower viscosity than the thin glass plate 14.
US09375896B2
A label material for use with water-based adhesives. The label material includes a synthetic paper having an upper surface and a lower surface. The synthetic paper includes a biaxially-oriented polymeric sheet having a voided layer. A printable coating is optionally provided on an upper surface of the polymeric sheet and an adhesive-receiving coating is provided on a lower surface of the polymeric sheet. The polymeric sheet has a density of not more than 0.55 g·cm−3. The adhesive-receiving coating includes a polymeric binder and an absorbent pigment and has a surface energy of at least 40 dyne·cm−1.
US09375895B2
The present invention relates to hotmelt adhesive compositions which comprise at least one thermoplastic, silane-grafted poly-α-olefin which is solid at 25° C. and at least one soft resin having a melting point or softening point between −10° C. and 40° C. These hotmelt adhesive compositions are suitable in particular as laminating adhesives and, even in thin layers, have an extended open time but nevertheless build up a high early strength rapidly and lead to a heat-stable adhesive bond.
US09375879B2
A process for the preparation of identifying media, such as a label or decal, that includes the deposition of suitable layers, and where each of the layers can be individually and sequentially formed with a three dimensional printing apparatus in communication with a computer assist device.
US09375865B2
A bladder monitoring apparatus and method for monitoring an inflatable bladder during curing of composite material in an autoclave. The bladder may be wrapped with composite material and have an impermeable membrane sealed around the composite material. The method may include the steps of fluidly coupling a vacuum port of the impermeable membrane with a vacuum source and fluidly coupling a vent of the bladder with a first port of a flow meter located outward of the autoclave. A second port of the flow meter may also be fluidly coupled with atmosphere within the autoclave. The method may then include evacuating air from within the impermeable membrane. If a flow above a threshold flow is detected by the flow meter, the leak in the bladder may be located and repaired or a valve of the flow meter between the first and second ports may be closed.
US09375863B2
A container for bone cement includes a first member defining a chamber, which contains a first ingredient. The chamber also includes a second member movably coupled to the first member. The second member includes a mixing device that is movably disposed within the first chamber, and the second member defines a second chamber containing a second ingredient. The container additional includes an opening device that selectively opens the second chamber and allows the second ingredient to enter from the second chamber into the first chamber. The mixing device is movable within the first chamber to promote mixing of the first ingredient and the second ingredient to prepare the bone cement. A corresponding method of preparing bone cement is also disclosed.
US09375862B2
The manufacturing method of the honeycomb structure includes a forming step of a honeycomb formed body with non-fired electrodes where there is performed twice a non-fired electrode forming operation in which an electrode paste is attached to a plate including a printing screen, a side surface of a honeycomb formed body, the side surface being a curved side surface, is brought into a pressed state by a squeegee via the printing screen of the plate, in the state, the body is rotated and the plate is linearly moved along the side surface of the body, and the squeegee allows the electrode paste to permeate the printing screen and coat the side surface of the body; and a forming step of the honeycomb structure where the body with the non-fired electrodes is fired to obtain the honeycomb structure.
US09375860B2
Adjustable guidebushes and methods for using the same facilitate cutting joint elements into work-pieces to join together two or more of the work-pieces. In some embodiments, the adjustable guidebush includes a guide surface defining a number of outer diameters having different lengths. Positioning different outer diameters of the guide surface to interact with a cutting guide allows one to adjust the fit of the joint elements formed in the work-pieces.
US09375858B2
An apparatus for removing a rind from a food item, the apparatus comprising: a compartment defining an interior area adapted to contain a food item, the compartment having at least one opening and a blade assembly; a pushing apparatus, wherein at least a portion of the pushing apparatus is movable to engage the food item; actuator means for driving the pushing apparatus to contact at least a portion of said food item in the compartment.
US09375855B2
A razor and trimmer combination assembly includes an elongated handle, a razor blade, a trimmer and a motor. The razor blade is disposed at or adjacent a first end of the handle. The trimmer mounts on the handle and includes a moving blade. The motor drives the moving blade.
US09375849B2
A sucker includes: a main body having a bottom face formed with an annular abutment; a disc body made of a flexible material having a tapered annular wall, the disc body being disposed under the bottom face of the main body, an outer circumference of the annular wall being formed with a freely flexible lip edge positioned below the annular abutment face; an air chamber being formed in the disc body; and an air-sucking passage having a first end in communication with the air chamber of the disc body and a second end passing through the disc body and the main body to communicate with outer side. When the sucker sucks a surface of an object, the top face of the lip edge is in contact with the abutment face and supported thereby.
US09375847B2
A mobile robot includes a microprocessor connected to a memory and a wireless network circuit, for executing routines stored in the memory and commands generated by the routines and received via the wireless network circuit. The microprocessor drives the mobile robot to a multiplicity of accessible two dimensional locations within a household, and commands an end effector, including at least one motorized actuator, to perform mechanical work in the household. A plurality of routines include a first routine which monitors a wireless local network and detects a presence of a network entity on the wireless local network, a second routine which receives a signal from a sensor detecting an action state of one of the network entities, the action state changeable between waiting and active, and a third routine which commands the end effector to change state of performing mechanical work based on the presence and on the action state.
US09375839B2
Methods and computer-program products for evaluating grasp patterns for use by a robot are disclosed. In one embodiment, a method of evaluating grasp patterns includes selecting an individual grasp pattern from a grasp pattern set, establishing a thumb-up vector, and simulating the motion of the manipulator and the end effector according to the selected individual grasp pattern, wherein each individual grasp pattern of the grasp pattern set corresponds to motion for manipulating a target object. The method further includes evaluating a direction of the thumb-up vector during at least a portion of the simulated motion of the manipulator and the end effector, and excluding the selected individual grasp pattern from use by the robot if the direction of the thumb-up vector during the simulated motion is outside of one or more predetermined thresholds. Robots utilizing the methods and computer-program products for evaluating grasp patterns are also disclosed.
US09375838B2
A grip apparatus includes a robot hand including plural fingers and pressure sensitive conductive rubber provided to the finger and configured to output a detection signal equivalent to acting force. The pressure sensitive conductive rubber is covered by a cover member. The grip apparatus also includes a control unit configured to cause the plural fingers to perform an opening or closing operation and compare a detection value based on the detection signal from the pressure sensitive conductive rubber with a threshold to determine whether the robot hand grips the work or releases the work. During a period from a time when the closing operation is started until a time when the fingers contacts the work, the control unit samples the detection signal of the pressure sensitive conductive rubber and sets the threshold as a value higher than a detection value at a time of this sampling.
US09375836B2
A tool rack includes a main body and at least one joint including a first end disposed on the main body, a second end, a flange between the first and second ends, an elastic structure extending from the flange to the second end, and at least one protrusion extending radially from the elastic structure. The elastic structure includes a plurality of elastic members arranged annularly and delimiting an open space. Two adjacent elastic members of the plurality of elastic members are separated from one another with a gap. The flange has a maximum width defining a first width. The second end of the at least one joint that includes the protrusion has a maximum width defining a second width. The second width is not less than the first width.
US09375835B1
A tool box assembly contains plural tool boxes with a same size or different sizes, and each tool box has a first casing and a second casing. The first casing includes at least one groove defined on a top thereof, and the first casing also includes at least one engaging portion arranged on a peripheral side of the at least one groove. The second casing covers with the first casing and includes at least one protrusion mounted on a bottom thereof and corresponding to the at least one groove of the first casing. In addition, each of the at least one protrusion has a joining portion arranged on a peripheral wall thereof and corresponding to each of the at least one engaging portion of the first casing. Thereby, the plural tool boxes with the same size or the different sizes are stacked and fixed together easily and securely.
US09375833B2
Disclosed are grips and methods of making grips for use with the handle of an article, and in particular for use with golf clubs, fishing poles, bicycle handles, hand tools, etc. Embodiments preferably include a first portion made of a first material and a second portion made of a second material. The first portion is preferably less dense and/or lighter than the second portion to allow for the manufacture of a light grip with different characteristics.
US09375831B2
A tool is configured to receive a locknut of a coaxial cable. The tool includes a sleeve provided with a first inner hole therein; a first block in the first inner hole, wherein the first block has a gradually small cross-sectional area from top to bottom in an axis of the first inner hole; a second block in the first inner hole, wherein the second block has a gradually small cross-sectional area from top to bottom in the axis of the first inner hole; and a third block in the first inner hole, wherein the third block has a gradually small cross-sectional area from bottom to top in the axis of the first inner hole, wherein the third block is configured to be between the first and second blocks, wherein the third block has a first surface configured to contact the first block and a second surface configured to contact the second block.
US09375819B2
A bound block of detachable sheets is disclosed, including a plurality of individual sheets, the edges of which are aligned, where the individual sheets are bound to a binding sheet, which is furnished with an adhesive, where the butt-edges of the individual sheets are adherent to the binding sheet, forming the block, and where a bracket is introduced onto the bound block, effectively restricting the bound block from over-opening.
US09375817B2
A tool exchanger for storing a tool (10) with a holding groove (12) formed at a periphery of the tool in a plurality of tool storage parts (302) provided in a tool magazine (300) so that a tool axis becomes substantially horizontal in direction, and taking out the tool from the tool storage parts (302), the tool exchanger including: a base part (100); a slider (200) provided in a side of the tool storage parts (302) slidably relative to the base part (100) in a direction substantially parallel to the tool axis; a holder (250) attached to the slider (200) in a movable manner relative to the slider, and having an engagement part (252) which engages with the holding groove (12) of the tool; and a moving portion moving the holder (250) relative to the slider (200), wherein the moving portion includes: a handle part (260) for exerting a rotary force about an axis extending substantially parallel to the tool axis; a first cam mechanism (250, 242) moving the holder in a plane substantially perpendicular to the tool axis in accordance with a first turning operation of the handle part (260); and a second cam mechanism (161, 270) moving the holder (250) along a direction of the tool axis in accordance with a second turning operation of the handle part (260) successive to the first turning operation.
US09375812B2
A welding carriage traveling with a welding torch mounted thereon includes: a carriage body; and a torch supporting part disposed between the front and rear ends of carriage body and supporting a tip of the welding torch in a state of positioning on a side surface side of the carriage body and facing diagonally downward. The torch supporting part includes a torch swinging unit and a weaving unit. The torch swinging unit includes a torch swinging mechanism which swings the tip of the welding torch in a forward and rearward direction of the carriage body, and thereby moves tip close to the welding line. The weaving unit includes a weaving mechanism which operates so as to integrally rotate a unit case and a torch mounting bar of the torch swinging unit about a screw, thereby to cause the welding torch to perform a weaving operation.
US09375802B2
Provided is a plasma arc welding method for continuously welding a welding target part of a welding workpiece while forming a keyhole weld on the welding target part of the welding workpiece using a plasma arc. A pulse current is used for a welding current, and the pulse frequency of the pulse current is controlled so as to be a frequency that is synchronized with a weld pool (P) during the welding. With this approach, vibration of the weld pool during keyhole welding can be controlled so as to synchronize with the pulse frequency of the pulse current. As a result, when the plasma arc keyhole welding is performed, a stable penetration bead having a desired height can be reliably obtained without hanging or irregularity.
US09375786B2
The invention relates to a refractory ceramic slide plate and an associated slide plate set.
US09375779B2
The invention relates to a horizontal forging press for massive forming, which comprises a machine frame, a forging ram, a clamping ram, at least a first force transmission device, at least a second force transmission device, and a multipart forging tool, wherein each force transmission device comprises at least one drive. The first force transmission device of the forging ram is here configured as a stroke-controlled force transmission device, and the second force transmission device of the clamping ram is here configured as a stroke-controlled force transmission device or as an energy-controlled force transmission device.
US09375773B2
A conduit bender having a unitary frame is mounted to a wheeled base which provides for transportation of the bender. A braking assembly provides for simplified locking of the wheels to secure the bender in a location. The bender is mounted to the base through a pivoting assembly which allows for bending of conduit in either a horizontal or vertical plane. A circuit is provided for controlling the bending operation. An auto-sensing portion of the circuit receives information regarding the characteristics of the conduit to be bent upon placement of the conduit in the bender. A feed back portion of the circuit is used to provide a precise bending operation.
US09375766B2
A near-surface wellhead for extracting sub-surface gas from beneath a geomembrane includes a plenum defining an enclosure with an upper portion. A conduit extends upwardly from the upper portion of the plenum, the conduit communicating with the interior volume of the plenum and has external threads for receiving a threaded nut thereon. The conduit is adapted and provided for extending through an aperture in the geomembrane for withdrawing sub-surface gas from within the interior volume of the plenum and through the geomembrane. A gasket having an opening formed therein is slipped over the conduit and above the geomembrane so that the geomembrane is sandwiched between the gasket and the upper portion of the plenum. A threaded nut is fitted to the conduit and above the gasket for securing the gasket against the geomembrane, thereby sealing the geomembrane to the upper portion of the plenum.
US09375760B2
A method for inspecting and detecting flaws in spheroidal products involves supplying the product to a transport element formed of pairs of supporting pads, turning the product over by means of inverting the rotation of at least one of the supporting pads, lighting the product, for example, with ultraviolet light, taking images and processing these to determine whether the product is suitable or not. The machine includes transport elements made up of pairs of freely rotating supporting pads (1) placed at regular distances on a conveyor chain, elements for controlling the rotation of the supporting pads independently as these move along, lighting devices and image capturing devices, in which the rotation control items are friction guides (25,27) placed at the bottom and top which are acted on by drive tracks (11) joined to the supporting pads.
US09375757B2
A screen system having a plurality of screen elements that can be readily removed and replaced to vary one or more characteristics of the screen surface formed by the screen system. The screen system includes a support system for supporting at least one screen element to prevent deformation of the screen element that typically would occur due to the insufficient structural stability of the at least one screen element relative to the weight of the product being screened. Preferably, the support system includes one or more support elements that can be readily and easily installed and removed from the screen system. The support system is preferably configured to permit the one or more support elements to be positioned at different locations in the screen system. Preferably, the support system is configured to permit a variety of different support elements to be used to allow a greater variety of screen elements to be used.
US09375738B2
A dispenser for discharging an in particular granular or powdery substance by blow-out, has a blow-out duct, and a suction line opening into the blow-out duct for sucking the substance into the blow-out duct. A positive air pressure can be built up in a duct section arranged upstream of the blow-out duct and closed in the direction of the blow-out duct by a valve opening in a pressure-dependent manner, for pressure-controlled formation of a blow-out stream in the blow-out duct. A method for emptying a substance reservoir having a freeze-dried substance sucks the substance out of the substance reservoir, using a suction air stream opening into a blowing stream, and discharges the substance. A sucking/blowing dispenser is used for emptying a substance reservoir having a freeze-dried substance.
US09375732B2
Systems and methods to improve the separation of drill cuttings from drilling fluids using cyclone devices are described. Specifically, a system for separating three phases of a gas/liquid/solid mixture is described. The system includes a cyclone for separating the gas/liquid/solid mixture into a solids component and a gas/liquid mixture; a gas/liquid separator for separating the gas/liquid mixture into a gas component and a liquid component; and a vacuum system for providing a motive force for moving the gas/liquid/solid mixture into the cyclone, moving the separated gas/liquid mixture into the gas/liquid separator and for removing the gas component from the gas/liquid separator.
US09375730B2
A centrifuge including: a rotor configured to be driven by a motor and to hold a sample, a centrifuge inverter, a chamber accommodating the rotor, a temperature sensor configured to detect the temperature of the chamber, a cooling machine configured to cool the chamber and including a compressor, a compressor inverter, a compressor motor configured to be controlled in a variable speed and a control device, wherein the control device carries out a feedback control of the compressor motor based on a preset temperature and a detected temperature of the temperature sensor when the rotation number of the compressor motor is larger than a predetermined rotation number, and the control device carries out an intermittent control for turning ON-OFF the cooling function of the compressor when the rotation number of the compressor motor is smaller than a predetermined rotation number.
