US09446534B2
A disconnection unit (10) is described for instantaneous disconnection of a load connected to a vessel (12) with the help of a wire, cable, chain or the like (16) that runs on a topside of an assigned part of an open deck (14) of a vessel, where the unit (10) comprises a housing (30) that contains an explosive part (32), said explosive part comprises, at least, one explosive unit (34) formed as a directed charge with a blast-off side, where the unit (10) is arranged to extend above the deck (14) of the vessel, and the unit (10) comprises a rod mechanism (50) arranged to hold the housing with the explosive part (32) adjoining said wire, cable, chain or the like (16) that shall be cut. Also described is an anchor handling vessel comprising, at least, one disconnection unit.
US09446533B2
A sensing mechanism (12) for detecting user contact with an active portion (26) of the power tool (10) is provided. In addition, a safety mechanism (14) for preventing prolonged user contact with the active portion (26) of a power tool (10) is provided. The safety mechanism (14) is configured to actuate upon receipt of a signal from the sensing mechanism (12). According to a first aspect, the safety mechanism (14) is arranged to rapidly displace the active portion (26) away from a user extremity. Alternatively, according to a second aspect, the safety mechanism (14) is arranged to rapidly urge an extremity of the user away from the active portion (26) of the power tool (10).
US09446530B2
The present invention provides a mandolin slicer adjustable for slicing item in variable thicknesses and variable shapes, wherein the adjustment is enabled by a ballpoint pen ratchet mechanism provided on the mandolin slicer. The mandolin slicer of the present invention further comprises an indicating mechanism to clearly indicate the selected thickness and shape of the sliced item.
US09446524B2
A wire clamp includes a clamp body; a pair of arms coupled to the clamp body; and a piezoelectric actuator having a longitudinal axis extending between a first end and a second end, the actuator being coupled to the pair of arms at the first end and to the clamp body at the second end. The second end of the actuator is coupled to the clamp body by a preload mechanism for applying a preload force along the longitudinal axis, and the preload mechanism comprises at least one wedge having an inclined surface which is slidable over a mating inclined surface.
US09446523B2
An example method includes receiving position data indicative of position of a demonstration tool. Based on the received position data, the method further includes determining a motion path of the demonstration tool, wherein the motion path comprises a sequence of positions of the demonstration tool. The method additionally includes determining a replication control path for a robotic device, where the replication control path includes one or more robot movements that cause the robotic device to move a robot tool through a motion path that corresponds to the motion path of the demonstration tool. The method also includes providing for display of a visual simulation of the one or more robot movements within the replication control path.
US09446519B2
In one example, a method is provided for a computing device to facilitate testing of an electronic apparatus. The method includes receiving a request from an apparatus coupled to a network to which the computing device is also coupled. The method further includes retrieving a command for a robot controlled by the computing device from the request, and configuring the robot to physically interface with the electronic apparatus to perform one or more tests according to the command.
US09446502B2
Precursor alpha alumina abrasive particles in a mold are subjected to a drying process that cracks or fractures at least a majority of the precursor abrasive particles into at least two pieces thereby producing abrasive shards having a smaller size than the mold cavity from which they were made. The smaller abrasive shards, once formed, could be reassembled like jigsaw puzzle pieces to reproduce the original cavity shape of the mold from which they were made. The cracking or fracturing of the precursor abrasive particles is believed to occur by ensuring that the surface tension of the abrasive dispersion to the walls of the mold is greater than the internal attractive forces of the abrasive dispersion as the abrasive dispersion is dried within the mold cavity.
US09446493B2
Kits for polishing sapphire surfaces are disclosed. The kits have compositions including colloidal silica and the colloidal silica has a broad particle size distribution. The kits also include a polishing pad. The polishing pad may include polyurethane impregnated with polyester and it may have a compressibility of about 1% to about 40% and a Shore D hardness of about 50 to about 60.
US09446489B2
A welding structure includes a sheet-shaped first part to be welded; a sheet-shaped second part to be welded that is positioned with respect to the first part to be welded by engaging with the first part to be welded, to perform welding; and a first positioning portion, a second positioning portion, and a third positioning portion, at which the first and second parts to be welded engage with each other. The first to third positioning portions are each configured to restrict movement of one of the first and second parts to be welded in a positioning direction, with respect to the other, and enable movement of the one in a movable direction perpendicular to the positioning direction, with respect to the other. The movable direction of each of the first and second positioning portions is the same direction as the positioning direction of the third positioning portion.
US09446481B2
Provided is a laser machining device that includes a laser oscillator that oscillates a laser beam; a machining head that irradiates the laser beam emitted from the laser oscillator onto a workpiece; and an optical path duct that includes an optical system that guides the laser beam from the laser oscillator to the machining head. A plurality of operation modes, in each of which a parameter is varied when being used when the workpiece is being machined, are provided for the laser machining device; and an energy saving mode, in which the output range of the laser beam is set to be less than that in other operation modes, is included in the operation modes.
US09446473B2
An electric resistance welding operation management device manages a welding operation during manufacture of electric resistance welded steel pipe, in which heat is input to a steel plate, that is being conveyed along a specific conveyance direction and formed into a circular tube shape while pressing side faces of the metal plate with a pair of squeeze rolls, to weld together two circumferential direction edge portions of the metal plate converging in a V-shape. The electric resistance welding operation management device includes an image input section that inputs plural images and each including a Vee convergence region of the steel plate. The electric resistance welding operation management device includes a welding point position derivation section that derives the position of a welding point.
US09446467B2
A method includes performing a plasma activation on a surface of a first package component, removing oxide regions from surfaces of metal pads of the first package component, and performing a pre-bonding to bond the first package component to a second package component.
US09446464B2
A wire discharge machining apparatus includes a numerical control unit carrying out numerical control of the wire discharge machining apparatus according to a machining program and a display unit displaying information concerning machining of the workpiece by the wire discharge machining apparatus. The numerical control unit includes a wire-remaining-length calculating unit calculating a length of the wire remaining in a wire bobbin attached to the wire discharge machining apparatus and a wire-consumed-length calculating unit calculating an estimated length of the wire used for machining of the workpiece. The display unit displays, as a graphic, information concerning a remaining length that is a calculation result in the wire-remaining-length calculating unit and information concerning an estimated consumed length that is a calculation result in the wire-consumed-length calculating unit, and adds information representing a progress of a machining stage to the information concerning the estimated consumed length.
US09446456B2
A remote controlled actuator includes an elongated spindle guide section and a distal end member fitted to a distal end thereof for alteration in attitude. The distal end member rotatably supports a spindle for holding a tool. The spindle guide section includes a rotary shaft for transmitting rotation of a tool rotation drive source to the spindle. An attitude altering member inserted in a guide hole is selectively advanced or retracted by an attitude control drive source. An initial attitude hold control unit controls the attitude control drive source so that an initial attitude holding force necessary to maintain the distal end member in the initial attitude can be applied to the attitude altering member. An attitude alteration control unit controls the attitude control drive source so that the attitude of the distal end member can be altered by a force larger than the initial attitude holding force.
US09446443B2
A cutting member for a shaving razor includes an elongated blade portion that tapers to a cutting edge, an elongated base portion that is integral with the blade portion, and a bent portion, intermediate the blade portion and the base portion. In some implementations, at least part of the cutting member has a thickness of at least about 0.005 inch (0.127 millimeter).
US09446429B2
Methods and systems for providing cleaning and providing barrier coatings to interior wall surfaces of small diameter metal and composite piping systems in buildings. An entire piping system can be cleaned in one single pass by dry particulates forced by air throughout the building piping system by an external generator, and the entire piping system can be coated in one single pass by a machine connected exterior to the piping system. Small pipes can be protected by the effects of water corrosion, erosion and electrolysis, extending the life of piping systems such as copper, steel, lead, brass, cast iron piping and composite materials. Coatings can be applied to pipes having diameters of approximately ⅜″ up to approximately 6″ so that entire piping systems such as potable water lines, natural gas lines, HVAC piping systems, drain lines, and fire sprinkler systems in single-family homes to apartments to high-rise hotel/resort facilities and office towers, apartment and condominium buildings and schools, can be cleaned and coated to pipes within existing walls. The coating forms an approximately 4 mils or greater covering inside of pipes. Buildings can return to service within approximately 24 to approximately 96 hours.
US09446427B2
A method, system and an apparatus for liquid sheeting is disclosed. In one embodiment, an apparatus includes a channel to contain a flow of liquid and a coupling to a liquid source. The channel may include one or more channel ends that may be coupled to the liquid source. The apparatus may also comprise a liquid sheeting component having a length extending along a longitudinal axis of the channel, the liquid sheeting component comprising an outlet extending through a bottom of the channel and a first sheeting element extending from inside the channel through the bottom of the channel, wherein the first sheeting element and the outlet are adjacent and extend the length of the liquid sheeting component and the liquid sheeting component divides the channel longitudinally into at least two side-by-side sub-channels such that a bottom portion of the channel is divided and a top portion of the channel is undivided. The apparatus may also comprise a second sheeting element extending from inside the channel through the bottom of the channel for the length of the liquid sheeting component.
US09446426B2
A device for painting a curved outer surface of an aircraft includes a paint applicator having a plurality of spray painting heads each assigned to one of a plurality of different base color supply units containing one of polyurethane aircraft paint and ink. The device further includes a spatially adjustable positioning device configured to move the paint applicator relative to the curved outer surface and at least one sensor device configured to determine a three-dimensional geometry of the curved outer surface. The device also includes a control unit configured to coordinate a movement of the positioning device with a paint output of the paint applicator, wherein the control unit is configured to alternately activate each of the plurality of spray painting heads so as to produce a picture motif so as to derive a two-dimensional driving geometry based on the three-dimensional geometry.