US09375724B2
A process and device for separation of plastic material from other stuff of a various density by a flotation process in a liquid bath. The process involves discharging heavier stuff that settles on the screen bottom by a movable screen bottom slowly moves in the direction of reducing a slot that exists between one edge of screen bottom and the wall of the flotation tank and then after having reached a final position too quickly and abruptly move in the counter-direction. That movement occurs in intervals. This abrupt motion of screen bottom initiates that kinetic energy accumulated in the heaps of metal and other heavy stuff moves this stuff towards the slot-edge and through the slot into a collection-container underneath the screen bottom to be discharged.
US09375722B2
A wear plate for a grinding mill discharge head comprises a support structure adapted to secure to a wall of the grinding mill. An opening is defined in the support structure for registration with a corresponding opening in the mill wall. The wear plate further comprises an elastomeric body comprising at least one discharge hole extending there through, the body being adapted to overlay the support structure such that a discharge end of the hole is spaced inwardly of an edge of the support structure opening.
US09375720B2
A beater bar for a rock impact crusher, in particular a rotary impact crusher, including a carrier which, in the region of a cutting edge, has a plurality of cutting elements made of a hard material arranged next to one another. For the purpose of simple maintenance and for improved cost-effectiveness of the beater bar, according to this invention two or more cutting elements are fastened on a cutting-element holder, and two or more cutting-element holders can be interchangeably fastened to the carrier.
US09375718B2
A grinder roller assembly and a method of forming a grinder roller assembly are provided. The grinder roller assembly includes an elongated shaft that comprises a shaft outer surface. The grinder roller assembly further includes an insert plate. The insert plate has a plate outer surface that is noncircular and substantially smooth. The insert plate further has a plate opening that defines a plate inner surface and is configured to receive the elongated shaft. The grinder roller assembly further includes a roller having a roller opening that defines a roller inner surface that cooperates with the plate outer surface. The grinder roller assembly further includes at least one fastener that attaches the insert plate to the elongated shaft.
US09375706B2
Alkylation systems and processes are described herein. The alkylation system generally includes a preliminary alkylation system containing a preliminary alkylation catalyst therein and adapted to contact an aromatic compound and an alkylating agent with the preliminary alkylation catalyst so as to alkylate the aromatic compound and form a preliminary output stream, wherein the preliminary alkylation system includes a first preliminary alkylation reactor and a second preliminary alkylation reactor connected in parallel to the first preliminary alkylation reactor and a primary alkylation system adapted to receive the preliminary output stream and contact the preliminary output stream and the alkylating agent with a primary alkylation catalyst disposed therein so as to form a primary output stream.
US09375702B2
The invention relates to the field of ion exchange with the formation of a complex or chelate by using complex-forming polymers and can be used in nonferrous metallurgy and hydrometallurgy of indium for extraction of indium from wastewaters, as well as in the chemical industry and for producing special-purity substances.A method for producing a complex-forming sorbent for selective extraction of indium is proposed, wherein the method comprises the introduction of gem-diphosphonic functional groups, and wherein, in order to increase the selectivity and sorption capacity for indium, the gem-diphosphonic functional groups are introduced by the treatment of a spherically granulated cross-linked macroporous acrylonitrile-divinylbenzene copolymer with phosphorous acid at temperature of from 140 to 160° C. for from 13 to 35 hours. In the presence of a diluent (chlorobenzene), the method is carried out at a temperature of between 100 and 130° C.The technical result is to introduce gem-diphosphonic functional groups by the treatment of spherically granulated cross-linked macroporous acrylonitrile-divinylbenzene copolymer with phosphorous acid, which simplifies the method for production and increases capacity and selectivity of the synthesized sorbent for indium, thus improving a complex of the application properties of the material.
US09375700B2
An aspect of at least one embodiment of the present invention is a device for cracking heavy hydrocarbons. A linear applicator is positioned within heavy oil containing aromatic molecules. A radio frequency electrical current source is electrically connected to the applicator at a first connection point and a second connection point to create a closed electrical loop. The radio frequency source is configured to apply a signal to the applicator that is sufficient to create a magnetic field and an electric field relative to the axis of the linear applicator. The device also includes a chamber positioned around the applicator generally between the first connection point and the second connection point to concentrate the magnetic field within a region surrounding the applicator and containing the heavy hydrocarbons.
US09375698B2
A micro-reactor system assembly comprises a stack of at least n process modules (1-6), wherein n is an integer equal to or greater than 1, made from a rigid first material and comprising at least one reactive fluid passage (1A, 1B, 2A, 3A, 6A) for accommodating and guiding a reactive fluid, and at least n+1 heat exchange modules (7, 8) made from a ductile second material other than said first material and comprising at least one heat exchange fluid passage (7A, 8A) for accommodating and guiding a heat exchange fluid, wherein each process module (1-6) is sandwiched between two adjacent heat exchange modules (7, 8).
US09375695B2
A process and apparatus for mixing streams of regenerated and carbonized catalyst utilizes a ramp or bend provided on only one of the catalyst conduits to provide mixing advantages.
US09375693B2
The invention relates to a method for performing chemical processes, where raw materials are heated, wherein a melt pool is produced in a tank or reactor using low-melting metals or metal alloys, wherein the raw materials are metered directly into the melt pool in the lower part of the tank or reactor.
US09375691B2
Blending particulate and liquid to make slurry for use in oilfield operations is addressed. The blender has an upwardly facing particulate expeller with a flat base, raised hub, and generally radially extending, circumferentially spaced vanes extending upwardly from the base. The vanes extend from leading edges spaced about a vane inner diameter to tips spaced about a vane outer diameter. Adjacent expeller vanes define expeller passageways therebetween. The particulate expeller does not serve as a meaningful liquid impeller and the blender does not act significantly as a pump. The expeller has a several preferred diameter, clearance, height and length dimensions and ratios. Wide, deep expeller inlets and shallow, narrow outlets enhance particulate entry and minimize expeller torque. Vane extensions impart velocity to the particulate upon contact and minimize sensitivity to particulate entry velocity. Maximized circumferential overlap of adjacent vanes reduces liquid back-flow.
US09375687B2
The invention discloses an environmentally-friendly pasty discharge agent for textile printing and a method for preparing the environmentally-friendly pasty discharge agent. The environmentally-friendly pasty discharge agent for textile printing is formed by the following raw materials according to part by weight: decamethylcyclopentasiloxane: 30-60 parts; thiourea dioxide: 40-70 parts; surfactant: 1-3 parts; and glycerol: 3-6 parts. Decamethylcyclopentasiloxane is put into a ball mill, a surfactant is added into the ball mill to make the decamethylcyclopentasiloxane dispersed or dissolved uniformly and then stirred uniformly, and then thiourea dioxide is added into the ball mill and ground together for 1-3 hours. In the invention, the special liquid compound decamethylcyclopentasiloxane does not chemically react with the thiourea dioxide; in addition, it isolates the thiourea dioxide from outside water and air, thus increasing the stability of the thiourea dioxide. The discharge effect is excellent, the defects of low dissolvability, poor dispersion uniformity in the discharge paste, poor net permeability and insufficient discharge effect of the common thiourea dioxide as the discharge agent are overcome, and there is no influence on the touch of the discharged and printed textiles.
US09375679B2
An air dryer assembly with manifold system provides increased drying capacity for pressurized air systems, such as vehicle braking systems. A manifold connected to the supply ports of two adjacent air dryers allows parallel flow of air through the separate air dryers. An identical manifold connects to the delivery ports of the two air dryers to combine the clean, dry air from the delivery ports. Similar manifolds connect the control and purge ports of the dryers to allow simultaneous regeneration of the desiccant canisters. An assembly combining two air dryers, two pretreatment units, and manifolds connecting the supply, delivery, control, and purge ports of two air dryers is also disclosed.
US09375675B2
A gas cleaning unit for cleaning an effluent gas of at least one aluminium production electrolytic cell comprises a contact reactor in which the effluent gas is brought into contact with alumina, and a dust removal device for removing at least a portion of the alumina. The gas cleaning unit further comprises a wet scrubber in which the effluent gas is brought into contact with an absorption liquid containing water for removing further pollutants from the effluent gas. The wet scrubber is positioned at a point vertically higher than that of the dust removal device.
US09375665B2
System and method for replacing a resist filter in such a manner as to reduce filter-induced wafer defects are described. In one embodiment, the system comprises a filtration system connected to a dispenser, the filtration system comprising a filter; and a switch connected to the filter for selectively connecting the filtration system to throughput one of a first chemical solution and a second chemical solution.
US09375662B2
A suspension processing method using ultrasonic waves has problems in that movement of solids in liquid do not follow movement of the sound field. Accordingly, application to a field that requires a high suspension processing performance or a high flow rate process is difficult. In order to achieve the high suspension processing performance, a design of adopting a long and large oscillator and the like is required. A suspension processing device (30) of separating and concentrating a component of solids in suspension (1a) using ultrasonic waves, includes: at least one supply port (32) for supplying the suspension (1a) into the device; a channel (31) through which the suspension flows; at least two outlet ports (33 and 34) for discharging processed suspension (1a); an oscillator (35) for emitting ultrasonic waves; and a reflection plate (36) for reflecting the emitted ultrasonic waves.
US09375658B2
A porous, non-particulate, convectively permeable polysaccharide matrix has a surface on which there is fixed a grafted-on polymer derived from at least one ethylenic monomer compound having functional groups, wherein the polysaccharide matrix is prepared by grafting a porous, non-particulate, convectively permeable polysaccharide starting matrix with the at least one ethylenic monomer compound in the presence of an organic acid having at least one carboxylic acid group and/or at least one acidic XH group, where X=—O, —S, or —N, and of a transition metal or lanthanide compound. The polysaccharide matrix has a high protein binding capacity. A process for preparing the polysaccharide matrix and a method for using the polysaccharide matrix for material separation also are provided.
US09375657B2
A flash chromatography apparatus which provides an improved apparatus for large and medium commercial scale flash chromatography columns. More particularly, the invention relates to a flash chromatography column and cartridge system for positioning and ease of loading and unloading of stationary phase agent in the flash chromatography column. The flash chromatography column further provides flow distributors to support the stationary phase and permit plug flow through the column. The apparatus of the present invention is a modular and can be disposed in any configuration to reduce maintenance cost and downtime in a commercial installation. Flash chromatography is widely used for purification of low molecular weight organic compounds and products of organic synthetic reactions.
US09375653B2
Disclosed herein is a method for concentrating an ink composition, wherein the method comprises the steps of: (a) providing an ink composition, the ink composition comprising a liquid carrier and particles comprising a resin and a colorant, and wherein the ink composition contains less than 0.3 mg of charge director per g of solids in the ink composition; (b) passing the ink composition between a chargeable conveyor and a first electrode, wherein a potential is applied such that the ink composition becomes adhered to the chargeable conveyor, wherein the electric field between the chargeable conveyor and the first electrode is 2000 V/mm or more; (c) passing the ink composition on the conveyor past a moving surface, wherein the ink contacts the moving surface and a potential is applied between the conveyor and the moving surface, such that the chargeable particles are disposed to move toward the conveyor and some of the liquid carrier is removed to increase the concentration of the chargeable particles in the liquid carrier on the conveyor to form a concentrated ink on the conveyor, the conveyor and the moving surface then diverging from one another, and at least some of the concentrated ink remains on the conveyor, and (d) removing the concentrated ink from the conveyor and transferring it to a storage vessel. Also disclosed herein is an apparatus.
US09375649B2
In the present disclosure, disclosed herein, is a toy vehicle. The toy vehicle may include a front portion including a first arm, a second arm, and a first support member coupled to the first arm and the second arm; and a rear portion including a third arm, a fourth arm, and a second support member coupled to the third arm and the fourth arm. The toy vehicle may also include a plurality of wheels in which a first wheel of the plurality of wheels is coupled to the front portion and a second wheel of the plurality of wheels is coupled to the rear portion. An adjustment mechanism includes an actuator and a receiver. The actuator is engaged with the receiver and is rotatable relative thereto. The receiver is movable between a first position in which the receiver is spaced apart from the first support member and the second support member, and a second position in which the receiver contacts the first support member and the second support member.
US09375645B2
An information-processing system includes: at least one processor configured to display posting information relevant to an application on a display, which information is shared by plural users. The application is started and executed in response to selection of an object in a vicinity of a first item of posting information, while items of posting information are displayed on the display, using conditional additional information of the first item of posting information corresponding to the selected object.
US09375639B2
An image display system includes an image transmitter, a first display device that displays a first image, and a second display device that displays a second image, the second display device includes a display device side receiving unit that receives the second image, a display unit that displays the second image, a visual direction acquiring unit that acquires a current visual direction of the user, and a display device side transmitting unit that transmits the current visual direction, and the image transmitter includes a transmitter side receiving unit that receives the current visual direction, an extracting unit that extracts the first image as an image of a partial area in a whole image and the second image as an image of an area in response to the current visual direction in the whole image, and a transmitter side transmitting unit that transmits the first and second images.
US09375636B1
This disclosure relates to adjusting individualized content made available to users of an online game based on user gameplay information. In implementations, information relating to prospective usage of the online game is used to classify users according by user type, and content made available to the users is customized accordingly. Information relating to prospective usage may include predictive information such as demographic and geographic information, as well as game usage information for the users. User types may include resource collection, player versus player, and player versus environment. Customized content may include content made available to the users through the users in-game actions, such as exploring a map, researching a technology or skill, purchasing an in-game item, and completing an in-game achievement, including in-game items, in-game powers, in-game skills, in-game technologies, in-game pets, in-game transportation units, in-game units, and in-game buildings.
US09375632B1
A skateboard including a pair of trucks, a plurality of wheels mounted on axles of the trucks, a frame assembly, and a board mounted and attached to the frame assembly. The trucks can be mounted to the frame assembly and board.
US09375627B2
Systems and methods for determining a time of a passing a detection line by a participant having an RFID tag traveling along the route, the system includes a timing system an RFID tag reader system for wirelessly receiving tag reads including a tag identifier for the RFID tags, time stamps each RFID tag read, and transmits them to the timing system, a laser detector detects a laser beam interrupt and generates a laser beam interrupt indicator receives the generated laser beam interrupt indicator, and determines a beam interrupt time, and creates a laser beam interrupt message including the beam interrupt time, the timing system receives the tag read messages and the laser beam interrupt messages, determines the identity of the participant from the tag identifier, associates the laser beam interrupt message with the determined tag identifier, and stores the beam interrupt time as the time of detecting the passing.
US09375618B2
A golf club head with means for adjusting a center of gravity along more than one axis and means adjusting at least one of a characteristic selected from the group consisting of face angle, loft angle, and lie angle is disclosed herein. The golf club head comprises one or more adjustable features such as weight bars, weight screws, weight cartridges, and adjustable sole members, and preferably includes structural features such as pegs, teeth, and polymeric dampeners that serve to preload the one or more adjustable features on the golf club head and prevent or reduce unwanted vibrations when the golf club head is in use.
US09375614B2
Golf balls comprising a multi-layer core and a cover are disclosed. The multi-layer core comprises a zero or negative hardness gradient center that is hard relative to an intermediate core layer.
US09375603B2
Disclosed is a garment configured to receive resistance elements for elevating physiological load under motion. The garment includes left and right docking platforms for receiving left and right resistance elements which provide resistance to movement throughout an angular range of motion. The garment may be low profile, and worn by a wearer as a primary garment or beneath conventional clothing. Force transfer layers may be provided to transmit torque from the docking platforms to the garment while minimizing stretching or wrinkling of the garment. The garment may be a compression garment, including or constructed from fabric having at least about 30% stretch prior to tensile failure. Sensors may be provided for sensing any of a variety of biometric parameters and for determining exerted power or calories consumed.
US09375597B2
An upper Body Toning Device includes adjustable handles for various grip positions providing various angles of muscle resistance. The handles may be press inward along carriage guides countered by a resistance element. Multiple resistance elements may be included that may be removable providing adjustable resistance—allowing still yet, more exercises to be performed. A vertical mounting position with accessory hands.