US09446424B2
A device for packaging, dispensing and using fluid contents having a liquid to pasty consistency, includes: a container having, at its front portion, a downstream opening, an element for conveying the contents including an upstream opening, an axially extended passage and a front downstream opening for dispensing the contents, the passage being elastically deformable and capable of being in an idle state having a maximum interior volume or in a compressed state having a smaller interior volume, an upstream valve element, a downstream valve element, a front wall, wherein is situated the front downstream dispenser opening, a movable annular actuating element associated with the passage of the conveying element and consisting of an elastically deformable annular side wall, which limits the passage laterally and externally. The side wall is positioned on the outside and includes an outer side wall of the device, which is at least partially accessible for actuating.
US09446413B2
A planetary mill is disclosed. The planetary mill comprises a self-balancing milling assembly comprising a pair of elongate floating milling chambers arranged in parallel to and on opposite sides of a main axis wherein the milling chambers are free to move outwards in a direction radial to the main axis, a drive assembly for rotating the milling assembly in a first direction of rotation about the main axis, and at least one of belt surrounding the pair of floating milling chambers such that when the milling assembly rotates about the main axis, the at least one belt limits a radial travel outwards of each of the milling chambers.
US09446409B2
Embodiments of the invention provide an efficient and effective technique for storing and dispensing reagent beads. In some embodiments, an apparatus is provided for dispensing reagent beads contained in a bead storage device which includes a bead carrier having a plurality of wells; a plurality of reagent beads disposed in the wells; and a cover tape releasably attached to the bead carrier to cover the wells and retain the reagent beads in the wells. The apparatus comprises a channel in which to place the bead storage device with the bead carrier facing a support wall of the channel and the cover tape facing a stripping wall of the channel. The stripping wall includes a stripping gap disposed between a stripping edge and an opposite edge, and a dispense opening provided adjacent the opposite edge on a side of the stripping wall opposite from the stripping edge. The cover tape is insertable through the stripping gap to be pulled against the stripping edge to peel the cover tape from the bead carrier to move the wells of the bead carrier inside the channel toward the dispense opening and expose the wells individually to dispense the reagent beads.
US09446394B2
The present invention relates generally to olefin metathesis. In some embodiments, the present invention provides methods for Z-selective ring-closing metathesis.
US09446393B2
In some embodiments, the present disclosure pertains to a compound, comprising a transition metal complex having the formula Φ-[M(x,y)-L1(w,v)-L2(t,u)-L3]p+An−mZ−p_m. In an embodiment of the present disclosure Φ may be A. In another embodiment Φ may be Δ. In some embodiments of the present disclosure, M is a transition metal. In a related embodiment, p is an integer corresponding to the oxidation state of M. In some embodiments of the present disclosure, each of x, y, w, v, t, and u independently comprise R. In other embodiments, each of x, y, w, v, t, and u independently comprise S. In an embodiment of the present disclosure, each of L1, L2, and L3 independently is a ligand comprising a substituted diamine. In some embodiments, An″ comprises a lipophilic anion, where m is from 1 to 3, and where Z− comprises an optional second anion.
US09446390B2
The present invention relates to a process for preparing acrylic acid comprising (i) providing a stream comprising a formaldehyde source and acetic acid and (ii) contacting this stream with an aldol condensation catalyst comprising a zeolitic material, wherein the framework structure of the zeolitic material in (ii) includes Si and O, and has a molar Al:Si ratio of 0:1 to 0.001:1, and wherein the framework structure of the zeolitic material in (ii), in addition to Si and any Al, comprises one or more elements selected from the group consisting of tetravalent elements Y other than Si and trivalent elements X other than Al.
US09446383B2
The system and method requiring a diverter plate for an in-line mill. The plate for use with the in-line mill includes an aperture for passage of particulate laden fluid therethrough and a plurality of tabs such that the fluid and the particulate entrained thereon is deflected at a variety of axial angles. The diverter plate thus provides a reliable method such that the milling process and component wear resistance is made more efficient thereby.
US09446362B2
The present invention concerns a process for unloading a bed (2) of particulate material from a vessel (1), which comprises inserting a removable and portable extraction pipe (4) into the lower part of said bed, injecting a fluidization gas upwardly into the extraction pipe (4) from the bottom part thereof, along the entire length of the extraction pipe (4), and applying a positive pressure differential between the inlet and the outlet of said extraction pipe.The present invention further concerns a device suitable for implementing such a process.
US09446352B2
An object of this invention is to provide an atmosphere-cleaning device for vehicles that is capable of restoring the function of an ozone purifying body carried by a vehicle component. Mud, dust, snow-melting agents as well as SOx and NOx are scattered into the atmosphere as a result of being swirled up by a preceding vehicle or due to weather and climate conditions. When such extraneous substances adhere or the like to an ozone purifying body, the purification sites thereof are clogged and the ozone purification function deteriorates. Therefore, when a predetermined removal implementation condition is established, control is executed to inject cleaning liquid from an injector to enhance the fluidity of the extraneous substances and wash the extraneous substances away. The function of the ozone purifying body can thereby be restored.
US09446350B2
[Object] To provide a gas decomposition apparatus and a gas decomposition method in which no safety problems occur in spite of the application of a relatively high voltage between an anode and a cathode for the purpose of decomposing odorous gases of many types.[Solution] A catalytic electrode layer 6 that contains a catalyst and is porous; a counter electrode layer 7 that forms a pair with the catalytic electrode; and an electrolyte layer 15 that is sandwiched between the catalytic electrode and the counter electrode and has ion conductivity are included. The catalyst is held by the catalytic electrode in the form of being carried by a carrier containing a conductive material or the catalyst is directly carried by the catalytic electrode. A conductive material in the catalytic electrode, the conductive material being in contact with the catalyst, is not a noncovalent carbon material.
US09446349B2
Disclosed are an adsorptive permeation hollow fiber membrane formed by uniformly dispersing an adsorbent capable of selectively adsorbing only a specific gas in mixed gas components inside a porous hollow fiber membrane having a sponge structure capable of non-selectively permeating a mixed gas in a powder or crystalline powder form, a method of manufacturing the same, and a gas adsorptive/desorptive separation system utilizing the same.
US09446344B2
The invention describes a method for enriching at least one component from a gaseous mixture of substances, comprising the steps of (i) contacting a flow of a first gaseous mixture of substances which contains at least one component to be enriched, with a composite material at a first pressure p1 such that the at least one component to be enriched is adsorbed to the composite material and a charged composite material is obtained, said composite material comprising (a) a porous matrix of a fluorine-containing polymer having a percentage of tetrafluoroethylene monomer units of at least 95 mol % based on the total number of monomer units and (b) zeolite particles which are embedded in the matrix and around which matrix filaments extend; (ii) disrupting the flow of the gaseous mixture of substances and (iii) desorbing the at least one component to be enriched from the charged composite material by reducing the pressure to a pressure p2, with p1−p2≧200 mbar, such that a second gaseous mixture of substances is produced and removing the second gaseous mixture of substances from the composite material.
US09446340B2
Filters capable of dissipating static charges. One example includes a filter media pack comprising fluted media secured to facing media; the fluted media having cellulose fibers; and the fluted media including an amount of carbon black sufficient to impart a static charge dissipative property thereto. One example includes an air filter cartridge having a filter media pack comprising fluted media secured to facing media; the fluted media comprising cellulose fibers; the fluted media having at least one side coated with a static charge dissipative amount of a metallic coating. These filters are useable in, for example, dust collectors.
US09446332B2
Disclosed is an apparatus for separating gas and liquid. The apparatus for separating gas and liquid includes a housing, a rotating shaft provided inside the housing, a drive unit configured to rotate the rotating shaft, a rotating cone mounted at the rotating shaft to rotate about the rotating shaft and having a diameter decreasing from an upper end to a lower end thereof, a fixed cone fixed in the housing to be spaced apart from the rotating cone and having a diameter decreasing from an upper end to a lower end thereof, and a scraper configured to remove scale generated in at least one of the fixed cone and the rotating cone, based on the rotation of the rotating shaft.
US09446328B2
Described herein is a liquid filtration device is disclosed comprising a fluid conduit fluidly connecting a fluid inlet to a fluid outlet; and a water filtration medium disposed in the fluid conduit; the water filter medium comprising a metal-containing particulate, wherein the metal-containing particulate comprises a thermolysis product of a metal salt wherein the salt is selected from nitrogen-containing oxyanions, sulfur-containing anions, chlorides, phosphates, and combinations thereof; and methods of removing chloramines from aqueous solutions.
US09446323B2
A recreational slide is presented having a lubricious top surface having an entry end and an exit end. Two side tubes are affixed laterally along each side of the slide to prevent water and users from sliding off the slide while in use. One or more water sprayers are located along the interconnection between the slide and one or both of the tubes to provide a continuous water supply to the surface of the slide. The exit end of the tube is configured with a connecting flap which removably attaches to the entry end of a tube of an adjoining slide to make a seamless transition between tubes. In addition, the water sprayers are configured so that the exit end of one water sprayer is interconnectable with the entry end of an adjoining water sprayer to make a seamless transition between water sprayers when interconnected.
US09446321B1
A system, computer-readable storage medium storing at least one program, and a computer-implemented method for providing public gameplay is provided. Gameboard display data is generated to display a gameboard of a game. A move associated with the game is received from a client device of a player. The gameboard display data and move display data are provided to the client device to display the move on the gameboard. The gameboard display data and the move display data are also sent to a broadcast server to display the move on the gameboard via a public medium.
US09446319B2
An interactive gaming toy is provided for playing a game having both physical and virtual gameplay elements. The gaming toy comprises a physical toy, such as a toy wand, doll or action figure, having an RFID tag pre-programmed with a unique identifier that identifies the toy within an associated computer-animated game. The RFID tag stores information describing certain attributes or abilities of a corresponding virtual character or object in the computer-animated game. Additional information may be stored on the RFID tag as the corresponding virtual character evolves or changes over time based on player performance and/or gameplay progression. The interactive gaming toy thus allows developed character attributes and the like to be stored and easily transported to other games and compatible gaming platforms. One or more optional auxiliary components may be attached to the gaming toy to selectively create a modified gaming toy having additional desired functionality and/or aesthetics.