US09375596B2
A suspension training device, system and method for using the same is disclosed. A suspension training device includes an elongated strap, a handle at a first end of the elongated strap, a harness at a second end of the elongated strap, and one or more stops, each stop being affixed at a position along a length of the elongated strap between the handle and the harness. A gravity training system includes two or more suspension training devices. The suspension training devices can be suspending with a stationary object by the stops, such as the elongated strap being threaded between a door and a doorframe, to a desired length to allow a user to accomplish any number of exercises or gravity-resistant movement.
US09375594B2
An assembly for connecting a sprinkler to a branch line of a fire suppression system includes a flexible conduit having one end attached to the branch line. The opposite end is attached to the sprinkler. The conduit is corrugated and has an outer surface with a plurality of crests and troughs. A sleeve co-axially surrounds a portion of the flexible conduit proximate to the sprinkler. The sleeve has a corrugated inwardly facing surface comprising a plurality of crests and troughs spaced so as to fit within the crests and troughs of the conduit and thereby prevent axial sliding motion of the sleeve relatively to the conduit. The sleeve and the flexible conduit are rotatable relatively to one another thereby preventing torque being applied to the flexible conduit through the sleeve.
US09375580B2
A device includes a signal generator module, a processing module, and a housing. The signal generator module is configured to deliver pacing pulses to an atrium. The processing module is configured to detect a ventricular activation event and determine a length of an interval between the ventricular activation event and a previous atrial event that preceded the ventricular activation event. The processing module is further configured to schedule a time at which to deliver a pacing pulse to the atrium based on the length of the interval and control the signal generator module to deliver the pacing pulse at the scheduled time. The housing is configured for implantation within the atrium. The housing encloses the stimulation generator and the processing module.
US09375579B2
A preferred atrial-based pacing method and apparatus is provided using an intelligent cardiac pacing system to having the ability to continue atrial-based pacing as long as relatively reliable AV conduction is present. In the event that such relatively reliable AV conduction is not present, mode switching to a DDD/R or a DDI/R pacing mode while continually biased to mode switch back to atrial-based pacing. The standard or relatively reliable AV conduction may be changed either automatically or manually. This increases pacing that utilizes natural AV conduction however possible so as to gain all the benefits of cardiac contractile properties resulting therefrom, while tolerating the occasional missed ventricular depolarization (i.e., non-conducted P-wave). In the event where relatively reliable AV conduction is not present, the pacing mode is switched to a DDD/R mode while detecting a return of the relatively reliable AV conduction (and resulting mode switch to preferred atrial based pacing).
US09375573B2
The present invention provides a system for providing neurological disease state information to a patient. The system comprises one or more sensors that sense at least one signal that comprise feature(s) that are indicative of a neurological disease state. A signal processing assembly is in communication with the one or more sensors and processes the at least one signal to estimate the neurological disease state. A patient interface module is in communication with the signal processing assembly and communicates with a patient an output that is indicative of the patient's estimated neurological disease state.
US09375570B2
Various embodiments are described herein for a method and system for improving a gait of a user with a functional electrical stimulation (FES) orthotic system. In some described embodiments, the method includes receiving motion information associated with the gait of the user; generating a foot orientation indicator for the foot based on a foot acceleration and a foot angular velocity provided in the motion information; determining a foot condition based on at least the foot orientation indicator and the foot acceleration; and adjusting signal parameters for a stimulation signal based on at least the foot condition. The foot condition can indicate a gait quality of the user and therefore, the stimulation signal is applied to the user to adjust an orientation of the foot when the gait quality of the user requires improvement.
US09375552B2
A safety needle assembly is disclosed which includes a a needle assembly and a needle guard. The needle guard is supported about a needle of the needle assembly and is positioned to engage an enlarged diameter portion of the needle during withdrawal of the needle guard from the needle to effect an inversion of the needle guard about a sharpened tip of the needle.
US09375550B2
Catheter actuators providing a mechanical advantage are disclosed. The actuators include a pull wire arm guide plate and a drive wheel attached around the pull wire arm guide plate and pivotable relative to the guide plate, the drive wheel comprising at least one thumb boss for pivoting the drive wheel about a drive wheel axis of rotation. The drive wheel mechanically engages at least one pull wire arm slidably mounted in a pull wire arm channel in the pull wire arm guide plate. A mechanism transfers drive wheel input into longitudinal motion of the at least one pull wire arm. The mechanism may include, for example, a pin pushing against a bendable pushing member riding in an arcuate pin groove in a top surface of the guide plate, or a pin pushing against a surface of a cam arm pivotably mounted on the top surface of the guide plate.
US09375547B2
A personal air filtration device and methods of using the same for providing a zone of filtered air proximate a breathing zone of a user are described. A blower provides an air flow to a head support which delivers the air flow to a zone proximate the users head. The air flow passes through a filter. The filter can be a point of delivery filter disposed about an air permeable surface of the head support. The delivered air flow can provide a laminar air flow defining a zone of filtered air about the user's breathing zone.
US09375540B2
The claimed invention is an apparatus to assist and encourage a person to take long, deep and steady breaths. The invention is designed to provide improved health for the user by fostering; improved breathing and relaxation, aroma delivery and positive smell association, calmer clearer thinking, reduced stress and anxiety, as well as providing a substitute for potentially harmful habits such as smoking, over-eating, over-drinking and other forms of drug abuse. This invention may also reduce the impact of some existing physiological and psychological health conditions.
US09375539B2
The subject multimodal surgical gas delivery system configured to couple to one or more surgical devices providing access into a patient body cavity includes a computer-controlled control unit configured and adapted to provide at least one of the following modes of operation. A first mode of operation for providing a pressurized insufflation fluid from an insufflation gas source into a surgical device for providing and maintaining sealable access to the body cavity in a surgical device. A second mode of operation for performing smoke evacuation in a filter element from insufflation fluid caused to recycle through the multimodal system from the body cavity via a surgical device. A third mode of operation for providing insufflation fluid from the insufflation gas source into the body cavity for creating and maintaining insufflation of the body cavity.
US09375538B2
Dispenser for the delivery of liquid media, having a base unit and a delivery head with a delivery opening. The delivery head includes a first portion which includes a fastening device by means of which the first portion is fastened or fixed in position with respect to a media storage unit on the base unit, and which includes the delivery opening. The delivery head includes a second portion realized so as to be movable in relation to the first portion and includes an actuating handle which is operatively coupled with the coupling piece such that a displacement of the actuating handle in relation to the first portion leads to a displacement of the coupling piece in relation to the first part portion.
US09375535B2
According to one aspect, a resettable drive assembly for a drug delivery device is provided for. The resettable drive assembly may comprise a housing having a proximal end and a distal end, a piston rod being rotatable with respect to the housing and being axially displaceable with respect to the housing between a proximal start position and a distal end position, a drive member for distally displacing the piston rod towards the end position when dispensing a dose, and a stop member. The drive assembly may be configured such that the drive member is operable to interact with the piston rod for forming an unlockable first interlock, the first interlock being operable to block proximal movement of the piston rod with respect to the drive member. The drive assembly may be configured such that the stop member is operable to interact with the piston rod for forming an unlockable second interlock, the second interlock being operable to block proximal movement of the piston rod with respect to the housing. The drive assembly may be configured such that, when the drive assembly is in a drive mode, the first and second interlocks are locked such that proximal movement of the piston rod from the end position to the start position is prevented by the first interlock and the second interlock. The drive assembly may be configured such that, for switching the drive assembly from the drive mode to a reset mode, the piston rod is rotatable with respect to the drive member for unlocking the first interlock and the stop member and the piston rod are rotatable with respect to each other for unlocking the second interlock. The drive assembly may be configured such that, when the drive assembly is in the reset mode, the first interlock and the second interlock are unlocked such that proximal movement of the piston rod to the start position is allowed. Further, a drug delivery device and a use of a spring are provided for.
US09375523B2
Method and apparatus for controling flow rates and patterns of human milk secretion by a breast pump
The invention relates to an apparatus and method to control the flow rates and pattern of human milk secretion while using a breast pump. The apparatus comprises a breast pump having a linear source of vacuum and a communication port for communicating with an external source of information on milk flow rates and patterns of a breastfeeding baby, through an external control circuit.
US09375522B2
A minimally invasive method of and apparatus for aspirating purulent material from an epidural abscess, or the like, in a patient includes a dual concentric catheter system having an inner infusion catheter and an outer suction catheter, the infusion catheter able to be advanced relative to and beyond the suction catheter. The catheter system is introduced into the extradural space through percutaneous entry and advanced to an epidural abscess of interest. Infusion is used to dislodge purulent material ahead of the infusion catheter toward side openings in the suction catheter where it is aspirated.
US09375518B2
The invention relates to a biodegradable barrier network comprising at least two macromolecular substances, one being anionic and the other one cationic. The invention also relates to applicators and kits comprising components to be used to create said biodegradable barrier network. The invention also relates to the use of said applicator or kit in therapy, such as in medicine, veterinary medicine and horticulture.
US09375517B2
Embodiments of the invention include lubricious medical device coatings. In an embodiment the invention includes a coating for a medical device including a first layer comprising polyvinylpyrrolidone derivatized with a photoreactive group; and a first cross-linking agent comprising at least two photoreactive groups; a second layer disposed on the first layer comprising polyvinylpyrrolidone derivatized with a photoreactive group; a second cross-linking agent comprising at least two photoreactive groups; and a polymer comprising polyacrylamide, the polymer derivatized with at least one photoreactive group. Other embodiments are included herein.
US09375516B2
A growth factor delivery scaffold combines a heparin/fibrin-based delivery system (HBDS) with a backbone based on polymer nanofibers for tissue (e.g., tendon and ligament) repair. The scaffold has improved surgical handling properties compared to the gelatinous consistency of the prior art HBDS system and retains the capability for delivering mesenchymal cells and controlling the release of growth factors. One application for the scaffold is mesenchymal stem cell (MSC) therapy for flexor tendon repair. The scaffold can deliver growth factors in a sustained manner, can be implanted for flexor tendon repair, is biocompatible, and is not cytotoxic. The growth factor delivery scaffold may also be used in the surgical repair of an injury to bone, muscle, cartilage, or other tissues.
US09375513B2
Methods of making tissue fillers are provided. In certain embodiments, the tissue is flake-like and has regenerative properties.
US09375499B2
A disposable, virus-trapping membrane, and a corresponding method to remove viruses from solution are described. The membrane includes a disposable, micro-porous filter membrane and a ligand immobilized on the membrane. The ligand irreversibly and selectively binds viruses. The ligand also has a pKa sufficiently high to repel antibodies via electrostatic charge repulsion.
US09375498B2
A process for the preparation of complexes containing 68Ga wherein a buffer formic acid/formate in the presence of compounds capable to sequester metal cations is used in the complexion reaction.
US09375494B2
Oxygen sensing luminescent dyes, polymers and sensors comprising these sensors and methods of using these sensors and systems are provided.
US09375487B2
A recombinant fusion protein comprising a human erythropoietin peptide portion linked to an immunoglobulin peptide portion is described. The fusion protein has a prolonged half-life in vivo compared to naturally occurring or recombinant native human erythropoietin. In one embodiment, the protein has a half-life in vivo at least three-fold higher than native human erythropoietin. The fusion protein exhibits enhanced erythropoietic bioactivity compared to native human erythropoietin. In one embodiment, the fusion protein comprises the complete peptide sequence of a human erythropoietin (EPO) molecule and the peptide sequence of an Fc fragment of human IgG1, which Fc fragment includes the hinge region, CH2 and CH3 domains. The EPO molecule may be linked directly to the Fc fragment to avoid extraneous peptide linkers and lessen risk of an immunogenic response when administered. In one embodiment the hinge region is a human Fc fragment variant having a non-cysteine residue at amino acid 6.
US09375477B2
Aqueous-gel type topical compositions are described. The compositions can be in the form of a homogeneous suspension of an active principle of the class of retinoids including at least one hydrophobic silica, the active principle preferably having general formula (I), and more specifically being 3″-tert-butyl-4′-(2-hydroxy-ethoxy)-4″-pyrrolidin-1-yl-[1,1′3′,1″]-terphenyl-4-carboxylic acid. Also described, is the preparation mode thereof and the use of same in the treatment of dermatological conditions.
US09375474B2
The present invention includes compositions that are useful in preventing or treating metastasis in a subject diagnosed with cancer. The present invention also includes methods of preventing or treating metastasis in a subject diagnosed with cancer, wherein the method comprises administering to the subject in need thereof an effective amount of a pharmaceutical formulation comprising at least one pharmaceutically acceptable carrier and at least one CX3CR1 or fractalkine antagonist.
US09375465B2
In certain embodiments, this disclosure relates to conjugates comprising GM-CSF and IL-7 and uses related thereto, e.g., enhancing the adaptive immune system. Typically the GM-CSF and IL-7 are connected by a polymer linker, e.g., polypeptide. In certain embodiments, the disclosure relates to nucleic acids encoding these polypeptide conjugates, vectors comprising nucleic acid encoding polypeptide conjugates, and protein expression systems comprising these vectors such as infectious viral particles and host cells comprising such a nucleic acids.
US09375460B2
The invention discloses the use of glutathione S-transferase Pb (GSTP1) for the prevention or treatment of cardiomyopathies or ischemic heart diseases and for the diagnosis thereof.
US09375454B2
The present invention relates to the field of infant nutrition. In particular, the present invention relates to infant feeding formulas comprising probiotic micro-organisms. These probiotic micro-organisms may be non-replicating probiotic micro-organisms such as bioactive heat treated probiotic micro-organisms, for example.
US09375448B2
The invention relates to the use of encapsulates of cancer cells, in agarose coated, agarose containing beads, for isolating chemotherapeutic resistant cells which have at least one stem cell property, such as expression of OCT4. The cells thus isolated are also a feature of the invention, as is a method for screening for potential therapeutic agents.
US09375446B2
There is provided a skin rejuvenation composition which comprises at least one oxidant, at least one photoactivator capable of activating the oxidant, and at least one healing factor chosen from hyaluronic acid, glucosamine and allantoin, in association with a pharmaceutically acceptable carrier.
US09375444B2
A prophylactic antiallergenic composition includes at least one arabinogalactan or arabinogalactan protein. The arabinogalactan or arabinogalactan protein is isolated from a grass or corresponds in its structural arrangement to an arabinogalactan that can be isolated from a grass.
US09375443B2
Provided herein are methods for treating or preventing advanced non-small cell lung cancer, comprising administering an effective amount of a TOR kinase inhibitor and an effective amount of erlotinib or a cytidine analog to a patient having advanced non-small cell lung cancer.
US09375439B2
Provided herein are small molecules for the induction of fibroblast proliferation and increased secretion or production of proteins. The small molecules described herein can be used for the promotion of skin regeneration. Also provided herein are methods for promoting skin regeneration and wound healing.
US09375438B2
Methods and compositions are provided that are utilized for treatment and/or prevention of intraventricular hemorrhage or progressive hemorrhagic necrosis (PHN), particularly following spinal cord injury. In particular, the methods and compositions are inhibitors of a particular NCca-ATP channel and include, for example, inhibitors of SURI and/or inhibitors of TRPM4. Kits for treatment and/or prevention of intraventricular hemorrhage or progressive hemorrhagic necrosis (PHN), particularly following spinal cord injury, are also provided. The present invention also concerns treatment and/or prevention of intraventricular hemorrhage in infants, including premature infants utilizing one or more inhibitors of the channel is provided to the infant, for example to brain cells of the infant.
US09375437B2
The present invention provides for progesterone containing pharmaceutical oral dosage forms, pharmaceutical kits, and related methods. In one embodiment, an oral dosage form formulated for on-going administration is provided. The oral dosage form includes an amount of progesterone and a pharmaceutically acceptable carrier. The oral dosage form is formulated such that upon single dose administration to a non-pregnant woman in follicular phase, the oral dosage form provides a serum progesterone C24h of at least 0.20 ng/mL.
US09375436B2
The present invention is directed to a method of using dehydroepiandrosterone to treat a human female with diminished ovarian reserve. The method includes administering about 25 milligrams three times a day of dehydroepiandrosterone per day to the female for at least four weeks to reduce human embryo aneuploidy. The present invention further is directed to a method of treating a human female with diminished ovarian reserve to improve the female's diminished ovarian reserve.
US09375435B2
The present invention relates to the use of a DNA expression construct comprising a dumbbell-shaped circular strand of deoxyribonucleic acids and provides such a construct with a double-stranded stem and single-stranded loops located at both ends of the stem, wherein the stem comprises complementary deoxyribonucleic acids of the circular strand with a promotor sequence, a coding sequence and a termination signal to be administered by jet injection for the treatment of cancer.
US09375434B2
An antitumor effect potentiator for potentiating one or more other antitumor agents, comprising, as an active ingredient, an imidazooxazine compound represented by Formula (I), or a pharmaceutically acceptable salt thereof, wherein A, B, C, and D represent C—R1a, C—R1b, C—R1c, and C—R1d, respectively, or one or two of A, B, C, and D represent an N atom; at least two of R1a, R1b, R1c, and R1d represent hydrogen, and the other(s) represent(s) halogen; cyano; C1-6 alkyl that may have hydroxyl group(s) as substituent(s); C1-6 alkoxy; carbonyl having, as a substituent, hydroxyl, amino, optionally substituted mono- or di-(C1-6 alkyl)amino, or mono- or di-(C1-6 alkoxy)amino; or an unsaturated heterocyclic group; R2 represents phenyl, pyridyl, or thienyl; R3 represents hydrogen, methyl, ethyl, or cyclopropyl; and R4 represents hydrogen or hydroxy.
US09375432B2
The invention relates to compounds of formula (I), or a pharmaceutically acceptable salt thereof: which possess inhibitory activity against activating mutant forms of EGFR, and are accordingly useful for their anti-cancer activity and in methods of treatment of the human or animal body. The invention also relates to processes for the manufacture of the compounds, or a pharmaceutically acceptable salt thereof, to pharmaceutical compositions containing them and to their use in the manufacture of medicaments of use in the production of an anti-cancer effect in a warm-blooded animal such as man.
US09375426B2
The present invention provides a method of screening anti-plasmodial activity of Acriflavin, comprising assessing growth inhibition of plasmodium in vitro in chloroquine susceptible and cloroquine resistant plasmodium by Acriflavin; or measuring in-vivo plasmodium killing ability of Acriflavin; assessing localization of Acriflavin at different stages; and analyzing effect of Acriflavin on gyrase activity wherein said method utilizes Acriflavin in nano-molar range. The present invention relates to potency of Acriflavin (Acriflavin) as an anti-malarial agent both in vitro parasite culture as well as in vivo. More specifically, the invention relates to a method o determining anti-plasmodial activity, Acriflavin as potent anti-malarial agent and also relates to composition(s) comprising Acriflavin.
US09375424B2
The invention provides methods and compounds for the treatment and prevention of malaria infection and transmission in a mammal by administering compounds of the invention to a mammal having or suspected of having a malaria infection. The invention also provides pharmaceutical compositions that can kill or arrest the growth of Plasmodium organisms, and especially Plasmodium falciparum, thereby preventing or blocking transmission of malaria as well as treating malaria infection.
US09375422B2
Disclosed is a fentanyl-containing adhesive preparation for external use, wherein an adhesive layer is laminated on a supporting body. The adhesive layer contains SIS, a tackifier resin that is composed of a rosin resin and terpene resin, and a softener that is composed of a plybutene and a liquid paraffin. The adhesive layer also contains fentanyl as an active ingredient. The fentanyl-containing adhesive preparation for external use has excellent skin permeation of fentanyl and high preparation stability, without suffering from crystallization of fentanyl during storage.
US09375421B2
A pharmaceutical intervention and therapeutic method for treating an apraxia of speech in children. The child can also be diagnosed with gait abnormalities or impairment autism, mental retardation and dyslexia. If the child demonstrates at least an 18 to 24 month development stage of either verbal development or non-verbal development, a therapeutic dose of a dopamine agonistic, particularly a nonlinear lower alkyl phenidate or dextro-threo-methylphenidate is administered to the child.
US09375417B2
The present invention includes a transdermal composition which contains a pharmaceutically effective amount of a cannabinoid for delivery of the cannabinoid to the bloodstream of a user. The composition may comprise the following components: a surfactant-lecithin organogel; and a cannabinoid. The composition may also comprise an exogenous terpene. The cannabinoid is capable of diffusing from the composition into the bloodstream of the user, and may be used in methods for treating a patient suffering from a condition such as pain, nausea and emesis, convulsions, muscle spasm, inflammation, depression, and cachexia.
US09375416B2
Providing a compound capable of continuously taking and having a vascular endothelial function improving effect by enhancing NO function from the vascular endothelial cells.A compound represented by Formula (I) wherein R1, R2, R3 and R4 are each independently H or a gallate group, a vascular endothelial function improving agent, food and drink or pharmaceutical composition containing the compound.
US09375413B2
Provided are methods of reducing milk somatic cell count using L-arginine supplementation of lactating ruminant animals during gestation, and/or during the lactation phase post parturition to decrease somatic cell count in milk produced by the animals.
US09375408B2
Deuterated and non-deuterated forms of tetrahydrocurcumin are described herein. Methods of making tetrahydrocurcumin in deuterated and non-deuterated forms and pharmaceutical formulations including tetrahydrocurcumin in deuterated and non-deuterated forms are disclosed. Methods of treating a subject using deuterated forms of tetrahydrocurcumin or non-deuterated forms of tetrahydrocurcumin are also disclosed.
US09375407B2
Dimethyl trisulfide (DMTS) antidote compositions may be used to as a cyanide poisoning antidote.
US09375395B2
The present invention relates to a composition comprising an NFκB-inhibitor and a tropoelastin promoter, and methods of treating signs of skin aging using said compositions.
US09375388B2
This invention relates to a nanoparticulate composition comprising lipid based nanostructures of 100-200 nm co-encapsulating nutrients selected from the group comprising iron as ferrous, ferric salts or elemental iron, iodine, folic acid, vitamins or micronutrients, incorporated within the matrix of a cosmetic and methods of making said nanoparticle composition.
US09375380B2
A walker frame is provided which has a generally open space frame and has handle portions that are cantilevered.
US09375370B2
A foldable wheelchair includes two side frames, each having a front wheel and a rear wheel mounted thereon, and a scissor-type element arranged between the side frames and having two scissor-type arms that are mounted pivotably in the side frames in one scissor-type element end. The scissor-type arms are mounted pivotably in another scissor-type element end in manually actuable actuating members that are mounted pivotably to the side frames at a distance from the pivot axis of the other scissor-type element end. A folding hinge is mounted pivotably in the side frames and is arranged at a distance from the other scissor-type element end. An actuating means is connected pivotably to the folding hinge at a distance from the side frames and is effective between the folding hinge and one of the actuating members at a distance from the pivot axis of the actuating member in the associated side frame. Means are provided for fixing at least one actuating member relative to the associated side frame in the unfolded position of the wheelchair.
US09375369B2
A vehicle lift for a load, such as a wheelchair. The whole lift is movable between a first retracted position and a second extended position comprising a support pillar, a platform, a lifting device, and a biasing element. The platform is connected pivotably to the support pillar and has a horizontal pivot axis such that the platform is pivotable about the horizontal axis. The lifting device is hingedly connected to the support pillar and is configured for lifting and lowering the support pillar with the platform between the retracted position and the extended position. The biasing device biases the platform in to the second extended position and acts upon the region of the hinged connection between the platform and the support pillar.
US09375357B2
A male incontinence guard having a longitudinal extension defined between a first and a second end and a triangular base shape, the male incontinence guard comprising a liquid permeable top sheet, a liquid impermeable back sheet; an absorbent core, the absorbent core having straight longitudinal side edges; a side barrier at each longitudinal side edge of the absorbent core, each side barrier having an outer edge facing away from the respective longitudinal side edge of the absorbent core and an elastic fixed to at least the back sheet between the longitudinal side edge and the outer edge; wherein a distance between the elastics of the side barriers and the respective longitudinal side edge of the absorbent core in a direction perpendicular to the longitudinal side edge differs along the longitudinal direction.
US09375355B2
The present subject matter relates to absorbent articles and signaling devices for use therewith. The signaling device includes one or more non-invasive sensors configured to detect the presence of a substance, such as a body fluid, in the absorbent article. The signaling device can provide an audible and/or visible alert to the user of the absorbent article when it detects the presence of a substance. The absorbent article includes one or more identifiable characteristics the presence of which permits operation of the signaling device. In this manner, the present disclosure provides for product and signaling device matching for use.
US09375352B2
Manifold structures, systems, and methods are disclosed that include using longitudinal members and one or more shaped projections to cause microstrain at a tissue site. In one instance a manifold structure includes a plurality of spaced longitudinal members and at least one shaped projection coupled to at least one of the plurality of longitudinal members for creating a microstrain at a tissue site. The at least one shaped projection includes a columnar member having a distal end and includes an enlarged member positioned at the distal end of the columnar member. The columnar member has a first outer diameter (D1) and the enlarged member has a second outer diameter (D2). The second outer diameter of the enlarged member is greater than the first outer diameter of the columnar member (D2>D1). Other systems, methods, and structures are presented.
US09375350B2
A steerable laser probe may include a handle having a handle distal end and a handle proximal end, an actuation control of the handle, a flexible housing tube having a flexible housing tube distal end and a flexible housing tube proximal end, an optic fiber disposed within an inner portion of the handle and the flexible housing tube, and a cable disposed within the flexible housing tube and the actuation control. A rotation of the actuation control may be configured to gradually curve the flexible housing tube and the optic fiber. A rotation of the actuation control may be configured to gradually straighten the flexible housing tube and the optic fiber.
US09375347B2
The device comprises at least an inlet tube for the passage of fluid to be drained, said tube being connected to a chamber wherein said chamber comprises rotating means for adjusting the flow rate in said tube.
US09375346B1
An absorbent pad. A first side of the absorbent pad is configured to abut a patient at a fluid discharging area or other location. Discharging fluid passes through a fluid-permeable liner of the absorbent pad into absorbent material. Liquid may be placed in the absorbent material prior to placing it on a patient and heated or cooled. An overwrap may be wrapped around the patient to hold the hot or cold compress in place while absorbing discharging fluid from the patient. A fluid barrier at a second side of the absorbent pad, parallel with the first side, prevents liquid from passing out of the absorbent pad at the second side. A coupler having hooks is disposed on the second side of the absorbent pad and is configured to engage with fibers of the overwrap in order to secure the absorbent pad in place with respect to the patient and overwrap.
US09375341B2
An orthopedic device has detachable components for treatment stages of an injury or surgical procedure. The orthopedic device is arranged as a protective functional support for regeneration of knee cartilage after surgical repair procedures, and includes a flexion control kit and a wrap-around liner sleeve.
US09375340B2
Systems, methods, and devices are described for providing a brace having an inflation control. The control directs fluid flow from an inflation component to one or more inflatable cells of the brace. The inflatable cells are independently inflated and deflated by the inflation component through the control. The control allows a user to create a fluid path between the inflation component and one of the inflatable cells by positioning the control in an orientation corresponding to the desired inflatable cells. Each inflatable cell is independently inflated and deflated in various orientations of the control.
US09375336B1
A delivery device can provide sequential delivery of a plurality of intraluminal devices or tacks held in a compressed state on the delivery device. Delivery platforms on the delivery device can hold a tack in a compressed position and have a unique shape, such as a non-constant outer diameter, an hourglass shape, a tapered proximal half, ridges, dimples, etc. This unique shape can be positioned between annular pusher bands that may also be radiopaque markers. In some embodiments, the unique shape is provided by a sleeve of flexible material with the unique shape surrounding a harder inner shaft. Further, the annular pusher bands can be made of wire or sections of material to increase flexibility while remaining radiopacity. A tack deployment method can include alignment of radiopaque markers on the outer sheath and the tack to be deployed prior to deployment.
US09375334B2
A method for crimping a bioabsorbable stent in a humid environment is disclosed.
US09375328B2
An angioplasty balloon including a non-deployable stent to prevent or reduce the potential for slippage of the inflated balloon with respect to the vessel wall being treated. The balloon includes a non-deployable stent that is adapted to be secured to the balloon or angioplasty balloon catheter. The stent has a proximal end, a distal end, and at least three radially-spaced struts, each, each strut connecting the proximal end to the distal end and having one or more bends that allow expansion of the strut to accommodate the inflation of the balloon. The stent is made or a material so that the stent collapses upon deflation of the balloon.
US09375323B2
Assemblies of one or more implant structures make possible the achievement of diverse interventions involving the fusion and/or stabilization of lumbar and sacral vertebra in a non-invasive manner, with minimal incision, and without the necessitating the removing the intervertebral disc. The representative lumbar spine interventions, which can be performed on adults or children, include, but are not limited to, lumbar interbody fusion; translaminar lumbar fusion; lumbar facet fusion; trans-iliac lumbar fusion; and the stabilization of a spondylolisthesis.
US09375320B2
Systems, devices and methods relating to a spinal implant for placement in a disc space of a spine are described. A spinal implant (1) can include a plurality of wedge members including a leading wedge (22), a trailing wedge (28), and one or more intermediary wedges (26) therebetween. The spinal implant (1) can be configured to have a first linear configuration in which the plurality of wedge members are in a linearly expanded form and a second circular configuration in which the plurality of wedge members are positioned circumferentially relative to a center axis. In its first configuration, the spinal implant (1) can be delivered to a disc space, whereby it can assume its second configuration within the disc space, thereby forming a replacement nucleus. The spinal implant (1) can be kept in its first configuration by a rod member (41) received as through the plurality of wedge members. The wedge members can be slidably removed off of the rod member (41) and can assume the second configuration.
US09375314B2
Rear tip extenders include a tether attached to a collar that can be mounted onto a respective cylinder forward of a fluid line (that communicates with a scrotal pump) to prevent full separation or detachment from the cylinder during a revision procedure.
US09375312B2
A transcatheter atria-ventricular valve prosthesis for functional replacement of an atrio-ventricular valve in a connection channel, having a circumferential connection channel wall structure, between atrial and ventricular chambers of a heart, including an inner device to be disposed in the interior of the connection channel, the inner device having a circumferential support structure which is radially expandable and having a valve attached to the circumferential support structure, and an outer device to be disposed on the exterior of the connection channel, wherein the outer device at least partly extends around the inner device at a radial distance to the inner device, wherein the inner and outer devices form a securing mechanism for securing the circumferential connection channel wall structure therebetween.
US09375311B2
A valve prosthesis includes an expandable frame. The expandable frame has an outflow portion and an inflow portion connected to the outflow portion. The frame defines a central lumen extending between the outflow portion and the inflow portion. The frame is generally cylindrical in a fully expanded configuration. When the frame is in the fully expanded configuration, an outer surface of the inflow portion is concave. The inflow portion has an upper inflow portion and a lower inflow portion. When the frame is in the fully expanded configuration, the upper inflow portion flares outwardly from the central lumen of the frame to greater extent than the lower inflow portion.
US09375310B2
A prosthetic heart valve configured to replace a native heart valve and having a support frame configured to be reshaped into an expanded form in order to receive and/or support an expandable prosthetic heart valve therein is disclosed, together with methods of using same. The prosthetic heart valve may be configured to have a generally rigid and/or expansion-resistant configuration when initially implanted to replace a native valve (or other prosthetic heart valve), but to assume a generally expanded form when subjected to an outward force such as that provided by a dilation balloon or other mechanical expander.
US09375307B2
A pattern of graft material that allows for radial expansion and contraction that comprises a plurality of rows of folds with an undulating configuration with at least one apex and at least one trough and the rows of folds each have a ridge and a valley therein. At least one stent with an undulating configuration can be attached to the at least one row of folds.
US09375298B2
A dental model and related systems and methods, including a first component representing a portion of a patient's jaw and a second component that is demountably attachable to the first component, and a second component representing a dental structure of interest, such as the remaining portion of a tooth or a dental implant.