US09446312B2
Example systems and methods relate to playing a multi-player video game in which multiple players each supply inputs to a respective input device to control a corresponding game character in a game world displayed on a display screen. Movements of each game character in the game world are controlled in accordance with respective first game character control operations during the playing of the multi-player video game. In response to satisfaction of one or more conditions, one player's game character is protected from harm in the game world, wherein one of the one or more conditions is a condition triggered voluntarily by the one player. Movements of the protected game character in the game world are controlled based on a position of another, unprotected game character.
US09446305B2
A system and method for efficiently processing a video stream using limited hardware and/or software resources. For example, one embodiment of a computer-implemented method for efficiently processing a video stream with a processor pipeline having a plurality of pipeline stages, comprises: identifying a bottleneck stage within the processor pipeline the bottleneck stage processing frames of the video stream; receiving a feedback signal from the bottleneck stage at one or more upstream stages, the feedback signal providing an indication of the speed at which the bottleneck stage is processing the frames of the video stream; and responsively adjusting the speed at which the one or more upstream stages are processing frames of the video stream to approximate the speed at which the bottleneck stage is processing the frames of the video stream.
US09446298B2
A roller apparatus that either attaches to or is incorporated into a roller hockey goalie leg protective member, allowing simulation of “on ice” motion. Rolling may be accomplished through a plurality of ball bearings, protruding from a plane of an apparatus, as well as a plurality of cavities wherein ball bearings may be housed. A recess in the cavities may allow for impact to be absorbed while still allowing the ball bearings to freely roll in one or preferably every direction. Apparatus containing ball bearings may be located on the landings of a roller hockey goalie leg protective member, or other areas most likely to come in contact with a dry surface.
US09446297B2
The device for throwing balls includes a frame having a striking mechanism formed of a striking arm and a striker. The striker is provided at the free end of the striking arm, and the striking arm is pivotably mobile via a shaft and combined with a driver suitable for pivoting the arm such that the striker can follow a circular path passing through a location intended to receive a ball. The striker includes a roller mounted so as to be freely rotatable about an axis parallel to that of pivoting of the striking arm.
US09446281B2
An exercise device with a frame which may include a longitudinal center section, defining a first end and a second end, and two substantially equal end sections, one of each of the end sections may be coupled to the first end and the second end of the center section substantially at a midpoint with respect to the width and the height of the end sections. One or more pins may be coupled to the frame between the first end and the second end, the pins adapted to receive weight plates. A bumper may be coupled to the top and bottom of the end sections. A sled frame may be added to the device to convert the device to a functional sled with different configurations. The sled skids may be removable to be easily repositioned, removed or replaced when worn.
US09446265B2
A finisher composition that provides improved look and feel benefits to an underlying skin care product. The finisher composition is an oil-in-water emulsion that includes from 10 to 25 wt % of substantially spherical starch particles having a mean particle size of from 5 to 30 microns. The oil phase of the finisher includes a non-volatile oil present at an amount to provide a weight ratio of non-volatile oil to starch particles of from 1:10 to 3:2. The aqueous phase of the finisher includes from 20 to 85 wt % of water.
US09446264B2
A medical method includes: determining a first probability density function related to a first uncertainty in hitting a target in a treatment of the target; determining a second probability density function related to a second uncertainty, wherein the first uncertainty is attributable to a first source of uncertainty, and the second uncertainty is attributable to a second source of uncertainty that is different from the first source of uncertainty; processing at least the first probability density function and the second probability density function using a processing unit; and outputting a result of the processing.
US09446257B2
According to an embodiment of the present invention, an apparatus includes an automated external defibrillator including at least one display. The apparatus also includes a support mechanism for supporting the automated external defibrillator. The support mechanism includes a stand connected to a hinge that is connected to the automated external defibrillator. The hinge is capable of placing the stand in a deployed position for supporting the automated external defibrillator during operation and is capable of placing the stand in a stowed position for storing the automated external defibrillator.
US09446256B2
A single-chamber implantable device for detecting a patient's atrial activity using a monobody lead is disclosed. The monobody lead (10) includes a ventricular coil (16), a supraventricular coil (18), a distal electrode (14) forming three electrodes for detecting depolarization signals. A generator (12) of the implantable device collects a first unipolar signal (20) between the ventricular coil and the generator housing and a second unipolar signal (22) between the supraventricular coil and the generator housing. An independent component analysis is performed to the detected depolarization signals to determine an estimated atrial activity signal from the first and second unipolar signals.
US09446253B2
System and methods for energy adaptive communications between medical devices are disclosed. In one example, a medical device includes a communication module configured to deliver a plurality of pulses to tissue of a patient, where each pulse has an amount of energy. A control module operatively coupled to the communication module, may be configured to, for each delivered pulse, determine whether the delivered pulse produces an unwanted stimulation of the patient and to change the amount of energy of the plurality of pulses over time so as to identify an amount of energy that corresponds to an unwanted stimulation threshold for the pulses. The control module may then set a maximum energy value for communication pulses that is below the unwanted stimulation threshold, and may deliver communication pulses below the maximum energy value during communication with another medical device.
US09446252B2
In one embodiment, a method, of operating an implantable medical device, comprises: (i) operating reset logic within the implantable medical device that is independently operable from a processor of the implantable medical device after the implantable medical device is implanted within a patient, wherein the processor is adapted for central control of the implantable medical device; (ii) operating a magnetic field sensor in the implantable medical device; (iii) generating digital data using, at least, the magnetic field sensor; (iv) detecting, by the reset logic, a digital key in the digital data; (v) in response to (iv), asserting a reset signal on a pin of the processor by the reset logic; and (vi) conducting reset operations in the processor in response to the reset signal.
US09446248B2
Delivery tools of interventional medical systems facilitate deployment of relatively compact implantable medical devices that include sensing extensions, for example, right ventricular cardiac pacing devices that include a sensing extension for atrial sensing. An entirety of such a device is contained within a delivery tool while a distal-most portion of the tool is navigated to a target implant site; the tool is configured to expose, out from a distal opening thereof, a distal portion of the device for initial deployment, after which sensing, via a sense electrode of the aforementioned sensing extension of the device, can be evaluated without withdrawing the tool from over the remainder of the device that includes the sensing extension.
US09446246B2
An implantable cardiac therapy device and methods of using a device including an implantable stimulation pulse generator, one or more implantable leads defining sensing and stimulation circuits adapted to sense and deliver therapy in at least one right side heart chamber, and an implantable controller in communication with the stimulation pulse generator and the one or more patient leads so as to receive sensed signals indicative of a patient's physiologic activity and deliver indicated therapy. The controller is adapted to monitor at least one indicator of cardiac dysynchrony and to compare the at least one indicator to a determined dysynchrony threshold. The threshold is determined for indications that the patient be further evaluated for cardiac resynchronization therapy. The controller is further adapted to set an alert when the at least one indicator exceeds the threshold to indicate to a clinician that evaluation for bi-ventricular pacing might be indicated.
US09446244B2
An algorithm programmed into the control circuitry of a rechargeable-battery Implantable Medical Device (IMD) is disclosed that can quantitatively forecast and determine the timing of an early replacement indicator (tEOLi) and an IMD End of Life (tEOL). These forecasts and determinations of tEOLi and tEOL occur in accordance with one or more parameters having an effect on rechargeable battery capacity, such as number of charging cycles, charging current, discharge depth, load current, and battery calendar age. The algorithm consults such parameters as stored over the history of the operation of the IMD in a parameter log, and in conjunction with a battery capacity database reflective of the effect of these parameters on battery capacity, determines and forecasts tEOLi and tEOL Such forecasted or determined values may also be used by a shutdown algorithm to suspend therapeutic operation of the IMD.
US09446239B2
A neurostimulation comprises a plurality of electrical terminals configured for being respectively coupled to an array of electrodes, at least three configurable sources respectively coupled to at least three of the electrical terminals, and control circuitry configured for programming each of the at least three configurable sources to be either a current source or a voltage source. A method of providing neurostimulation therapy to a patient using an array of electrodes implanted adjacent neural tissue of the patient, comprises conveying electrical stimulation energy between a first one the electrodes and a second one of the electrodes, thereby creating an electrical field potential within the neural tissue, regulating a first current flowing through the first electrode, and regulating a first voltage at a third different one of the electrodes, thereby modifying a shape of the electrical field potential within the neural tissue.
US09446235B2
In some examples, relatively low frequency (e.g., less than about 50 Hertz) electrical stimulation therapy is delivered to a target tissue site proximate to one or more of the T9, T10, T11, T12, L1, L2, or L3 (“T9-L3”) spinal nerves of a patient to manage a pelvic floor disorder, such as urinary retention, fecal retention, or both. The relatively low frequency electrical stimulation therapy is configured to excite the one or more of the T9-L3 spinal nerves, which may generate an activating response from the patient related to voiding and help promote voiding by the patient. For example, the low frequency electrical stimulation may be configured to help improve the patient's pelvic sensations, which may help the patient better control urination.
US09446231B2
A neurostimulation system and method of providing therapy to a patient implanted with a plurality of electrodes using a plurality of electrical sources is provided. A source-electrode coupling configuration is determined from the electrical sources and electrodes. Electrical current is respectively conveyed between active ones of the plurality of electrical sources and active subsets of the plurality of electrodes in accordance with the determined source-electrode coupling configuration. The total number of the electrodes in the active electrode subsets is greater than the total number of the active electrical sources.