US09375295B2
In an arrangement for obtaining reliable anchoring of a threaded implant in dentine, a hole is made in the bone substance. In the side wall of the hole it is possible to establish an internal threading which can cooperate with an external threading on the implant. The implant threading is arranged to force the bone substance out in essentially radial directions as a function of the extent to which the implant is screwed into the hole. The threading is arranged to effect greater forcing out of the bone substance at the outer parts of the hole than at the inner parts of the hole. The degree of forcing out is adapted in relation to the softness of the bone in order to achieve the reliable anchoring. Along at least part of the longitudinal direction of the implant, the implant threading can be given a non-circular configuration for the purpose of obtaining improved rotational stability in soft/weak bone.
US09375291B2
A dispensing device comprises a compartment for receiving a dental material, a piston for extruding the material from the compartment and a spindle drive for moving the piston and the compartment relative to one another. The spindle drive comprises a spindle and a link which are adapted for disengageable engagement with one another, wherein the spindle and the link are operable relative to each other between an engaged position in which the link and the spindle are engaged with one another, and a disengaged position in which the spindle and the link are disengaged from one another. The device may be relatively robust and inexpensive to manufacture, and may facilitate preparation of dental materials for use.
US09375288B2
A method for a minimally invasive surgical system is disclosed including reading first tool information from a storage device in a first robotic surgical tool mounted to a first robotic arm to at least determine a first tool type; reading equipment information about one or more remote controlled equipment for control thereof; comparing the first tool information with the equipment information to appropriately match a first remote controlled equipment of the one or more remote controlled equipment to the first robotic surgical tool; and mapping one or more user interface input devices of a first control console to control the first remote controlled equipment to support a function of the first robotic surgical tool.
US09375287B2
A marker device that aids in the subsequent identification of a particular area is equipped with an anchoring device that prevents migration once placed in the tissue of that particular area. The device may include a chemical agent or drug that adds a therapeutic function to the marker device.
US09375285B2
Instruments are provided, representative embodiments of which have a first and a second jaw, from each of which at least one engaging element, whose distal end is suitable for engaging the skin tissue to be stretched, protrudes; an elastic member connecting the jaws, stressing them against each other when subjected to a traction force; and elements for adjusting the distance separating the jaws in the absence of traction force on the elastic member.
US09375284B2
Devices, systems, and methods for providing increased range of movement of the end effector of a manipulator arm having a plurality of joints with redundant degrees of freedom. Methods include defining a position-based constraint within a joint space defined by the at least one joint, determining a movement of the joints along the constraint within a null-space and driving the joints according to a calculated movement to effect the commanded movement while providing an increased end effector range of movement, particularly as one or more joints approach a respective joint limit within the joint space.
US09375283B2
A method for performing a surgical procedure within lungs of a patient. The method comprising the steps of providing a plurality of surgical instruments and providing a housing. Attaching a flexible, elongated shaft with distal and proximal ends to the housing. Engaging at least one working end to the distal end of the housing, the working end including a plurality of tubes disposed therein that define a corresponding plurality of working channels for housing a corresponding plurality of surgical instruments. Controlling an actuator to engage at least one of the corresponding plurality of surgical instruments, wherein rotation of the working end with respect to a longitudinal axis of the elongated shaft engages at least one of the plurality of surgical instruments with the actuator to deploy the at least one surgical instrument to the lung as needed during a surgical procedure.
US09375281B2
The invention relates to a light application apparatus (1) for applying light to an object (3). A light source (4) generates processing light (2) and sensing light (5), which are coupled into the object (3). A light detector (8) detects the sensing light (5) after having left the object (3), and a control unit (9) controls the light source (4) such that processing light (2) in a processing time interval and sensing light (5) in a sensing time interval are alternately generated. Since processing light and sensing light are generated alternately, the generation of the processing light and of the sensing light is decoupled, i.e. the processing light can be optimized for processing purposes and the sensing light can be optimized for sensing purposes. This allows improving the quality of sensing the object and, thus, the quality of controlling the application of light depending on properties of the object.
US09375278B2
A microwave ablation system includes an energy source adapted to generate microwave energy and a power splitting device having an input adapted to connect to the energy source and a plurality of outputs. The plurality of outputs are configured to be coupled to a corresponding plurality of energy delivery devices. The power splitting device is configured to selectively divide energy provided from the energy source between the plurality of energy devices.
US09375276B2
A microwave ablation system is provided. The microwave ablation system includes a power source. A microwave antenna is adapted to connect to the power source via a coaxial cable feed including an inner conductor defining a portion of a radiating section of the microwave antenna, an outer conductor and dielectric shielding. The inner conductor loops back around and toward the outer conductor of the coaxial cable feed such that a distal end of the inner conductor is operably disposed adjacent the dielectric shielding. The inner conductor includes one or more reactive components disposed thereon forming a reactively-loaded loop configuration configured to maximize delivery of microwave energy from the power source to tissue such that a desired effect to tissue is achieved.
US09375271B2
An electrosurgical system is disclosed. The electrosurgical system includes an electrosurgical generator adapted to supply electrosurgical energy to tissue. The electrosurgical generator includes impedance sensing circuitry which measures impedance of tissue, a microprocessor configured to determine whether a tissue reaction has occurred as a function of a minimum impedance value and a predetermined rise in impedance, wherein tissue reaction corresponds to a boiling point of tissue fluid, and an electrosurgical instrument including at least one active electrode adapted to apply electrosurgical energy to tissue.
US09375264B2
An end effector assembly adapted to couple to an electrosurgical instrument, the end effector assembly including a pair of opposing jaw members pivotably attached about a pivot member and moveable from a first spaced position to a second grasping position. Each jaw member includes a jaw housing and a seal plate formed on an inner surface of the jaw member including at least two seal plate segments extending along a substantial portion of the length of the jaw members. An insulating member is positioned between adjacent seal plate segments and configured to provide electrical isolation between adjacent seal plate segments. Each sealing plate segment is adapted to selectively connect to an electrosurgical energy source and form part of an electrosurgical energy delivery circuit.
US09375263B2
A surgical instrument includes a housing that supports an elongated shaft. A selectively movable drive rod extends through the elongated shaft and carries a cam pin in a longitudinal direction. An end effector for surgically treating tissue is supported by the elongated shaft and includes upper and lower jaw members pivotally coupled to one another about a pivot axis. The upper jaw member includes a first pair of laterally spaced flanges, and the lower jaw member includes a second pair of laterally spaced flanges defining a camming slot for engaging the cam pin. The flanges are arranged in an offset configuration where one flange of the upper jaw member is positioned on a laterally exterior side of a corresponding flange of the lower jaw member, and the other flange of the upper jaw member is positioned on a laterally interior side of the other flange of the lower jaw member.
US09375253B2
An electrosurgical instrument that reduces the amount of fatigue experienced by a physician performing electrosurgery includes a hand piece with a utility conduit connected to the hand piece. The utility conduit can include an electrical cable and a smoke/fluid evacuation hose. The location at which the utility conduit exits the hand piece is selectively adjustable to reduce the resistance to the movement of the electrosurgical instrument created by the weight of the utility conduit. An electrosurgical instrument may also include an extendable shaft that allows for selective adjustment of the reach of the operational capabilities of the instrument.
US09375238B2
The present invention relates generally to a bone plate for stabilizing bony structures. More particularly, the invention is directed to bone plates having an elongate body to which an integrated rod is formed. Integrated rod portion may be captured by a bone anchor with a receiving member. The bone plate is movable from a first position to a second position and may have an aperture for lagging the bone plate to the bone.
US09375233B2
A vascular procedure includes sliding a constriction crossing mechanism over a wire guide having a tip positioned at a proximal side of a constriction, and rotating a sheath of the mechanism about an axis relative another sheath of the mechanism. The method further includes helically engaging the sheaths, and guiding an intraluminal treatment device into or past the vascular constriction. The mechanism includes a first sheath and a second sheath, and a tip coupled with the first sheath. The mechanism further includes a helical coupling between the first and second sheaths, which is configured to convert a torque on one of the sheaths to an axial force on the other of the sheaths for crossing a vascular constriction with the tip. An anchoring mechanism coupled with one of the sheaths includes a deployed state resisting displacement of the second sheath within a vascular structure of a patient.
US09375231B2
An excision device configured to excise living tissue by ejecting liquid includes: a supplying unit configured to supply liquid to be ejected; a chamber configured to be filled with the supplied liquid; an ejection nozzle connected to the chamber; a drive member configured to be deformed in the direction to reduce the volume of the chamber when a drive voltage is applied more than a case where the drive voltage is not applied; a liquid ejecting unit configured to eject the liquid in the chamber in a pulsed manner from the ejection nozzle by applying the drive voltage to the drive member in a state in which the chamber is filled with the supplied liquid; and an air-bubble detecting unit configured to detect air bubbles in the chamber by detecting an electric current flowing in the drive member when the drive voltage is applied to the drive member.
US09375229B2
A latch mechanism for a surgical instrument includes a lever moveable from an initial position to an actuated position for moving an end effector assembly from a first to a second state. A pin extends from the lever. A cantilever spring is operably engaged to the housing of the instrument. A pin track member is operably engaged to the cantilever spring at a free end thereof. The pin track member is configured to permit translation of the pin therealong between a first position corresponding to the initial position of the lever and a second position corresponding to the actuated position of the lever. The pin is configured to translate from the first to the second position along a first path and from the second position back to the first position along a second path and is configured to be releasably retained in the second position.
US09375219B2
Medical systems, devices and methods are provided for engaging tissue, e.g. for clipping tissue, closing a perforation or performing hemostasis. Generally, the medical system including a housing, first and second jaws rotatable relative to the housing, a driver, and an elongate drive wire. The elongate drive wire may be disconnected from the driver, first and second jaws, and the housing, which are left in vivo engaged with the tissue.
US09375206B2
The invention relates to a surgical instrument comprising: —a distal tool (5) securely fastened to a distal end of a rotation shaft (4) and rotatably mounted on and in the extension of a distal member (30) rotatably mounted at an end of an elongated arm (3), —an comprising motorized means (20) for actuating the distal motion of the distal tool (5) and further comprising controlling means (21) for a user to control the motorized means (20); —a handle (1) extending from the actuation unit (2) and comprising a lever (11) mechanically coupled to the distal tool (5) for actuation of said distal tool (5); characterized in that the handle (1) has a non-axially-symmetric shape and is mounted on and in the extension of the actuation unit (2) with coupling means (12, 22) enabling rotation of the handle (1) relative to the actuation unit (2) around the longitudinal axis, and wherein the controlling means (21) are adapted to be operated by the user whatever the rotational position of the handle (1) relative to the actuation unit (2).
US09375203B2
An embodiment of the present invention provides a kit of parts for use in a surgical procedure performed under image guidance, and particularly under real time image guidance. The kit includes a sterilized drape for use with the chosen imaging machine and which can be used to provide a sterile operating environment when the procedure is performed under the imaging beam. The kit also includes a needle holder that can keep the surgeon's hand away from the imaging beam. The needle holder is operable to hold a needle that is made from a material suitable for piercing tissue, but also substantially preserves the appearance of the needle when it is viewed under the imaging beam.
US09375190B2
A radiography device and a radiography method are specifically adapted for examinations in the field of pediatric radiology. The radiography device examines a diagnosis-relevant region of a patient. The device has a radiation source, which emits radiological rays in an irradiation direction. An irradiation surface is selectable in dependence of a specified examination region of the patient. The radiography device also has a measurement field. The size of the measurement field is changeable such that the size of the measurement field and the size of the irradiation surface correlate.
US09375189B1
The x-ray stick marker includes a shaft having a proximal end, a distal end, and a lumen extending through the shaft between the proximal end and the distal end. A handle is disposed at the proximal end of the shaft and a marking tip is disposed at the distal end of the shaft. The handle includes an actuating button configured to control the release of the marking tip. The marking tip is configured for marking the skin of the patient. To avoid exposure to radiation, a user may maintain a suitable distance from the patient when positioning the marking tip on a designated location of the patient's skin for drawing a mark thereon.
US09375188B2
A method is disclosed for recording and displaying medical imaging data records of a body part including fatty tissue. In at least one embodiment, the method includes recording an emission-tomographic data record of the body part; recording a magnetic-resonance imaging data record of the body part using a recording sequence designed such that fatty tissue can be displayed such that it can be distinguished from other types of tissue; identifying regions in the emission-tomographic data record, which regions correspond to fatty tissue, using the magnetic-resonance imaging data record; and modifying the emission-tomographic data record in those regions that correspond to fatty tissue. Further, at least one embodiment relates to a correspondingly designed device for evaluating and displaying medical imaging data records of a body part comprising fatty tissue.
US09375186B2
Method and apparatus for estimating an arrival time (PAT) value of a subject in an automatic and unsupervised fashion from a sequence of electrical impedance tomography (EIT) images. The method comprises: providing an EIT imaging device adapted to record impedance signal distribution within a measurement region of the subject; measuring a sequence of temporally discrete EIT images during a predetermined measuring time period in the measurement region using the EIT imaging device, each EIT image comprising one or a plurality of EIT pixel subsets, each of said one or a plurality of EIT pixel subset representing an impedance value; generating one or a plurality of time series, each of said one or a plurality of time series representing a variation of the impedance value of the sequence of EIT images; and estimating the PAT value from each of said one or a plurality of time series.
US09375182B2
A biopotential signal acquisition system including an analog readout unit configured to receive an analog biopotential signal, which may be acquired from at least one electrode attached to a body; and to extract an analog measured biopotential signal and an analog reference signal. The system also includes an ADC unit configured to provide a digital version of the analog measured biopotential signal and the analog reference signal, a digital filter unit configured to calculate a digital motion artifact estimate based on the digital version of the measured biopotential signal and the reference signal. The system further comprises a reference signal processing unit configured to convert the reference signal into a new reference signal being provided to the digital filter unit based on the correlation between the measured biopotential signal and the reference signal.
US09375173B2
Correction for initial variation in thickness of a polymer layer and for changes in the coating thickness that occur after implantation of a biosensor and therefore provides substantial increase in the accuracy and lifetime of implantable sensors is done using a factor derived from the decay of potential.
US09375168B2
The invention is devices and methods for collecting fetal blood from the umbilical cord and placenta after the birth of a baby. Embodiments of the invention are open circuit devices and methods that allow collection of relatively large quantities of cord blood while reducing the risk of contamination to levels lower than those presently associated with closed circuit systems. Other embodiments are methods and devices for use in closed system procedures that increase the amount of blood collected and also reduce the amount of contamination in presently employed closed systems.
US09375166B2
A bi-directional flow sensor may be adapted for reducing pneumatic noise during pressure sensing with a flow passing through the flow sensor. The flow sensor may include a hollow, tubular member having a throat section disposed between a ventilator end and a patient end. A flow restrictor may be disposed in the throat section and may be adapted to measure differential pressure in the flow. A baffle may be mounted at the ventilator end and may be adapted to minimize non-axial flow at pressure taps located on opposing ends of the flow restrictor. The patient end may include a flow obstruction configured to promote uniform velocity across the flow at the pressure taps during exhalation flow from the patient end to the ventilator end. The flow sensor can minimize pneumatic noise to less than 0.1 LPM to allow accurate patient flow measurement and triggering of inhalation and exhalation phases at flow rates of 0.2 LPM.
US09375163B2
An invasive medical probe includes an insertion tube, having a proximal end and a distal end configured for insertion into a body of a patient. Multiple arms extend distally from the distal end of the insertion tube. Each arm has a distal tip and includes a magnetic transducer and an adhesive element, which is configured to removably attach the distal tip to a tissue surface within the body.
US09375155B2
A diaphragm pump for achieving reduced pressure ripple of an exhausted gas is provided. The diaphragm pump is a pump for transporting a gas in accordance with change in volume of a pump chamber, and the diaphragm pump includes an exhaust valve permitting flow of the gas that flows out of the pump chamber and prohibiting a flow thereof in a reverse direction, an air chamber in which the gas that has flowed out of the pump chamber through the exhaust valve flows, an exhaust port through which the gas is exhausted to the outside of the diaphragm pump, and a through hole portion for restricting a flow rate of the gas that flows from the air chamber to the exhaust port.