US09446230B1
An exemplary cochlear electrode array includes a flexible body having a pre-curved spiral shape so as to conform with the curvature of a human cochlea, a plurality of stimulation electrode contacts spaced apart along a first side of the flexible body, a bundle of wires embedded within the flexible body for electrically connecting the electrode contacts to at least one stimulation signal source, at least one inflatable portion extending along at least part of the length of the flexible body, the at least one inflatable portion being adapted to straighten the flexible body, starting from the pre-curved shape, prior to insertion into the cochlea upon being inflated by being filled with gas or liquid, and to allow the flexible body to gradually reassume its pre-curved shape during insertion of the flexible body into the cochlea upon gradual withdrawal of gas or liquid from the at least one inflatable portion.
US09446227B2
Therapeutic agents, diagnostic agents and other compositions can be effectively delivered to target tissues using ultrasonic dispersion. For example, a therapeutic agent in solution may be injected subcutaneously in the vicinity of a target tissue in a patient. External ultrasound is used to disperse the therapeutic agent in the target tissue. The disclosed methods provide increased concentrations of therapeutic agents in tissue relative to traditional delivery methods, thereby improving therapeutic outcomes while reducing costs. In addition the methods can be used to deliver effective concentrations of therapeutic agents to tissues with limited blood supply.
US09446226B2
Composite structures composed of a fibril core and a polymeric coat and designed capable of encapsulating both hydrophobic and hydrophilic bioactive agents while retaining the activity of these agents are disclosed. Further disclosed are processes of preparing such composite structures, and medical devices and disposable articles made therefrom.
US09446224B2
Devices and methods are provided to conduct fluid away from or deliver fluid to an area of a treatment site of a patient's body. In one example, a catheter includes a fluid exchange portion and a member attached to the fluid exchange portion for biasing fluid flow at the treatment site.
US09446211B2
A resuscitator has a patient airway interface device, a bag, a flow passage coupled between the bag and patient airway interface device, and a sensor assembly. The patient airway interface device may be a mask or an endotracheal tube. The sensor assembly has a display, at least one sensor coupled to the flow passage and configured to provide a measurement of at least one parameter, and a processor coupled to the display and the at least one sensor. The processor is configured to receive the measurement from the sensor and provide information on the display based on the received measurement. The information may include a current breath rate, a pressure-vs-time curve, and guidance to the user to assist in achieving a target breath rate.
US09446202B2
A plunger (4) having engaging means and a lever (5) are arranged in a body (1). The lever has a first pivot that is stationary with respect to the body in the direction of an axis, a second pivot, and a third pivot formed by an engaging element of the lever. The pivots are arranged in such a manner that a rotation of the lever with respect to the first pivot moves the second pivot and the third pivot in the same direction with respect to the axis. The engaging element and the engaging means are shaped such that the lever is disengaged from the plunger when the second pivot is moved relatively to the plunger in the proximal direction (30), and the plunger is engaged with the lever when the second pivot is moved in the distal direction (20).
US09446201B2
A medicament delivery device has proximal and distal housing parts connected along a longitudinal axis, the proximal part for accommodating a medicament container. A drive member inside the distal part has a first circumferential set of interacting devices. A longitudinal plunger rod is rotationally locked through a central passage of the distal part, acts on a stopper inside the container, and is connected to the plunger rod. A turnable dose setting member coaxially arranged around the drive member is rotatably connected to the distal part. A torsion spring is connected to the dose setting member and to a hub of the drive member. The hub, spring, dose setting member, and drive member are coaxial transversally. The drive nut has second interacting devices on its outer surface. When the drive member is rotated by the spring, the drive nut rotates, whereby the plunger rod moves proximally for expelling a dose of medicament.
US09446199B1
Syringes and methods of using are described which protect the syringe barrel cavity from contaminants. A first syringe is formed with a corrugated sheath which encloses the plunger and space between the rearward end face surface of the syringe barrel handle member and the forward face of the plunger handle member. A second syringe is formed with a syringe barrel having a straight segment and a corrugated segment having the forward face of the plunger handle member molded to the rearward terminus of the corrugated segment of the syringe barrel. A third syringe is formed from mating syringe barrel and plunger member walls. The walls of the mating syringe barrel and plunger member are concentric and slide relative to each other while maintaining an enclosure around the plunger shaft. A fourth syringe is formed from inner and outer concentric syringe barrel walls mating with the walls of a plunger member. The mating walls are concentric and slide relative to each other while maintaining an enclosure around the plunger shaft. A fifth syringe is formed with an end cap contaminant shield having an extension wall that is mated with the rearward end opening of the syringe barrel cavity. Alternatively, the end cap contaminant shield can be provided with a flat design without the extending wall and is bonded or molded to the rearward end terminus of the syringe barrel. The end cap contaminant shield designs are provided with an opening defining the shape of the cross-section of the plunger shaft.
US09446193B2
A dosing unit for an ambulatory infusion pump device is presented. The dosing unit comprises a cylinder pump with a cylinder and a piston arranged in the cylinder. The piston has a shaft with a first threaded segment interacting with a threaded portion of the cylinder and can be displaced along a longitudinal axis of the cylinder by rotating the piston in regard to the cylinder around the axis. Furthermore, the piston allows for the relative or absolute determination of the longitudinal and/or rotational displacement of the piston in regard to the cylinder. In one embodiment, the piston shaft comprises a second segment provided with optically detectable markings that allow the monitoring of the longitudinal and/or rotational displacement of the piston in regard to the cylinder.
US09446186B2
Some embodiments of an infusion pump system can be configured to provide improved safety monitoring features so that a user receives proper dosage amounts.
US09446185B2
Devices and methods for delivering therapeutic fluid to a patient's body are described. The devices may comprise a dispensing unit having a reservoir, a driving mechanism having a movable member for delivering therapeutic fluid to a patient's body, at least one sensor for sensing a relative position of the movable member and generating a signal, and a processor for controlling the driving mechanism to deliver an amount of therapeutic fluid that compensates for a change in the flow of the therapeutic fluid occurring during fluid delivery. The methods may be implemented by operating the driving mechanism, receiving a signal based on the position of the movable member, determining an amount of therapeutic fluid to deliver, and controlling the driving mechanism to deliver an amount of fluid that compensates for a change in flow occurring during fluid delivery.
US09446182B2
A filling device of a fluid conducting system of an extracorporeal blood treatment device is disclosed. The filling device includes a spike that is adapted for connection to a single fluid connector of a medical fluid container of the fluid system and a manually operable fluid blocking mechanism that is arranged directly downstream of the spike and is adapted or provided in such a way so as to remain fluidly connected with the spike while the filling device is in operation. The fluid blocking mechanism has at least one fluid outlet connector that is adapted so that a line section or hose of the fluid conducting system, preferably an arterial line section of a blood purification device, can be connected to it in a detachable manner while the filling device is in operation.
US09446178B2
An apparatus for cleansing wounds, in which wound exudate is removed from a wound bed and selectively cleansed and returned to the wound. The cleansing means removes materials deleterious to wound healing, and the cleansed fluid, still containing materials that are beneficial in promoting wound healing, is returned to the wound bed. The associated wound dressing and cleansing means are conformable to the wound, and may have irrigant fluid circulated from a reservoir by a device for moving fluid through a flow path which passes through the dressing and a means for fluid cleansing and back to the dressing.
US09446175B2
Methods for treating or preventing neointima stenosis are disclosed. The methods generally involve the use of a TGFβ inhibitor, a SMAD2 inhibitor, an FGF Receptor agonist, a Let-7 agonist, or a combination thereof, to inhibit endothelial-to-mesenchymal transition (Endo-MT) of vascular endothelial cells into smooth muscle cells (SMC) at sites of endothelial damage. The disclosed methods can therefore be used to prevent or inhibit neointimal stenosis or restenosis, e.g., after angioplasty, vascular graft, or stent. Also disclosed are methods for increasing the patency of biodegradable, synthetic vascular grafts using a composition that inhibits Endo-MT. A cell-free tissue engineered vascular graft (TEVG) produced by this method is also disclosed.
US09446165B2
Biomedical and tissue engineering devices, such as surgical sutures and microporous scaffolds, respectively, which undergo swelling and increase in dimensions when placed in aqueous environments such as living tissues, are produced by the melt-spinning or electrostatic spinning into strong monofilament and multifilament yarns or microfibrous fabrics, respectively. Such devices are formed from especially high molecular weight crystalline polyether-esters having a minimum inherent viscosity of 0.8 dL/g and heat of fusion of at least 5 J/g, wherein the polyether-esters are made by grafting to a polyester component a polyether glycol component having a minimum molecular weight of about 11 kDa with at least one cyclic monomer.
US09446124B2
Antibodies which bind an antigen of the bone marrow neovasculature in leukemia patients, for use in treatment and diagnosis of leukemia, in particular the treatment and diagnosis of acute myeloid leukemia (AML).
US09446122B2
The present invention is directed to the use of FGK-1 immunopotentiator, composed by the peptide named GK-1, characterized by the sequence G-Y-Y-Y-P-S-D-P-N-T-F-Y-A-P-P-Y-S-A (SEQ ID No. 1) and linked to the pVIII surface protein of M13 filamentous phage, to prepare pharmaceutical products potentiating the protective immune response of vaccine antigens when used by itself or conjointly with these antigens administered either intranasally, subcutaneously, or intramuscularly, yielding an increase in the level of specific antibodies against vaccine antigens in serum and in bronchioalveolar lavages.
US09446118B2
The present invention encompasses recombinant Newcastle Disease Virus-Herpesvirus vaccines or compositions. The invention encompasses recombinant NDV vectors encoding and expressing herpesvirus pathogen, antigens, proteins, epitopes or immunogens. Such vaccines or compositions can be used to protect animals against disease.
US09446116B2
Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMVVVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.