US09375148B2
A motor drive apparatus includes: a transmission unit carrying-out transmission of an optical signal between a rotation unit for rotating a transmitting and receiving unit and a fixation unit for transmitting reflected light to a control apparatus through a signal line, wherein the transmission unit includes: a tubular shaped lens holding member where a collimator lens is held, and a holding member fixing member having first fixation surface by which the end surface of the lens holding member is fixed and second fixation surface fixed by a surface which is formed to be approximately perpendicular to the direction toward which the optical signal is emanated or the optical signal is light-received; the first fixation surface is formed in a spherical shape; and the second fixation surface is formed to be approximately perpendicular to the direction toward which the optical signal is emanated or the optical signal is light-received.
US09375142B2
A patient monitoring and intervention system, comprises an interface for receiving data representing multiple different parameters from multiple different sensors, comprising sensors in a patient bed and attached to a patient including, a heart rate sensor, a respiration sensor and a pressure sensor indicating bed pressure points. A learning processor determines a normal range for a set of the different received patient parameters for the patient by recording the patient parameter values over a time period and analyzing the recorded parameter values to determine their range. A data processor determines if the set of different received patient parameters exceeds the determined normal range and in response to this determination and in response to the type of parameters in the set and medical record information of the patient, initiates adjustment of a patient bed and at least one of, (a) changes medication administered to a patient and (b) alerts a worker of the patient parameter change.
US09375133B2
A virtual field of view of a virtual endoscope, which is positioned at a position corresponding to a detected position of an endoscope in a 3D medical image, is determined based on a position of a structure of interest, the corresponding position and a posture of the endoscope, and an angle of view of the endoscope, such that the position of the structure of interest is contained within the virtual field of view and the virtual field of view has continuity with the field of view of the endoscope. From the 3D medical image inputted, a virtual endoscopic image having the determined virtual field of view with the view point thereof being the corresponding position of the endoscope is generated. The generated virtual endoscopic image is displayed on a WS display.
US09375129B2
A dishwasher with a tub at least partially defining a washing chamber, a liquid spraying system for spraying liquid within the washing chamber, a liquid recirculation system defining a recirculation flow path, and a liquid filtering system. The liquid filtering system includes a rotating filter disposed in the recirculation flow path to filter the liquid.
US09375122B2
A cleaning device agitator system having an agitator and one or more cleaning members. The agitator has first and second ends, a longitudinal axis and one or more agitating devices. One or more friction surfaces may project from the spindle. The cleaning members are adjacent the agitator and adapted to move between a first position and a second position. In at least the second position, the cleaning members engage the agitator, such as by engaging the friction surfaces, to remove debris. Agitator and cleaning members may be incorporated into a cleaning head having an inlet nozzle and a chamber in which the agitator rotates, and there may be an activation mechanism using, for example, a resilient member to move the cleaning members. An overload protection device may be provided, and may adjust its sensitivity depending on whether the cleaning devices are in the first or second position.
US09375117B2
The device includes a housing with an associated cover receiving a module receiving the strip of pre-cut material, said module being provided with a transverse support plate, a flap pivotally assembled with respect to said module and to the support plate by being arranged in front of it, opposite to the inner front surface of the cover to allow the passing of the strip of material. A transverse barrier rod is arranged in the lower portion of the cover between its lateral flanges. The flap has at least one recess enabling to catch the strip of material and at least one long slot arranged in a plane forming an angle from the lower edge of the flap, said slot defining an area for receiving at least one rib formed in a complementary configuration on the cover by penetrating on closing of the cover into said slot. The cover has at least one rib adapting in the slot formed on the flap and at least one recess for the passing of the strip of material. The rib(s) formed on the cover have a tear drop configuration with a progressive height from their base inside of the cover to the lower end thereof, and the rib(s) have in their upper portion a rounded shape having the function of allowing the separability of a format of pre-cut strip of material from the rest of the strip.
US09375102B2
A shelving unit includes formed front and rear beams providing shelf supporting and lower flanges, respectively. A C-shaped tie bar extends centrally between respective front and rear beams and is captured between the beam flanges with tie bar ends engaging the beams providing loaded shelf support and resisting loaded beam twisting.
US09375096B2
A carrying device for a baby or a small child has a retaining harness system and an accommodating element connected to the retaining harness system. At least one end area of the accommodating element extends at least to the retaining harness system and is adjustably connected to the retaining harness system. An accommodation space of the accommodating element can be adapted to the size of the baby or small child to be carried.
US09375095B2
A child holding accessory includes a reversible resting support and at least one fixture for attaching the resting support with a rigid support frame. The reversible resting support has a first and a second bearing surface facing opposite directions, the first and second bearing surfaces respectively having different profiles, and each of the first and second regions being positionable to be upwardly facing to receive a child thereon.
US09375093B1
A chair has a selectively mutable decor, readily changed selectively by providing at least one of the component parts of the chair with a transparent wall surrounding an inner chamber for receiving any one of a plurality of decorative components through an access to the inner chamber. The access preferably is closed with a closure, the closure being removable to open access to the inner chamber for insertion of a selected decorative component, and being secured to capture the inserted decorative component within the inner chamber for viewing through the surrounding wall. A wide variety of decorative components is available, enabling the decor of the chair to be changed to accommodate the requirements of the venue within which the chair is to be placed.
US09375092B2
An outdoor chaise lounge may include a frame, multiple legs coupled to and extending below the frame to support the frame, a seat member coupled to the frame to enable a user to sit or lay on the seat member, a lock-box fixedly supported by the frame that enables a user of the outdoor chaise lounge to store and lock items therein. The lock-box may include a lock-box door inclusive of a user interface that enables a user to lock and unlock the lock-box. A door member may be coupled to the seat member and have a closed position and an open position such that when said door member is in the open position, the user has access to the user interface on the lock-box door.
US09375084B2
A drawer glide mechanism can include a first elongate guide member, a second elongate guide member, a ball bearing component, a v-notch socket, a release mechanism, and/or a roller support. The first elongate guide member can include a distal end that is configured to fit within an opening in the v-notch socket. The drawer glide mechanism can further include one or more floating members and fixed members. In some cases, the drawer glide mechanism includes a release member configured to facilitate separation of the first and second elongate guide members when actuated and to inhibit or prevent accidental separation of the first and second elongate guide members.
US09375079B2
Embodiments of work stations for use in medical dose preparation management system. A work station may include a camera stand. The camera stand may include a housing enclosing a camera and one or more light sources therein. As such, the camera and light sources may be directed at a medical dose preparation staging region to capture medical dose preparation images of the medical dose preparation staging region. The camera stand may include an adjustable support positionable in a plurality of positions to dispose the camera and light source relative to the medical dose preparation staging region. A base with a removable tray may be provided that include medical receptacle engagement features. The work stations may facilitate improved image quality, efficiency of work flows carried out at the work station, and administrative tasks such as cleaning.
US09375075B2
Provided herein is a clip system for attaching an item to a belt or waistband with a suspenders type gripping assembly that includes a pinned rotatable item retaining member.
US09375073B2
A tablet support accessory is revealed that holds electronic tablets, iPads, notebooks, game players, e-readers, smart-phones, or other interactive electronic devices or viewing devices, on the thigh of a sitting, supine, or semi-supine person. Because interactivity at times involves the tapping on the face of the device, the tablet support accessory is stabilized by coupling a thigh brace and platform assembly, on which the device is held, to a support in the wearer's knee-shin region by means of an adjustable strap.
US09375070B2
A stick-type cosmetic holder is formed in a cylindrical shape opened at upper and lower ends. On an inner peripheral surface, an inner diameter is gradually decreased from an upper opening downward to provide an upper tapered surface, and the inner diameter is gradually decreased from a lower opening upward to provide a lower tapered surface. A single annular step portion forming a step such that the lower tapered surface side is higher than the upper tapered surface side is provided at a boundary between the upper tapered surface and the lower tapered surface. The step portion is formed with an inclination in relation to the axial center as viewed from the lateral side. Moreover, taper angles of the upper and lower tapered surfaces are 1° to 10°, and the height of the step portion is 0.1 to 2.0 mm.
US09375067B2
A Guest Check Presenter Device and Method of Use. In one embodiment, advantageous for establishment use, the invention comprises a guest check presenter in the form of a booklet having a bill slot for holding a bill which can be made of transparent magnifying plastic that enlarges the appearance of the bill, which can be coupled with a light, enhancing visibility of the bill. The system also provides for a calculation device that limits its functionality and options: permitting the patrons to split the total of the bill, and calculate the percentage of gratuity desired selecting from choices provided on the face of the device. In a second embodiment advantageous for personal use, the case has a front and back side, with a computation device, a magnifier, and a light all being disposed on the case. By offering only limited functions, the device is made more user-friendly and time-efficient. The invention aids the elderly and eyesight-impaired individuals.
US09375066B1
A ring box having a rotating ring holder, wherein movement of one or more lids as the ring box is opened or closed drives rotation of the ring holder. In some embodiments the depth of the ring box in its closed configuration can be substantially similar to the depth of the ring holder.
US09375062B2
The present invention replaces the traditional steel and plastic construction primarily used in sports equipment bags to provide a novel sports equipment bag with flexibility, durability, strength, and a net weight reduction. The sports bag of the present invention integrates optionally removable composite rods into the frame structure of a sports bag to allow for significant flexibility and compression thereof for general transport, storage, shipping and handling purposes, and yet the sports bag is also capable of holding a semi-rigid exterior to a given volume and shape when in regular use. The present invention also discloses a sports equipment bag with a novel folding floor to assist with the flexible and collapsible nature of a sports equipment bag.
US09375056B1
A quick connect fastener accessory includes a base plate and lid to enclose an upper end of a quick release pin or fastener, preventing disengagement of the fastener or quick release pin from its engagement and an illumination means integrated within the base plate and connected to a local available low voltage electrical system, the illumination means using low voltage LEDs with a prismatic backplate for maximizing illumination as an accent or as a visual aid.
US09375055B2
Convertible garment systems and related devices and methods are shown and described. In one example, a convertible garment system includes a bathing suit and a pair of detachable-strap-interfaces, each configured to removably connect to the bathing suit's lower straps, and removably connect to the bathing suit's upper straps, thereby creating a second configuration for the pair of upper straps. In another example, a device includes at least one detachable-strap-interface for converting a bathing suit.
US09375049B2
A spacer textile material may include a first layer, a second layer, and a plurality of connecting members extending between and joining the first layer and the second layer. The connecting members may form a series of at least ten rows that are separated by spaces. The rows have a width that is less than a width of the spaces, and the connecting members form at least one stabilizing row with a width that is greater than the width of the spaces.
US09375046B2
Various articles may include a knitted component formed of multiple knitted component portions. The knitted component is formed of unitary knit construction and includes multiple tubular rib structures and multiple webbed areas. An article of footwear may include an upper incorporating a knitted component. The upper may be assembled through a wrapping process. The upper may comprise areas with tubular rib structures arranged in different orientations over the forefoot region, the midfoot region, the vamp region, and the heel region of the article of footwear. Some regions of the upper may have a greater number of tubular rib structures than other regions, and some tubular rib structures can include tensile elements.
US09375040B2
Disclosed is a deployable garment venting device that offsets the beltline of a wearer's trousers from the body of the wearer to allow an air gap such that heat and moisture is released and airflow is achieved across the trouser beltline. The device comprises a flexible frame member bordering an internal mesh web. The preferred embodiment comprises a pair of straps that deform the frame into a deployed state, bowing out the frame and creating a non-planar structure to offset a trouser beltline. The straps comprise clips for attachment to the wearer's beltline, whereby the frame can be released from the strap tension and thus stowed against the user's body in a planar state. Embodiments include of the frame straps include hooks that releasable maintain the frame's distorted shape, tensionable straps, and a frame that folds onto itself when disconnected from the user for condensed storage.
US09375039B2
A method for assembling a bow tie comprising inserting a first end of a link into an receiving end of a first strap portion of a first interchangeable tie section, the first interchangeable tie section including the first strap portion and a first leaf portion, selecting a second interchangeable tie section, the second interchangeable tie section including a second strap portions and a second leaf portion, the second strap portion including a receiving end, and inserting a second end of the link into the receiving end of the second strap portion.
US09375036B2
A method of protecting a participant user, participant player, players, referee, official, coach or spectator from skin contact with an exposed connector by isolating the connector of a sports glove, which includes a front palm portion having finger stalls for insertion of fingers therein, and a rear back joinable portion which is attachable to said front palm portion by a connector, such as a zipper. The method includes the step of removably covering the zipper connector with a friction fit fly cover having an attachment end and a free end, wherein further lifting of the free end of the fly cover exposes the zipper for participant user engagement therewith. The fly cover prevents any exposure of the metallic or plastic connector.
US09375021B2
A combination oven for cooking with heat and steam provides a boiler system for creating steam and includes a smoker appliance for generating smoke flavor during the cooking process. An oven controller detecting the use of the smoke appliance institutes a flushing and filling of the boiler after such use to reduce the transfer of smoke flavors to food that is subsequently cooked in the oven.
US09375020B2
The invention pertains to a device for separating at least one leg part (1) from a carcass part of slaughtered poultry, wherein the device comprises: —a main conveyor, which main conveyor comprises a plurality of carriers (10), each carrier being adapted to engage a carcass parts by or in the vicinity of the free ends of the leg parts, the main conveyor being provided with a drive for moving the carriers along a path, —a hip dislocator assembly, which is adapted to dislocate the hip joints in such a way that after said dislocation, a tissue connection remains between each leg part and the saddle, and adapted to disengage the leg parts from the carrier of the main conveyor, —a saddle support guide (32), which is adapted for supporting the saddle of the carcass part after the carcass part has become disengaged from the carrier of the main conveyor, —a leg separator (40) comprising two leg grippers (41), each leg gripper comprising a leg gripping slot that is adapted for engaging a leg part, wherein the leg grippers are adapted to induce a downward pulling movement of the leg parts relative to the saddle, thereby tearing loose the tissue connection between each leg part and the saddle such that the leg parts are separated from the saddle.
US09375011B2
This invention relates to a pesticidal compositions containing at least one pyrrolizidine alkaloid compound derived from a plant and endophyte combination, and applying the pesticidal compositions to another plant without pesticidal protection, where upon application of the composition, the plant confers pest protection. The pyrrolizidine alkaloid compound is of Formula (I) wherein: R═H or CH3 and R′═H, CH3, CHO, COCH3.
US09375001B1
The present invention provides insecticidal compositions for killing flies. The composition comprises a core material, a sugar layer comprising a supersaturated solution of sugar and a toxicant, which binds the core material and is dried on the core material.
US09374998B2
The present invention relates to fungicidal N-cycloalkyl-N-[(cycloalkenylphenyl)methylene]carboxamide derivatives and their thiocarbonyl derivatives, their process of preparation and intermediate compounds for their preparation, their use as fungicides, particularly in the form of fungicidal compositions and methods for the control of phytopathogenic fungi of plants using these compounds or their compositions.
US09374991B2
A system for killing pests in an affected area of a structure comprises a heat pump unit placed within an affected area. The heat pump unit comprises an evaporator component, a condensor component, and a compressor component. The evaporator component is configured to receive a flow of water from a faucet, and transfer heat from the flow of water to a refrigerant. The condenser component is configured to receive the refrigerant from the evaporator component, and generate heated air by transferring heat from the refrigerant to air flowing through the condenser component. The heated air being emitted into the affected area is in order to raise the temperature of the affected area to a target temperature greater than 120 degrees Fahrenheit. The compressor component is configured to return the refrigerant from the evaporator component of the heat pump unit to the condenser component of the heat pump unit.
US09374987B1
An aquarium having an adjustable lighting system for enhancing the display of fluorescent objects, such as fluorescent fish, contained within the aquarium under various external lighting conditions, such as a dark room or a brightly lit room. The aquarium comprises a tank and a plurality of light sources. Each light source emits light at a different wavelength spectrum which is selected to enhance the display of the fluorescent object under each type of external lighting condition. An electronic control is provided to control the operation of the plurality of light sources such that each light source may be selectively turned on/off based on the external lighting condition, or chronological criteria, to provide the best viewing experience.
US09374983B1
A clothing article for a dog. The article includes a torso cover extending between the neckline and tail line of the dog and having a width defined by its lateral edges sized to drape over the dog's torso covering at least a portion of it. A belly strap is included extending between the lateral edges and when combined with extenders facilitate the removable attachment of the clothing article to the dog. A hood completes the clothing article which includes a structural frame and webbing for selective attachment to the torso cover, the hood being shaped and sized such that when worn by a dog, it selectively resides above the dog's head without significantly deforming the dog's ears and without significantly obstructing the dog's vision.
US09374982B2
A pet groomer and vacuum cleaner including the pet groomer are provided. The pet groomer includes a substance body having a suction channel to be connected with the suction hose of vacuum cleaner and has at least one air intake which transmits air to the suction channel; a combing assembly which is used to comb pet hair; and a driving assembly which drives the combing assembly so as to make the comb teeth in the combing assembly to move to the air intake from a comb position. The pet groomer drives the combing assembly through the driving assembly so as to move pet hair which is combed from pet body to the air intake to be vacuumed away by the vacuum cleaner directly, avoiding the intermediate action of stripping off pet hair from comb teeth or similar actions, so that pet hair will not fall down and environmental pollution and allergen spreading will not be caused by pet hair.
US09374976B2
A system includes a robotic attacher comprising a main arm and a supplemental arm operable to extend into a stall portion of a milking box. A camera couples to the supplemental arm. The supplemental arm comprises a camera-facing nozzle operable to spray the camera with a cleanser.
US09374968B2
A novel maize variety designated PH259Y and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH259Y with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH259Y through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH259Y or a locus conversion of PH259Y with another maize variety.
US09374967B1
A novel maize variety designated PH25RY and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH25RY with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH25RY through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH25RY or a locus conversion of PH25RY with another maize variety.
US09374961B1
A novel maize variety designated PH1D5M and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH1D5M with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH1D5M or a locus conversion of PH1D5M with another maize variety.
US09374960B2
The invention provides seed and plants of the pea line designated DLSC709-1058. The invention thus relates to the plants, seeds and tissue cultures of pea line DLSC709-1058, and to methods for producing a pea plant produced by crossing a plant of pea line DLSC709-1058 with itself or with another pea plant, such as a plant of another line. The invention further relates to seeds and plants produced by such crossing. The invention further relates to parts of a plant of pea line DLSC709-1058, including the seed, pod, and gametes of such plants.
US09374954B2
Methods of initiating plant somatic embryos from megagametophytes are provided.
US09374951B2
An apparatus is provided for growing plants hydroponically. In one embodiment, the apparatus includes a plurality of containers each having a supply and a drain positioned above the supply. Methods of growing plants hydroponically in individual containers are also provided.
US09374947B2
Embodiments include a containment unit for a living wall that includes a rear wall with two side walls, a top and a liquid collection trough at the bottom with several ribs extending down the front of the containment unit between the side walls, where the ribs are angled and arranged relative to each other to define vertically stacked openings between sequential ribs that forms horizontal growing surfaces when the containment unit is filled with loose plant growth medium.
US09374942B2
A seeding follower isolation device may include a forming bar connection portion, a seeding follower support portion, and an extension portion. The forming bar connection portion may be configured for secured attachment to a forming bar in a leading position relative to a seed tube of a planting unit. The seeding follower support portion may be configured to adjustably and removably support a seeding follower in an aft position relative to a seed tube. The extension portion may extend between the forming bar connection portion and the seeding follower support portion. The seeding follower isolation device does not contact a seed tube so that a seeding follower joined to the seeding follower isolation device is isolated from the seed tube.
US09374941B2
Provided is a method for seed priming comprising the steps of treating seed with a seed priming composition comprising sieved compost, hydrogel and water in a ratio of sieved compost:hydrogel:water of from about 5:1:4.75 to about 9:1:11 by weight in an amount sufficient to result in priming of the seed. In some embodiments, the seed is treated with from about 2 to about 39 grams of the seed priming composition per gram of seed. In preferred embodiments, the seed composition and the seed priming composition are free of soil or sand. In further preferred embodiments, the seed is blended with the seed priming composition at a temperature of about 5° C. to about 25° C.
US09380735B2
A heat dissipation system for cabinet servers supported on a raised floor includes a condenser, airflow adjusting apparatus, a controller, and a temperature sensor located at an air outlet of each cabinet server. The raised floor defines air outlets adjacent to each cabinet server. The adjusting apparatus are mounted to the raised floor and aligning with the air outlets. Each of the airflow adjusting apparatus includes a number of shielding members rotatable relative to the raised floor and aligning with the air outlets, and a motor electrically coupled to the controller. The temperature sensors are electrically coupled to the controller. The condenser generates cool air entering the raised floor through the air inlet, to enter the cabinet servers through the airflow adjusting apparatus and the air outlets. The controller controls the shielding members to rotate, to change the opening size of the air outlets of the raised floor.
US09380719B2
An information apparatus, includes: a first-housing and a second-housing; and a link mechanism spanned from a front side of the second-housing to a rear side of the first-housing in a state in which the second-housing is superposed over the first-housing, the link mechanism including a link provided with a first-rotation axis at one end and provided with a second-rotation-axis at another end, a first bracket that pivotally supports the first-rotation-axis and is provided on a side of the first-housing, a second bracket that pivotally supports the second-rotation-axis and is provided on a side of the second-housing, and an urging part that urges the link in a direction in which the second-rotation-axis moves away from the first-housing, wherein when the second-housing tilts from the first-housing, the link mechanism allows one end of the second-housing to slide over the first-housing and the second-housing tilts in an upper space of the first-housing.
US09380708B2
In order to transport a flat material to be treated (21) in an installation for the chemical and/or electrochemical treatment of said material, within which the material to be treated (21) is transported within a plane of transport in a direction of transport (5), holding means (22, 25) are attached to said material to be treated (21). The holding means (22, 25) hold the material to be treated (21) at at least two points on an edge region of said material, which edge region is directed along the direction of transport (5) when said material to be treated (21) is being transported. The holding means (22, 25) are coupled in a detachable manner to a transporting device (41) which moves said holding means (22, 25) in the direction of transport in order to transport the material to be treated (21). At least during a portion of the transportation of the material to be treated (21), a force (6, 7) having a component which lies within the plane of transport and is directed transversely to the direction of transport (5), is exerted upon a region of the material to be treated (21), for example upon the longitudinal edge regions.
US09380702B2
A server system includes an array of server cells. Some or all of the server cells include a set of at least three side panels forming an enclosure and a compute component comprising a processor core. At least one side panel of each server cell is removably mechanically coupled and removably electrically coupled to a facing side panel of an adjacent server cell. The enclosure may form a triangular prism enclosure, a cuboid enclosure, a hexagonal prism enclosure, etc. The enclosure can be formed from a rigid flex printed circuit board (PCB) assembly, whereby the side panels are implemented as rigid PCB sections that are interconnected via flexible PCB sections, with the flexible PCB sections forming corners between the rigid PCB sections when the rigid-flex PCB assembly is folded into the enclosure shape. The compute component and other circuit components are disposed at the interior surfaces of the rigid PCB sections.
US09380682B2
A method and system for facilitating at least first and second different activities within a first space that includes a first set of environmental control affordances including at least a first subset of lighting devices, the method comprising the steps of monitoring for triggers associated with the first space, when a trigger occurs, determining which of the first and second activities to facilitate, when the first activity is to be facilitated, controlling the environmental control affordances to present a first series of environments associated with the first activity and when the second activity is to be facilitated, controlling the environmental control affordances to present a second series of environments associated with the second activity.
US09380675B2
Described herein are systems, devices, and methods related to adjusting the intensity of specific wavelengths in an illumination panel based on the presence of a person near the panel. By reducing some emitted wavelengths, such as wavelengths associated with blue light, when such wavelengths are not needed or desired, the lifetime and/or efficiency of the lighting panel can be increased. The systems, devices, and methods can be used to reduce energy costs and also to delay the aging of lighting panels.
US09380673B2
The present invention provides LED backlight source of liquid crystal display device. The LED backlight source includes: a boost converter, boosting input DC voltage and outputting boosted DC voltage; a plurality of LED strings connected in parallel, with each LED string including a plurality of LEDs in series and receiving boosted DC voltage from boost converter; a plurality of constant-current drivers, controlling current of each LED string, each constant-current driver controlling at least an LED string and first constant-current driver controlling connection/disconnection of boost converter; an under-voltage protection control circuit, outputting under-voltage protection voltage to constant-current drivers and constant-current drivers determining whether to stop operating based on received under-voltage protection voltage, wherein under-voltage protection voltage outputted to first constant-current driver less than under-voltage protection voltages outputted to other constant-current drivers. The LED backlight source can turn on and off LED strings simultaneously to improve the optical quality.
US09380664B2
Provided is a lighting system that includes a plurality of lighting elements which emit light, a power supply which supplies power, a lighting driver comprising a microcontroller and which outputs power to the plurality of lighting elements for operation thereof; and a control system which transmits a control signal to the microcontroller to initiate a standby mode of the plurality of lighting elements. The microcontroller receives the control signal and decreases output power supplied to the plurality of lighting elements, while remaining in a low power consumption mode for communicating with the control system during standby mode.
US09380663B2
The Light Emitting Diode (LED) lamp is adapted for mounting in a fluorescent tube mount having a selectively activatable magnetic ballast powering two pairs of sockets with AC power upon activation. The LED lamp has a body having connectors at both opposite ends adapted to the corresponding pair of sockets, at least one LED string extending along at least a portion of the body, a driver inside the body connecting the connectors to the LED string, the driver including a transistor, an inductor, and a rectifier in a switch mode converter configuration, for converting the AC power of the sockets into a DC power of a voltage adapted to power the LED string; and a pulse mode controller for controlling the transistor in an intermittent manner upon activation of the multiple fluorescent tube mount, until conduction across the at least one LED string is achieved.
US09380658B2
A device for controlling the amount of energy stored in a storage device comprises a control unit that is adapted to adjust the power received via an input of the device, based on the amount of energy currently stored in the storage device, and that is further adapted to output the adjusted power via an output of the device to the storage device.
US09380654B2
Provided is a driver circuit including an input port configured for coupling to a ballast and a transformer having a first side coupled to the input port. The driver circuit also includes a rectifier having an input portion coupled to a second side of the transformer and an output portion configured for coupling to a light source. The transformer is configured to match output characteristics of the ballast to input characteristics of the light source.
US09380651B2
A microwave heater equipped with a microwave choke and suitable for heating one or more articles under vacuum. The microwave choke inhibits leakage of microwave energy between a door of the heater and a main vessel body of the heater without causing arcing at the choke, even at low pressures. In certain situations, the microwave choke can be configured with side-by-side choke cavities. In certain situations, the microwave choke can be removably coupled to the door and/or vessel body for easier fabrication, installation, and/or replacement.
US09380650B2
A microwave heating system configured to heat a plurality of articles and a process for using the same is provided. The heating system includes at least two laterally-spaced parallel convey lines and two or more groups of microwave launchers configured to heat articles transported along each convey line. The groups of microwave launchers can include pairs of oppositely disposed launchers that are spaced apart from one another along the axis of convey. When the system includes multiple convey lines, adjacent launcher groups are staggered relative to one another in the convey direction. Heating articles, such as foodstuffs or medical fluids or equipment in such a system, minimize undesirable interference between launchers of adjacent groups and provide a more uniform heating field.
US09380646B2
A user equipment device intelligent network selection architecture is provided that enables service provider policy driven dynamic intelligent network selection of a radio technology for user traffic delivery. The network selection is based on radio network conditions, user subscription profile, and device mobility state, including speed and movement pattern. Also provided are application program interfaces that allow access network discovery and selection function carrier clients decision as to communication with a connection manager or other lower layer functions. The architecture and associated application program interface enable automatic network selection and connection, which provides a consistent implementation across different device original equipment manufacturers and operating systems.
US09380633B2
Embodiments of the invention proxy control the establishment or continued existence of a WLAN connection by using the back end authentication mechanism to authenticate/de-authenticate a WLAN session in dependence on the experienced quality of the connection during the set-up phase or session itself. This has the effect of preventing a bad quality connection from being established or from continuing, and hence should improve the user experience, and help a WLAN network operator maintain a service with high Quality of Service (QoS).
US09380627B2
Disclosed are various embodiments of a telecommunication environment including a wireless transmitter in a first mobile device that enables the first mobile device to communicate over a network infrastructure. An application may be executed in the first mobile device such that the application enables the first mobile device to communicate with a second mobile device over a wireless ad hoc network.
US09380622B2
This disclosure provides systems, methods and apparatus for wirelessly communicating with a wireless station. In one implementation, a mobile device comprises a memory unit configured to store communication information associated with communicating on at least one channel of a wireless network. The mobile device further comprises a processing system that is configured to establish communications with the wireless station via a communication link, retrieve the communication information from the memory unit, and to provide at least a portion of the communication information to the wireless station.
US09380619B2
A method is provided in a node in a radio access network for packet data communication in a wireless communication network, the method includes intercepting, by the node, a first PDP context message between a mobile station and a core network. The message includes PDP context related information. The interception is performed to detect the PDP context related information. The method further includes establishing, by the node, based on the intercepted PDP context related information, a second PDP context between the node and the mobile station, thus enabling prioritizing packets in the radio access network. The disclosure also concerns a corresponding apparatus.
US09380617B2
A method for increasing gateway stability in a long term evolution system (LTE) mode Femtocell system comprises: a gateway (HeNB GW) determining that multiple SCTP links need to be established between the HeNB GW and a single mobility management entity (MME), and setting different Global eNB identifiers (Global eNB IDs) for S1 interfaces on different SCTP links of same one MME; the HeNB GW establishing multiple SCTP links between the HeNB GW and the MME; and for each established SCTP link, the HeNB GW notifying upper-layer application configuration information born by the SCTP link to the MME through an S1 setup request, and establishing an S1 link on the SCTP link.
US09380616B2
A connection dormancy method for a wireless communication device, the wireless communication device and computer readable recording medium using the same are provided. The method includes recording connection information between the wireless communication device and at least one target device, and generating at least one connection establishing time according to the connection information. The method also includes determining using either a first dormancy waiting time or a second dormancy waiting time as a default dormancy waiting time according to the at least one connection establishing time, and disconnecting a connection between the wireless communication device and the at least one target device after the connection is idled for the default dormancy waiting time.
US09380614B2
The present invention relates to a method of configuring a user equipment-based communication area in a cloud radio access network environment and an apparatus therefor. As one embodiment of the present invention, a method of performing a communication, which is performed by a user equipment (UE) in a cloud radio access network environment includes the steps of generating an RRU list based on signal strength of downlink signals received from each of one or more RRUs (remote resource unit), setting a UE-based communication area in a manner of transmitting the RRU list to a BBU (base band unit) via a first RRU among the one or more RRUs and establishing an RRC connection with a second RRU within the UE-based communication area.
US09380605B1
Loading information of an access node and a random access failure rate at the access node are determined, wherein the access node is using a first physical random access channel (PRACH) configuration index. Based on the comparison of the loading information to a loading criteria and the comparison of the random access failure rate to a failure rate criteria, a second PRACH configuration index is selected for the access node.
US09380595B2
Systems and techniques for discontinuous reception management for user devices communicating using carrier aggregation. Information relating to discontinuous reception for a user device is received and used to determine discontinuous reception states of the user device. The information relating to discontinuous reception may include, for example, past scheduling information, information received at one scheduler and reporting scheduling information for another scheduler, or discontinuous reception information managed at a media access control layer of a base station. The discontinuous reception information may be used for scheduling of a plurality of carriers used for carrier aggregation by a user device, with scheduling for each carrier being performed by a scheduler dedicated to that carrier.