US09446105B2
The invention provides compositions and methods for treating leukemia, for example, acute myeloid leukemia (AML). The invention also relates to at least one chimeric antigen receptor (CAR) specific to folate receptor beta (FRβ), vectors comprising the same, and recombinant T cells comprising the FRβ CAR. The invention also includes methods of administering a genetically modified T cell expressing a CAR that comprises a FRβ binding domain in combination with a RXR agonist, such as all-trans retinoic acid.
US09446103B2
Methods and apparatus for a free-standing biodegradable patch suitable for medical applications, especially intravascular, minimally-invasive and intraoperative surgical applications are provided, wherein the patch comprises a free-standing film or device having a mixture of a solid fibrinogen component and a solid thrombin component that, when exposed to an aqueous environment, undergoes polymerization to form fibrin. In alternative embodiments the patch may comprise a solid fibrinogen component, with or without an inorganic calcium salt component. The patch may take a non-adherent form during delivery to a target location within a vessel or tissue, and thereafter may be activated to adhere to vessel wall or tissue, and may include a number of additives, including materials to improve the mechanical properties of the patch, or one or more therapeutic or contrast agents.
US09446102B2
The present invention relates to isolated polypeptides having alpha-glucuronidase activity, catalytic domains and polynucleotides encoding the polypeptides, catalytic domains. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides or catalytic domains.
US09446095B2
Provided is a solid composition which has reduced bad taste and offensive odor and provides good taste and flavor, while containing wheat albumin at a high concentration. A solid composition comprising the following components (A) and (B): (A) wheat albumin, and (B) alanine or a salt thereof, wherein a mass ratio of a content of the 0.19-wheat albumin (a) in the solid composition to a content of the alanine or a salt thereof in terms of alanine (b) in the solid composition, [(a):(b)], is from 250:1 to 10:1.
US09446092B2
The present invention provides a new drug to treat malignant glioma, which is the most prevalent type of primary tumor of the central nervous system (CNS). The present invention indeed shows that the isolated NFL-TBS40-63 peptide is highly specific for glioma cells, in which it triggers apoptosis. It is therefore presented here for use in a method for treating malignant glioma. The present invention further relates to the use of the NFL-TBS40-63 peptide for detecting specifically glioma cells either in vivo, or in vitro, or for addressing chemical compounds to said tumor cells.
US09446088B2
The present invention relates to the preparation of an enriched and equilibrated plant extract from Solanum glaucophyllum with an enriched content of 1,25-dihydroxyvitamin D3, glycosides and flavonols, particularly quercetin glycosides. The present invention particularly describes a method for preparation of such a plant extract either in industrial or in laboratory scale. The present invention furthermore describes the use of such a plant extract or similar (synthetic) compositions for the prevention and treatment of bone mass reduction-related diseases, such as Osteopenia or Osteoporosis, for the prevention and treatment of Tibial Dyschondroplasis, preferably in poultry, for the treatment of milk fever, and is a dietary supplement for human and veterinary use.
US09446086B2
A novel herbal extract, MF101, is effective in the treatment of symptoms of menopause.
US09446083B2
A fatty acid composition containing linoleic acid, linolenic acid and oleic acid is provided. Also provided is a fatty acid composition containing linoleic acid, linolenic acid and oleic acid, and at least one selected from palmitinic acid, palmitoleic acid, stearic acid, arachidic acid and docosanoic acid. A plant extract and a pharmaceutical preparation are provided, wherein the pharmaceutical preparation contains an active component including at least one of the fatty acid composition, the plant extract and modified products thereof. Also provided is an application of the fatty acid composition, the plant extract and the pharmaceutical preparation in multiple fields. The pharmaceutical preparation may function to repair various wounds and traumas in skin, mucosa, lumina and muscular tissues.
US09446076B2
The present invention is related to a pharmaceutical composition comprising cells committed to the generation of heart tissue and at least one pharmaceutically acceptable excipient produced according to internationally recognized standards for pharmaceutical product manufacture, a process for the manufacture of such a pharmaceutical composition and a kit for the administration of said pharmaceutical composition which comprises a container containing said pharmaceutical composition.
US09446057B2
The disclosure provides controlled release compositions comprising tetracyclines and in some embodiments, doxycycline. The controlled release doxycycline compositions of the invention exhibit a superior dissolution profile and provide reduce side effects such as nausea and irritation.
US09446052B2
Provided is a composition for preventing nausea or vomiting, including a 5-HT3 receptor antagonist and a corticosteroid, and having a pH adjusted to 3.0-6.0. Provided also is a method for preparing a composition for preventing nausea or vomiting, including: mixing a 5-HT3 receptor antagonist with a corticosteroid; and adjusting pH of the mixture obtained from the preceding operation to 3.0-6.0.
US09446051B2
Methods for treating neurodegeneration and/or myelination in patients are disclosed comprising treating the patient with a progestin compound which exerts binding to progesterone receptors and elicits progesterone-receptor-induced biological responses without interacting with the androgen receptor and without inducing androgen or glucocorticoid biological responses at a dosage sufficient to prevent or reduce neurodegeneration. The progestin compound preferably comprises 16-methylene-17α-acetoxy-19-norpregn-4-ene-3,20-dione, and the methods include combining the progestin compound with an estrogen compound to provide both contraception and treatment for myelin repair and neurodegeneration, and include effects on stroke and TBI.
US09446049B2
The basic formulation comprises a combination of three estrogens, 2-hydroxyestrone, 17-beta-estradiol and estriol, and a metabolite of an estrogen, 2-methoxyestradiol, in specified amounts. Amounts of folic acid, DHEA, testosterone, Vitamin B6, Di-Indolyl Methane, melatonin and progesterone, as well as selenium and cobalt can be added in specific amounts to the basic formulation. 2-Hydroxyestradiol, another metabolic, can also be added.
US09446045B2
A method for treating cancer tumors, particularly ovarian cancer tumors, is described, where fused cyclic pyrimidine having a cancer treating ability is selectively delivered to an FR expressing cancerous tumor.
US09446041B2
The present invention relates to a method of treating T cell mediated inflammatory immune diseases or T cell mediated hypersensitivity diseases, which comprises administering to a human in need thereof an effective amount of a compound which inhibits EZH2 and/or EZH1, or a pharmaceutically acceptable salt thereof.
US09446040B2
Imidazoquinolines of formula I that contain substituted amine or amide functionality at 1-position and that are effective as Toll like Receptor 7 activators are disclosed. These compounds are useful as anticancer agents.
US09446038B2
A method and composition for treating serotonin receptor-mediated conditions.
US09446036B2
Delivery systems and compositions comprised of a biodegradable polyorthoester polymer, an aprotic solvent, and a drug are described. The solvent is selected to modulate release of drug from the composition, where, in some embodiments, the solvent is rapidly released after administration and provides a corresponding rapid rate of drug release. Alternatively, in other embodiments, the solvent is slowly released from the composition after its administration, and provides a correspondingly slow rate of drug release.
US09446035B2
Provided herein are compounds according to Formula I and pharmaceutically acceptable salts thereof, and compositions comprising the same, for use in various methods, including treating cancers such as colon, ovarian, pancreatic, breast, liver, prostate and hematologic cancers:
US09446034B2
The present invention relates to a compound of formula (I): or a pharmaceutically acceptable salt thereof, wherein R1, R2, R3, R11, R12, R13, Q, Z, and p are as described herein. Compounds of the present invention are useful for the treatment of cancers.
US09446029B2
Methods for managing visceral pain in mammalian subjects are described, in which a NK-1 receptor antagonist is administered to the subject before, during or after administration of general anesthesia. The methods and uses of NK-1 receptor antagonists described herein provide improved visceral pain management and MAC reduction when used with volatile anesthetics for general anesthesia.
US09446026B2
The present invention relates to topical formulations comprising a compound of the following formula: for treating ocular neovascularization. The Compound-I is present in a solution or a suspension in about 0.005% to about 5.0% w/v, such that the solution or suspension delivers the compound at the posterior segment of the eye for inhibiting VEGF in the retina and/or the choroid.
US09446024B2
The present disclosure provides novel formulations suitable for the intravaginal delivery of tinidazole, as well as methods of using the same.
US09446015B2
The present invention relates to novel nitric oxide donor compounds for the use in the treatment and/or prophylaxis of hypertensive glaucoma, normotensive glaucoma and ocular hypertension.
US09446014B2
It has now been found that after administration to a diseased person or person that is at risk for developing such disease of a neutraceutical or pharmaceutical composition that comprises: a) a lipid fraction comprising at least one of docosahexaneoic acid (DHA), docosapentaenoic acid (DPA) and eicosapentaenoic acid (EPA); b) a protein fraction comprising proteinaceous material from non-human origin which provide at least cysteine and/or taurine; and c) a mineral fraction comprising at least one of manganese and molybdene, the health of these persons improves. Membrane function of several types of mammalian cells improves, which allows efficient treatment of immune related disorders, such as allergy, autoimmune diseases, cancer, cognitive dysfunction and other diseases of the nervous system, neuropathies, such as diabetic neuropathies and neuropathic pains, neuronal damage during insulin resistance, and gut diseases and support of the development of gut and lung function during growth or recovery.
US09446010B2
Methods and compositions are provided for treatment of disorders associated with aberrant adrenal cortex cell behavior, including (but not limited to) treatment of adrenocortical carcinoma (ACC), Cushing's syndrome and/or pituitary ACTH excess (Cushing's Disease). Such methods involve administration of an effective amount N-(2,6-bis(1-methylethyl)phenyl)-N′-((1-(4-(dimethylamino)phenyl)cyclopentyl)-methyl)urea hydrochloride to the patient.
US09446002B2
The invention relates to a directly-compressible gastro-resistant spheroid. The spheroid comprises: (i) a core containing one or more active substances; (ii) a flexible, deformable film which directly coats the aforementioned core and which comprises an enteric polymer and a mixture of saturated and/or unsaturated polyglycosylated glycerides, the fatty acids of which include at least 8 carbon atoms; and (iii) an outer water-dispersible layer containing at least one disintegrating agent. The invention further relates to multiparticular tablets comprising said spheroids.
US09446001B2
Methods are provided for promoting the adsorption of an active agent to microparticles by modifying the structural properties of the active agent in order to facilitate favorable association to the microparticle.
US09445992B2
Compositions and methods are provided for mucosal delivery of peptides. The compositions include a stably hydrated peptide active agent complexed with a crown compound and/or a counter ion solubilized in a non-aqueous hydrophobic vehicle at a pH different from the pI of the peptide active agent. The methods include administering to a subject an effective amount of a composition of the disclosure. Other aspects include methods for the manufacture of the compositions of the disclosure. Also provided are compositions and kits that find use in practicing embodiments of the disclosure. The methods and compositions find use in a variety of applications, including the treatment of a variety of different disease conditions.
US09445989B2
A topical wound treatment composition comprises a hydrogen peroxide generator; alkaline powder; not more than 5 percent by weight of water; additional topical active agent if desired, and emollient (preferably hygroscopic emollient) to balance. When topically applied to a wound and water from the surrounding environment diffuses into the composition, the hydrogen peroxide generator and/or the alkaline compound diffuse into one another, causing a chemical reaction that generates treatment-effective amounts of oxygen to occur. The oxygen can then diffuse out of the composition and aid in wound treatment or healing.
US09445986B2
The invention relates to a cosmetic composition comprising, in a cosmetically acceptable medium, a compound that can be obtained by reaction between an OH-functionalized or COOH-functionalized wax and a junction group capable of establishing hydrogen bonds with one or more partner junction groups, said junction group comprising at least one unit of formula (I) or (II): The invention also relates to a cosmetic treatment process using said compounds.
US09445982B2
A cosmetic water-based ink containing at least one acryl-based polymer, at least one polymeric ionic thickener, at least one anionic or amphoteric-ionic surfactant, at least one material in particle form and at least one non-ionic surfactant, wherein the non-ionic surfactant is a compound which contains between 4 and 8 units of PEG or PPG and a C6-C20 fatty acid residue.
US09445981B2
Methods for preventing, ameliorating, or reducing dermatological signs of aging are provided which employ a composition comprising an effective amount of N-Acetyl-Tyrosinamide and an effective amount of a retinoid, in a cosmetically acceptable vehicle, for topical application to the skin for a time sufficient to improve the appearance of said skin.
US09445977B2
A cosmetic agent (A) is applied to the fibers and allowed to act for a time period from 30 seconds to 30 minutes. Then a cosmetic agent (B) is applied to the keratinic fibers still being acted upon by agent (A), and both agents (A) and (B) are allowed to act for a time period from 5 to 45 minutes, whereupon agents (A) and (B) are rinsed out. Agent (A) (a1) contains one or more oxidation dye precursors of the developer type, (a2) contains one or more oxidation dye precursors of the coupler type, (a3) has a pH from 8.0 to 12.0, and agent (B) (b1) contains one or more oxidation dye precursors, (b2) contains one or more oxidizing agents, and (b3) has a pH from 8.0 to 12.0.
US09445973B2
A dental filling composition includes zirconia powder, a hydraulic inorganic binding agent, a slightly acidic hardening controller agent and a pozzolan component with respect to the gross weight of the composition. The dental filling composition includes 45% to 85% of zirconia powder with respect to the gross weight of the composition, and includes a minimum quantity of inorganic binding agent, thus exhibiting excellent radio opacity and hardly comprising heavy metals. Therefore, the dental filling composition of the present invention is excellent in biocompatibility, and therefore, can be safely and widely used in various dental filling operations.
US09445969B2
Aspects of the present invention relate to systems, methods and apparatus for converting a container into a smart bottle. According to a first aspect of the present invention, a smart-bottle apparatus may comprise a container portion comprising a plurality of individually addressable sensor pairs covering the wall of the container portion. According to a second aspect of the present invention, a smart-bottle apparatus may comprise a container portion comprising a plurality of individually addressable sensor pairs covering a neck portion of the container portion.
US09445968B1
A system for aiding the crawling mobility of children or young adults is disclosed. The system consists of central hub supported by four legs. The patient is enclosed in a harness which is coupled to a support cord extending through the central hub. A lifting force partially offsetting the patient's weight is supplied by tension on the support cord, which is locked relative to the central hub via a locking device. Coupling between the support cord and harness is provided by carabineers which are clipped to “D” rings on the harness. The balance point can be adjusted by moving the attachment point to various “D” ring locations.
US09445959B2
A two-wheeled self-balancing wheelchair is provided, including: a housing having support brackets which are mounted directly below rotary shafts of the motors located at both sides of the bottom side of the housing, rotary shafts of the motors which are drawn out from the housing, and wheels which are mounted to the rotary shafts and rotate in a way as to read an inclination angle of a rider's body; a saddle frame which is mounted on the upper part of the housing; and multipoint supports mounted at the front and rear of the support brackets, each of the multipoint supports having a first hinge part and a second hinge part which are formed at the front ends of the multipoint support to be able to rotate by bolts and are connected with each other through a connection bar and a third hinge part.
US09445951B2
An absorbent article, such as a diaper, pant diaper, incontinence garment, incontinence insert, bed protecting sheet or the like intended to absorb and retain body exudates which may include low viscosity fecal materials. The article has an absorbent core (5) and a cover enclosing the absorbent core, the cover having a liquid pervious inner cover (6) on the body facing side of the absorbent core and a liquid impervious cover (7) on the garment facing side of the absorbent core, wherein the inner cover (6) in at least a fecal receiving area has parts of the rear and crotch portions (3, 4) of the article has a three-dimensionally structured hydrophilic fibrous web material (12) having on the body facing surface a plurality of alternating recessed (13) and elevated portions (14), wherein the recessed as well as the elevated portions are hydrophilic.
US09445948B2
In wound therapy, a combination of negative pressure therapy and subsequent therapy in a preferably moist or moist-wet medium without use of negative pressure reduces costs and improves therapeutic results. Thus, the present invention involves a method for treatment of a wound by therapy having a first segment, in which negative pressure wound therapy is performed, and a subsequent, second segment, in which wound therapy is conducted using a wound dressing without creating a negative pressure. The wound dressing for the second segment has an absorbent body with a superabsorbent polymer. The invention also relates to a device for conducting negative pressure wound therapy and a wound dressing for use in such method, and further to a kit including such a device and wound dressing.
US09445946B2
A laser eye surgery system includes a laser source, a ranging subsystem, an integrated optical subsystem, and a patient interface assembly. The laser source produces a treatment beam that includes a plurality of laser pulses. The ranging subsystem produces a source beam used to locate one or more structures of an eye. The ranging subsystem includes an optical coherence tomography (OCT) pickoff assembly that includes a first optical wedge and a second optical wedge separated from the first optical wedge. The OCT pickoff assembly is configured to divide an OCT source beam into a sample beam and a reference beam. The integrated optical subsystem is used to scan the treatment beam and the sample beam. The patient interface assembly couples the eye with the integrated optical subsystem so as to constrain the eye relative to the integrated optical subsystem.
US09445945B2
A steerable laser probe may include a handle having a handle distal end and a handle proximal end, an actuation control of the handle, a flexible housing tube having a flexible housing tube distal end and a flexible housing tube proximal end, an optic fiber disposed within an inner portion of the handle and the flexible housing tube, and a cable disposed within the flexible housing tube and the actuation control. A rotation of the actuation control may be configured to gradually curve the flexible housing tube and the optic fiber. A rotation of the actuation control may be configured to gradually straighten the flexible housing tube and the optic fiber.
US09445941B2
A bioresorbable drug eluting intravitreal implant system includes a syringe with a chamber containing a medicinal drug. A balloon is releasably secured to a needle where the needle has a central section chamber in fluid communication with a chamber in the syringe. The needle central section has an opening formed through a wall for transporting the medicinal drug to the interior of the balloon subsequent to insertion of the needle through the sclera of a patient's eye.
US09445935B2
The present invention relates to a layered soft palate support and an implantation method for treating sleep apnea/hypopnea syndrome or snoring. The layered soft palate support is a flat implant made of a material capable of being implanted into a human body for a long term, and includes a hard palate connecting end and a support. The support is a layered structure formed by stacking two or more layers of supporting plates and capable of being inserted into a soft palate, and is removably or irremovably fixed to the hard palate connecting end. The hard palate connecting end has a connecting structure connected with a hard palate, and is fixed to the hard palate through the connecting structure. The support is implanted into a muscular layer of the soft palate, and is inserted into the soft palate by a length equal to ⅕ to ⅘ of its total length.
US09445915B2
The present invention relates to an intervertebral disc prosthesis preferably comprising at least three pieces including an upper plate (1), a lower plate (2) and a mobile core (3) at least in relation to the lower plate (2), co-operation means (23, 33) allowing to limit or eliminate the movements of the core (3) in relation to the lower plate (2), in translation and in rotation, respectively, about an axis substantially parallel to the lower plate (2) and about an axis substantially perpendicular to the lower plate (2), at least one part of the surface of at least one plate being concave and complementary with a convex surface (30) of the core (3), with which it is in contact, wherein the tip (31) of the convex surface (30) of the core (3) is off center, in at least one direction, in relation to the center (32) of this convex surface (30).
US09445914B2
A prosthetic intervertebral spacer is disclosed. The spacer preferably includes a body and an interface extending away from the body for use during implantation of the spacer. Methods of implanting the spacer and tools used during such procedure are also disclosed.
US09445913B2
Arcuate fixation members with varying configurations and/or features are provided, along with additional components for use therewith in provided intervertebral implants. The arcuate fixation members may be of different lengths, cross sectional geometries, and/or cross sectional areas. Applications of intervertebral implants utilizing arcuate fixation members are particularly suitable when a linear line-of-approach for delivering fixation members is undesirable.