US09380592B2
There is proposed a mechanism allowing a compressed multi-cell channel state information feedback. In a user equipment communicating with plural base stations such as eNBs, a joint set of communication subbands is identified which includes those subbands which provide a specific communication quality level, and which are common to at least two of the plural cells. Then, a status report is generated and transmitted to the control nodes of each of the plural cells. The status report includes an information regarding the joint set of communication subbands, cell specific information including quality indicators for each cell of the plurality of cells related to a transmission using the subbands of the respective cell included in the joint set of communication subbands and quality indicators for each cell of the plurality of cells related to a transmission using all subbands of the respective cell, and joint information concerning a joint quality indicator related to a transmission using all cells.
US09380591B2
Disclosed is a method for a femtocell to reduce interference with an overlapping macrocell. The femtocell determines soft-frequency-reuse (“SFR”) information of the macrocell. From that information, the femtocell determines which frequency subchannels are assigned by the macrocell for its cell-center users and which frequency subchannels are assigned for cell-edge users. (Cell-edge users are given a higher transmission power profile in order to overcome potential interference with neighboring macrocells.) Then, the femtocell selects from the cell-center user frequency sub-channels for transmission to the femtocell's users. By transmitting on the cell-center user frequency sub-channels, the femtocell reduces interference with the overlapping macro cell. The femtocell continues to update its knowledge of the macrocell's SFR information and re-assigns frequency sub-channels as the SFR changes. If the macrocell detects that one of its cell-center users is “close enough” to the femtocell, then the macrocell re-assigns the cell-center user as a cell-edge user to overcome interference.
US09380589B2
Provided is a method for detecting a network or device and a neighbor thereof, in order to detect networks or devices which substantially interfere with each other and to manage resources in consideration of the substantial interfering relationships so that the networks or devices can efficiently coexist. To this end, according to an embodiment of the present invention, a method for detecting a neighbor of a television band device (TVBD) network or device comprises the steps of: transmitting a request to a coexistence manager which serves the TVBD network or device; and receiving neighbor information on the TVBD network or device in response to the request, wherein the neighbor information includes an identifier of a neighbor TVBD network or device which interferes with the TVBD network or device, and the neighbor information is based on operating channels of the TVBD network or device and the neighbor TVBD network or device.
US09380588B2
The invention includes several embodiments for slot assignment in code division multiple access communication systems. One embodiment for fixed beams assigns slots by first detecting a beam having the best received quality and selected the best slot from that beam. Another fixed beam embodiment determines the best slot or slots in a number of beams and determines the overall best beam/slot combination. Another fixed beam embodiment uses a modified interference factor. One embodiment for the uplink using adaptive arrays using a spatial analysis stage followed by a transmission power level estimation stage. An overall interference level associated with each slot is determined and a slot having the best overall quality is determined. Another embodiment for the downlink uses the spatial analysis and slot assignment of the uplink for the downlink. Another embodiment for the downlink uses a spatial and transmission power level estimation stages.
US09380587B1
A system including a control module and a scheduling module. The control module is configured to define a plurality of basic service sets for an access point, where each of the basic service sets respectively corresponds to a class of service. The scheduling module is configured to schedule (i) first transmit times for the basic service sets to transmit data from the access point to a plurality of client stations and (ii) second transmit times for the plurality of client stations associated with the basic service sets to transmit data from the plurality of client stations to the access point. The first transmit times and the second transmit times are based on the class of service respectively associated with each of the basic service sets.
US09380582B2
A mobile station performs a method for random access in a wireless network. The method includes receiving, from a base station, information regarding a configuration of at least one receive beam of the base station to receive a random access signal. The method also includes configuring at least one transmit beam for a transmission of the random access signal based on the configuration information from the base station. The method further includes transmitting the random access signal to the base station on the at least one transmit beam.
US09380578B2
A method for establishing a first and second association between a main node and respectively a first and second wireless node is disclosed. The first association associates a first virtual access point VAP1 of the main node and the first node. The first virtual access point transmits to the first node first beacon frames comprising a first item of information BSSID1 representative of the first association BSS1. The first virtual access point VAP1 is identified by a services set identifier SSID. According to the invention, when the main node receives from the node a request for the establishment of the second association BSS2, the method comprises, at controller level, a step of creation of a second virtual access point so as to isolate the transmissions over the associations.
US09380575B2
Provided is a communication control device controlling communication of multiple secondary usage nodes providing second communication services using a part of a frequency band assigned to a first communication service, including a communication unit receiving service area information for estimating service areas of the second communication services provided by the secondary usage nodes and access technique information indicating radio access techniques usable by the secondary usage nodes, a storage unit storing information on the service area and access technique received by the communication unit, an estimation unit estimating service areas of multiple second communication services, and a control unit notifying a secondary usage node providing one of the multiple second communication services of a radio access technique or a channel recommended to the at least one second communication service on the basis of a location relationship between the service areas estimated by the estimation unit and the access technique information.
US09380572B2
A base station (BS) which communicates with a plurality of mobile stations (MSs) is configured so as to comprise a control signal generation unit which generates control signals showing information on the allocation of resources for each of the plurality of mobile stations (MSs), and a transmission unit which transmits the control signals to the plurality of mobile stations (MSs). A control signal for a given mobile station (MS) includes information relating to another mobile station (MS).
US09380566B2
The present invention discloses a method and a device for transmitting information on a physical uplink control channel (PUCCH). The method includes the following steps: a user equipment (UE) selects information from channel state information (CSI) to transmit (S1); the information selected from the CSI is transmitted on the PUCCH with one or both of hybrid automatic retransmission acknowledgment information and a scheduling request (S2), which enables a base station to obtain not only the information in the CSI but also one or both of the hybrid automatic retransmission acknowledgement information and the scheduling request from the PUCCH. The present invention avoids the problem of system downlink throughput degradation caused by dropping all CSI by the UE in the prior art, and avoids the problem that system downlink throughput is influenced by unnecessary data retransmission on a downlink carrier caused by ACK/NACK bundling among carriers.
US09380561B2
A method and a system for implementing CS domain paging are disclosed, applied in scenarios of performing CS domain paging for a called UE after ISR function is introduced in PS domain, and comprising: MSC/VLR only storing one Gs association; during CS domain paging, MSC/VLR sending a CS domain paging request message to the PS domain network element recorded in the Gs association in the MSC/VLR; after receiving the message, the PS domain network element initiating one or two CS domain paging procedures in the PS domain to transmit the CS domain paging to the called UE; or sending a paging response to the MSC/VLR directly without initiating CS domain paging. A method for transferring service information is also disclosed, applied in the scenarios that ISR function is activated in PS domain, and comprising: transmitting service message(s) between the ISR-associated PS domain network elements serving the UE to implement transfer of service information.
US09380555B2
In a wireless communication device that has LTE and 1× capabilities and multiple receive chains, this application provides for sharing non-LTE receive chain(s) and/or unused LTE receive chain(s) for 1× tune-away events to improve LTE throughput by not interrupting LTE data transmission on the LTE active receive chain(s).
US09380553B1
In systems and methods of paging a wireless device, it is determined that an application requirement of an application running on a wireless device meets a requirement threshold. A first subset of tracking areas of a tracking area list are selected based on a paging load. A paging message is sent for the wireless device to the selected subset of tracking areas.
US09380548B2
A clustering apparatus and method that can be used when synchronizing phase and frequency using a hybrid system of network assisted global navigation satellite system (AGNSS) and timing packet. A clustering apparatus for controlling timing is to determine a best master having a higher master-slave quality level among potential masters that can provide a timing packet based on a neighbor list provided by a server. The clustering apparatus organizes a cluster having linkability between the best master and at least one slave. The clustering apparatus performs synchronization between the best master and said at least one slave for each cluster.
US09380537B2
A partial envelope tracking (PET) circuitry for improving the dynamic range of a plurality of power amplifiers amplifying radio frequency signals in a MIMO based handheld wireless computing device. The circuitry includes a plurality of sub-PET circuits respectively connected to the plurality of power amplifiers; and a common charging circuit connected to each of the sub-PET circuits and a power source, wherein the common charging circuit comprises a storage capacitor and a logic configured to control the charging of the storage capacitor respective of an operation mode of each of the sub-PET circuits, wherein the operation mode is any one of: a tracking mode and normal mode, wherein during the normal mode of all of the sub-PET circuits the storage capacitor is charged at the voltage level provided by the power source and during the tracking mode of at least one of the sub-PET circuits the storage capacitor is discharged.
US09380535B2
Methods and apparatus for adaptively adjusting receiver operation during non-continuous (e.g., discontinuous) reception. In one exemplary embodiment, a user device such as a User Equipment (UE) adaptively adjusts its reception mode based on a determined actual error. The reception mode is selected so as to improve reception performance, while still minimizing overall power consumption.
US09380530B2
A discontinuous reception method, mobile station, base station and wireless communication system are provided in the present invention. The discontinuous reception method in the wireless communication system includes the following steps: in case of a continuous carrier aggregation, setting a common On Duration timer and/or a common Discontinuous Reception inactivity timer for a primary cell and each secondary cell; and in case of a discontinuous carrier aggregation, setting an independent On Duration timers and/or an independent Discontinuous Reception inactivity timers for the primary cell and each secondary cells. The present invention realizes discontinuous reception of the carrier aggregation, thus saving power consumption of the mobile station.
US09380523B1
Systems, methods and computer program products that enable efficient roaming of virtual mobile devices. In one embodiment, multiple PoP locations having a set of common master images are maintained. A communication from a mobile device received at a central facility identifies a user, a location and a type of the mobile device. The central facility determines performance measures for the PoP locations and identifies a preferred PoP location in response to the communication. If the preferred PoP location has available capacity, the central facility directs the preferred PoP location to provision resources and instantiate a virtual device from a selected master image corresponding to the mobile device. If the preferred PoP location persistently stores a user data volume for the user, the virtual device is attached to the stored user data volume. Otherwise, data is transferred from the user's data volume to a cache attached to the virtual device.
US09380521B2
Provided are a method for cell selection for a narrowband terminal and an apparatus using same. A narrowband terminal receives a wireless frame comprising a first synchronous signal for a user equipment supporting a first bandwidth, and a second synchronous signal for a user equipment supporting a second bandwidth which is narrower than the first bandwidth. The narrowband terminal searches at least one neighboring cell on the basis of the second synchronous signal. The narrowband terminal selects at least one cell from among one or more neighboring cells.
US09380514B2
A method, control node, and system for routing communication calls from a first telecommunication system of a first network operator to a second telecommunication system of a second network operator, the first telecommunication system and the second telecommunication system being interconnected via at least two points of interconnect, and the points of interconnect being physically distant to each other. The method comprises the steps of receiving at the first telecommunication system a setup request associated with the communication call from an originating user equipment, determining whether a recipient of the communication call is a subscriber of the second network operator and if so, determining a geographical location of the originating user equipment, selecting a point of interconnect being closest to the geographical location of the originating user equipment, and routing the communication call from the first telecommunication system to the selected point of interconnect of the second telecommunication system.
US09380512B2
Embodiments of a system and method for finding optimal routes for simultaneous transmissions over broadcast medium are generally described herein. In some embodiments, nodes are placed into a cost matrix representing a connected graph of nodes, virtual nodes are identified by applying matrix operations to the cost matrix and backtracking is performed incrementally to build candidates of virtual nodes for a solution set from the identified virtual nodes and to eliminate unsuitable candidates.
US09380511B2
Coordinated multipoint communication is a technology for improving cell-edge performance for users in a cell-type mobile communication system. In order to enable a coordinated multipoint transmission/reception operation, a user equipment report of a local environment is required to select both coordinated communication modes and communication partners in evolved Node B (eNB) base stations. According to the present invention, a method is described for feeding back information from User Equipment (UE) to a serving base station to enable a coordinated multi-point transmission/reception operation. The information reported through the feedback is classified into two categories corresponding to received signal intensity information and received signal timing information. The UE may select one or both types of information from between the categories to provide feedback. In embodiments of the present invention, various overhead-reducing reporting formats are described.
US09380510B2
A system for processing General Packet Radio Service (GPRS) Tunneling Protocol (GTP) for a handover in a mobile communication system is provided. The system includes an Evolved Packet Core (EPC), a source base station, and a target base station. The EPC transmits an end data indication message to a source base station of a user terminal to inform of an update for a user plane when receiving an update request message for the user plane of the user terminal from the target base station. The source base station forwards the remaining data destined for the user terminal to the target base station when receiving the end data indication message from the EPC, and transmits the end data indication message to the target base station upon completion of the forwarding. The target base station transmits data destined for the user terminal and stored in a buffer to the user terminal when receiving the end data indication message from the source base station, and releases resources set for the forwarding with the source base station upon completion of the data transmission to the user terminal.
US09380497B1
Disclosed is an arrangement in which a radio access network detects a trigger such as the RAN being threshold loaded, and the RAN responsively causes each of one or more served UEs to transition from operating in a mode in which the UE would engage in call initiation signaling via the RAN to set up the call extending through the RAN, so the UE would then engage in the call served by the RAN to operating in a mode in which the UE would engage in call initiation signaling via the RAN to instead set up the call extending through another RAN and would transition to be served by the other RAN, so the UE would engage in the call served by the other RAN. As disclosed, one RAN may be an LTE RAN, and the other RAN may be a fallback RAN such as a CDMA or GSM RAN.
US09380492B2
Generally, embodiments to enable short frames are described herein. Embodiments may comprise logic such as hardware and/or code to reduce the size of a packet by determining a short frame, transmitting the short frame, communicating that the frame is a short frame and interpreting the short frame at the receiving device. Embodiments may determine and transmit and/or receive and interpret short frames.
US09380490B2
Methods and apparatuses are provided for uplink MIMO transmissions in a wireless communication system. In some particular aspects, scheduling of the uplink MIMO transmissions may make a determination between single stream, rank=1 transmissions and dual stream, rank=2 transmissions based on various factors. Further, when switching between single and dual stream transmissions in the presence of HARQ retransmissions of failed packets, the scheduling function may determine to transmit the HARQ retransmissions on a single stream transmission or to transmit the HARQ retransmissions on one stream while transmitting new packets on the other stream.
US09380483B2
Methods, network server, and mobile communication devices for reporting an MDT log are provided. The method, adopted by a network server, requesting a Minimization of Drive Test (MDT) log from a mobile communication device is disclosed, including: transmitting a first request message for the MDT log to the mobile communication device; in response to the first request message, receiving a first response message comprising a part of the MDT log from the mobile communication device, wherein the first response message indicates whether the MDT log reporting is finished or whether at least one more part of the MDT log is available; and transmitting a second request message for the MDT log to the mobile communication device when the first response message indicates that the MDT log reporting is not finished or at least one more part of the MDT log is available.
US09380481B2
A mobile station in a wireless communication network is disclosed. The mobile station includes a transceiver coupled to a processor configured to rank a plurality of detected cells according to a signal level metric of the plurality of cells, to determine a first pattern of time periods during which a highest ranked cell is configured to transmit only a restricted set of information, and to perform measurements of cells other than the highest ranked cell, of the plurality of cells, only during the first pattern of time periods.
US09380475B2
Access devices may receive signals over a network and calculate a frequency spectrum of the received signals. An analyzer system may collect the frequency spectrum data from multiple access devices, and based on the collected data, detect, identify, and locate sources of anomalies in a communication network.
US09380473B2
A system or circuit for generating timing events for mobile communications includes fetching network parameters corresponding to a transmission configuration. The network parameters are used to program a set of programmable registers. The timing events then are generated based on the network parameters. The timing events enable a user equipment (UE) or a base station to operate in various transmission configurations.
US09380461B2
Apparatus for a mobile communication device, comprising means for detecting a unique subscriber identification of an incoming communication, means for storing the incoming communication into a protected area of the mobile communication device, if the subscriber identification fulfills at least one specific criterion, means for putting through incoming communication, if at least one specific criterion is fulfilled; and wherein the at least one criterion for storing and/or putting through the incoming communication is based on a detection of the frequency of contact and/or a time and/or a location.
US09380452B2
Methods and systems of managing radio based power may include a mobile platform having a plurality of radios and logic to detect changes in location for the mobile platform. The logic may also deactivate at least one of the plurality of radios in response to the changes in location. The changes in location may be detected based on location information obtained from one or more active radios in the plurality of radios and connection losses with respect to active radios in the plurality of radios.