US09445912B2
A prosthesis for primary artrodhesis can be used for artroplasty and a prosthesis for artroplasty comprises members for artrodhesis. The prosthesis (1b) for primary artrodhesis comprises a locking member (33b) with an attachment portion (16b) which is insertable into a hole (8b) in a first attachment member (4b) of the prosthesis for location of the locking member therein, and a lockable member (34b) integral with a second attachment member (5b) of the prosthesis. The lockable member (34b) is configured for adjustable setting thereof relative to the locking member (33b) and for fixation thereof, in set position, to the locking member. Alternatively, the lockable member comprises an attachment portion which is insertable into a hole in the second attachment member for location of the lockable member therein. At the prosthesis for artroplasty, the hole in the first screw-like attachment member is partly configured to define a press fit with an attachment pin of a socket member and partly threaded to permit, after removal of the socket member, during artrodhesis, securing by screwing in the hole of the locking member for cooperation with a lockable member which is configured for adjustable setting thereof relative to the locking member and for fixation thereof, in set position, to the locking member.
US09445911B2
A humeral prosthesis includes a first body having a first body articulating surface defining a generally circular outer periphery, and a first centerline axis. The first body having a support surface opposite to the first body articulating surface, the first body is hollow and configured to receive a head of the humerus, and a stem extending away from the support surface, the stem defining a second centerline axis which is coincident with the first centerline axis. The prosthesis further includes a second body in the form of a flange which extends laterally from a portion of the circular outer periphery, the first body articulating surface and a surface of the second body defining a boundary portion between them which is generally smooth and continuous, wherein the second body is located superiorly and the surface of the second body which bounds the first body articulating surface is a second articulating surface.
US09445910B2
A method of shoulder replacement surgery is described in which an implant is placed on a surface of a glenohumeral joint while keeping the joint located. The method includes creating a first non-bony passage to the joint, inserting the implant through the passage into the joint, and replacing a surface of the joint with the implant without dislocation of the joint.
US09445907B2
A method for preparing a femoral neck for receiving a neck implant includes resecting a femoral head from a femoral neck of a patient according to a pre-operative patient-specific plan. The method also includes removing only cancellous bone from the femoral neck and proximal femoral bone of the patient using a patient-specific broach. The patient-specific broach has a three-dimensional cutting surface matching as a negative mold a cortical/cancellous bone interface surface of the femoral neck of the patient.
US09445893B2
A device (200) for implantation in or near an annulus of a tricuspid valve comprising at least one blood flow control element (202) adapted to capture a volume of blood therein. Optionally or alternatively, the blood flow control element is adapted to allow at least some volume of blood (406) to regurgitate through the annulus during at least some part of systole. Optionally or alternatively, the device comprises a relatively rigid annulus with an arc length of less than 300 degrees. Optionally or alternatively, the relatively rigid annulus comprises a plurality of tissue fixation elements positioned along no more than 300 degrees of a circumference of the annulus, for example to avoid damaging conduction pathways between an atria and a chamber.
US09445891B2
Provided is an intraocular lens including a lens and a pair of right and left loop-shaped support portions, and a folding-back portion is provided in the front end of each support portion. A sclera tunnel is formed in the circumferential direction at a position of a depth corresponding to the half of the thickness of the sclera in two symmetrical positions with respect to the visual axis in a portion adjacent to a limbus of the sclera. The front end of the support portion is extracted from the ciliary sulcus and is inserted into the sclera tunnel, so that the intraocular lens is fixed into the eye. Furthermore, at that time, the folding-back portion is hooked to a certain portion inside the sclera tunnel, so that the support portion is strongly restrained inside the sclera tunnel. As a result, the intraocular lens is more reliably fixed.
US09445885B2
The bending flexibility profile of a stent closely matches the flexibilities of the stent delivery system on either side of the stent. In one embodiment, a stent has a longitudinal axis and at least one link attaching each ring to an adjacent ring. The links closest to the stent end rings have the greatest bending flexibility and the links closest to the center of the stent have the least bending flexibility.
US09445881B2
Described are devices, implants, kits, and related methods for treating pelvic conditions such as urinary in incontinence, in a male or a female patient.
US09445878B2
A method of cleaning teeth by providing a device for generating a chemical agent in situ on an as-needed basis via the application of an electrical potential across a pair of conductors in communication with an electrolyte. The chemical agents may include ozone, hydrogen peroxide, peroxide, chlorine and/or hypochlorite. The device may include a voltage source and a first set of electrodes for applying an electrical potential to the electrolyte. The device may also include a second set of electrodes disposed about an anode of the first set of electrodes. The first and second sets of anodes cooperate to produce ions, peroxides, ozone and/or other chemical agents via the application of electrical potential to the electrolyte.
US09445876B2
A surgical control system is provided including a glove having a plurality of sensory elements disposed therein, the plurality of sensory elements configured to provide sensory signals and at least one surgical instrument configured to be responsive to the sensory signals when the glove is within a functional range of the at least one surgical instrument. The plurality of sensory elements are magnetic elements or conductive elements. At least one surgical instrument includes a plurality of sensors positioned therein for sensing the magnetic elements or the conductive elements of the glove. Movement of the glove having the plurality of magnetic or conductive elements disposed therein, relative to the at least one surgical instrument, causes the plurality of sensors positioned within the at least one surgical instrument to activate at least one operation of the at least one surgical instrument.
US09445869B2
A microwave surgical device with high energy efficiency produces, at an antenna, an asymmetric heating pattern directed towards the side and it comprises: a plain curved portion extending from the distal end of said external conductor; and an inflection point at said distal end of the external conductor, so that said curved portion has a single cavity directed towards the axis of the coaxial end part.
US09445864B2
Tissue treatment systems include an actuator handle assembly coupled with a clamp assembly having a first jaw mechanism and a second jaw mechanism. A first jaw mechanism includes a first flexible boot, a first flexible ablation member coupled with the first flexible boot, and a first rotatable jawbone disposed within the first flexible boot. A second jaw mechanism comprises a second flexible boot, a second flexible ablation member coupled with the second flexible boot, and a second rotatable jawbone disposed within the second flexible boot.
US09445861B2
Devices and methods for controlling ablation therapy are provided herein. In one embodiment, an ablation device is provided that includes an elongate body having proximal and distal ends, and an inner lumen extending therethrough. The inner lumen can be configured to receive fluid therein and to deliver fluid to the distal end of the elongate body. The device can also include an ablation element positioned at a distal end of the elongate body that is configured to heat surrounding tissue, and a heater element disposed within the inner lumen adjacent to a distal end of thereof, the heater element being configured to heat fluid flowing through the inner lumen.
US09445858B2
A bipolar electrosurgical device is disclosed. The bipolar electrosurgical device includes a handle having a shaft and a distal end. The handle can be coupled to a source of electrical energy and a fluid source. A U-shaped first electrode extends distally in a plane from a pair of openings on the distal end of the shaft. The first electrode is in electrical communication with one of an active pole or a return pole of the source of electrical energy. A longitudinal second electrode extends distally from a middle opening on the distal end of the shaft. The second electrode is coplanar to the first electrode and electrically isolated from the first electrode. The second electrode is in electrical communication with the other of the active pole or the return pole of the source of electrical energy. The second electrode forms a lumen configured to be in fluid communication with the fluid source and a fluid opening for dispersing fluid.
US09445853B2
Some embodiments of the invention include a cannulated bone screw including a screw shaft with screw thread, a proximal end, a distal end, and a channel extending through the screw shaft. Some embodiments include an inlet port coupled to the channel and extending through the distal end, and an outlet port coupled to the channel by a curved or angled channel region. In some embodiments, the outlet port extends through the screw shaft and exits a side that is substantially parallel to the shaft longitudinal axis. In some embodiments, the cannulated bone screw can form part of a therapy delivery device. In some embodiments, the outlet port extends through a portion of the screw shaft and exits at the distal end. In some embodiments, the valve includes a plunger with a plunger rod within the screw shaft, and a valve seat for control of fluid flow out of the screw.
US09445852B2
A system for treating a bone includes an insert for a bone screw or a fixation nail. The insert includes a shaft that extends between proximal and distal ends of the insert and a cap. The shaft includes an opening in the proximal end and a cannulation extending from the opening through at least a portion of the shaft. The shaft further includes a fenestration disposed along the cannulation such that the cannulation is configured to provide a pathway for a substance between the opening and the fenestration. The cap is fastened to and seals the opening in the proximal end of the shaft and adjoins the cannulation. The cap is configured to provide a needle access through the cap to the cannulation following implantation of the system within the bone, and is further configured to self-seal after the needle is removed.
US09445848B2
An implant to separate a vertebral cut has an upper portion, lower portion, and inner member. The inner member communicates with a swivelable coupling located at each end of the inner member. Each swivelable coupling also interacts with a respective one of the upper and lower portion, within an inner bore thereof. Movement of the inner member relative to one or both of the upper and the lower portions, via one or both swivelable couplings, translates the upper portion away from the lower portion, about a vertebral cut, to widen the vertebral cut and expand the spinal canal. Swivelable action of the couplings allows angulation of the inner member, relative to a longitudinal axis of the implant, to accommodate a natural lateral shift occurring during a widening of a vertebral cut.
US09445841B2
A wire tensioner tip for use with a wire fixation bolt. First and second wires may be anchored to and tensioned across an external fixator frame with first and second wire tensioners. The first and second wires may be anchored at first anchor locations with first and second wire fixation bolts. First and second wire tensioner tips may engage with third and fourth wire fixation bolts, thereby preventing the third and fourth wire fixation bolts from rotating. The first and second wires may be tensioned to a desired tension with the first and second wire tensioners at the same time to prevent over-tensioning or under-tensioning. The first and second wires may be anchored at second anchor locations with third and fourth wire fixation bolts. By engaging the wire fixator bolts with the wire tensioning tips, fewer tools are required and one medical professional can tension two wires at once.
US09445818B2
A content inflation and delivery system including a fluid inlet communication with a fluid outlet; wherein the fluid outlet is positioned between the fluid inlet and a second end of the container. The system also includes an inflatable content being configured for inflation and delivery from the second end of the container.
US09445815B2
The invention relates to an intraluminar method of treating a reflux disease in a patient by implanting a device comprising an movement restriction device that, when implanted in a patient, fills a volume in the patient's abdomen that is close to and at least partially above the patient's cardia when the patient is in a standing position. The invention further relates to a method of restoring the location of the cardia in a patient suffering from a reflux disease and to an instrument suitable to use with intraluminar method and/or restoration method. Also disclosed are instruments treating a patient suffering hiatal hernia and providing a movement restriction device to be invaginated in the stomach fundus wall.
US09445813B2
A surgical instrument system can comprise a surgical instrument and an end effector, wherein the end effector can comprise a distal end, a proximal connection portion configured to attach the end effector to the surgical instrument, a first jaw, and a second jaw movable relative to the first jaw, wherein the second jaw is movable between an open orientation, a partially-closed orientation, and a closed orientation. The end effector can further comprise at least one sensor configured to detect the orientation of the second jaw and an array of indicators configured to simulate the orientation of the second jaw.
US09445790B2
An insertion device for taking samples within a body. The insertion device includes a trigger housing, an outer sheath assembly, a sampling device, and a resilient member. The trigger housing includes an interior channel in which the resilient member is disposed to urge the outer sheath assembly away from a proximal end of the trigger housing. The outer sheath assembly is disposed within the interior channel of the trigger housing. The outer sheath assembly includes a body and an outer sheath attached to a distal end of the body. The sampling device is removably disposed within the outer sheath assembly and the trigger housing. The sampling device may be a removable biopsy needle assembly which is used to cock the insertion device. The removable biopsy needle assembly may be removed from the insertion device and be replaced by a needle assembly for fine needle aspiration.
US09445789B2
A method is provided for cutting a tissue sample into sections. A blade having a first reference line is provided that extends from an attachment point of the blade to a rotation mechanism to an outermost point of the blade. Also provided is the rotation mechanism having a second reference line that extends from an axis point of the rotation mechanism to the attachment point. Further, a tissue sample is provided that remains stationary for at least a portion of a cutting process by way of a holding mechanism. By way of the rotation mechanism, the blade is caused to rotate such that a first rotation of the blade causes a first cut of the tissue sample that produces a first tissue section.
US09445779B2
An infrasonic stethoscope for monitoring physiological processes of a patient includes a microphone capable of detecting acoustic signals in the audible frequency bandwidth and in the infrasonic bandwidth (0.03 to 1000 Hertz), a body coupler attached to the body at a first opening in the microphone, a flexible tube attached to the body at a second opening in the microphone, and an earpiece attached to the flexible tube. The body coupler is capable of engagement with a patient to transmit sounds from the person, to the microphone and then to the earpiece.
US09445778B2
In a diagnostic imaging system (10), a monitor (50) monitors periodic biological cycles of the subject (14). A trigger point detector (60) detects a time (t1, t2, . . . , tn) of a common, reoccurring reference point (R1, R2, . . . , Rn) in each periodic cycle of the subject (14). A sequence selector (62) selects a sequence (64) of nominal sampling segments (Si, S2, . . . , Sn). An adjustor (70) adjusts duration of each nominal sampling segment (Si, S2, . . . , Sn) to coincide with the times of detected reference points (R1, R2, . . . , Rn). A scaling processor (72) scales each adjusted segment based on a difference in duration between the corresponding nominal (Si, S2, . . . , Sn) and adjusted sampling segments (S′i, S′2, . . . , S′n).
US09445776B2
Disclosed are an X-ray imaging apparatus that captures one or more images of an inner part of the human body or the like, and a method for controlling the apparatus. In particular, an imaging system includes an X-ray generator which is configured to irradiate a target object with X-rays, a detector which is configured to detect X-rays which are emitted at a plurality of times and which have propagated through the target object, a driver which is configured to change a position of the X-ray generator or the detector, an image processor which is configured to generate a plurality of X-ray images from the detected X-rays and to compare the plurality of X-ray images in order to generate at least one difference image, and a controller which is configured to detect tissues which constitute the target object based on the at least one difference image.
US09445773B2
Included are a storage unit for storing as first medical image information a three-dimensional image representing information about an inside of the subject; an image processor for generating a display image on the basis of the first medical image information and second medical image information; and a display for displaying the display image generated by the image processor. The image processor includes: a catheter position information detector for calculating a position of the balloon catheter C and detecting position information; and a balloon pressure-contact degree calculator for calculating a pressure-contact degree A of the tissues of the subject and a balloon b on the basis of the first medical image information and the position information.
US09445771B2
An apparatus aids operation of an interventional x-ray imager during image acquisition, where the X-ray imager is configured to vary X-ray dosages depending on differences in X-ray attenuation levels across an object of interest to be imaged. The X-ray imager is further configured to assume any one of a plurality of imaging geometry positions when acquiring an image. An indication, visual, acoustic or haptic, to the operator of the X-ray imager is provided on the incurred change in X-ray dosage when changing from a current projection view to an updated projection view, while a given constant image quality is maintained throughout the different views.
US09445766B1
The present invention relates to methods for differentiating a blood vessel from a nonvascular tissue during a minimally invasive surgery using a device. A device may be any penetration sensor device, such as a dilator sensor device, a hollow needle sensor device, or a trocar sensor device, which penetrates the skin and subcutaneous layers to reach a target location inside the body. The penetration sensor device includes a sensor probe which can make optical measurements to determine various parameters of the tissue at the tip of the sensor probe. These parameters may include an optical signal level returned from tissue contacting the tip of the sensor probe, an oxygen saturation level of the tissue, a total hemoglobin concentration, a blood flow, and a pulse. Based on these parameters, the presence or absence of a blood vessel at the tip of the penetration sensor device can be determined while the device travels towards the target location for surgery.
US09445765B2
The invention provides a system for evaluating a patient featuring: 1) an ECG-measuring system connected to the patient and configured to sense ECG information from the patient; 2) a data-acquisition system interfaced to a vital sign-monitoring system configured to sense vital sign information from the patient during an electro-physiology (EP) procedure; and 3) an external software system interfaced to both systems. The external software system includes a first software interface that receives ECG information measured from the patient by the ECG-measuring system, and a second software interface that receives vital sign and EP-related information from the data-acquisition system measured from the patient during an EP procedure. A database stores physiological and EP-related information measured from the patient before, during, and after the EP procedure. And an algorithm interfaced with the database determines an efficacy of the EP procedure by collectively analyzing information measured during each of these phases.
US09445756B2
An integrated lancing test strip includes a test strip and a lancet packet coupled to the test strip. The lancet packet includes a sterility sheet enclosing a lancet to maintain the sterility of the lancet and prevent cross-contamination between the test strip and the lancet. The sterility sheet allows the lancet to be sterilized separately from the test strip. The sterility sheet gives the integrated strip a low profile, which is attractive for packaging multiple integrated strips in cassettes, drums, magazines or the like. In one form, the integrated strip is loaded in a meter that includes an adjustment mechanism that adjusts the position of the test strip relative to the skin being sampled. This allows the user to adjust the position of the test strip so as to not apply excessive pressure against skin, which could hamper bleeding from the incision in the skin.
US09445751B2
Methods and devices for monitoring the position of a subject are disclosed. One such method includes sensing pressure waves generated by the subject moving on a divided bladder comprising interleaved portions, generating signals indicative of the pressure waves for each of the interleaved portions, and sending the signals to a processor. The method further includes determining the position of the subject based on the difference between the signals from each of the interleaved portions and generating a pattern for the subject. The pattern includes the presence and/or position of the subject over time. The method further includes predicting an action such as an exit of the subject from the divided bladder based on comparing a current pattern for the subject to previous patterns for the subject.
US09445744B2
Devices, systems, and methods for spine centrum extraction and intervertebral disk dividing are disclosed.
US09445742B2
A device is described for measuring electrical characteristics of biological tissues with plurality of electrodes and a processor controlling the stimulation and measurement in order to detect the presence of abnormal tissue masses in organs. Examples of suitable organs are the breast, skin, oral cavity, lung, liver, colon, rectum, cervix, and prostate and determine probability of tumors containing malignant cancer cells being present in tissue. The approach can also be applied to biopsied tissue samples. The device has the capability of providing the location of the abnormality. The method for measuring electrical characteristics includes placing electrodes and applying a voltage waveform in conjunction with a current detector. A mathematical analysis method is then applied to the collected data, which computes spectrum of frequencies and correlates magnitudes and phases with given algebraic conditions to determine mass presence and type.
US09445737B2
A method includes storing baseline data representing at least one local or global electrical characteristics for at least a portion of a region of interest (ROI) of a patient's anatomical structure. The baseline data is determined based on electrical measurement data obtained during at least one first measurement interval. The method also includes storing in memory other data representing the at least one local or global electrical characteristics for the at least a portion of the ROI based on electrical measurement data obtained during at least one subsequent measurement interval. The method also includes evaluating the baseline data relative to the other data to determine a change in the at least one local or global electrical characteristics. The method also includes generating an output based on the evaluating to provide an indication of progress or success associated with the applying the treatment.
US09445734B2
An adapter for an endovascular device and a catheter steering device are provided. The adapter for an endovascular device includes a body, a conductive metal ring and a conductive wire. The body includes a first open end, a second open end, a central lumen having a substantially cylindrical surface extending from the first open end to the second open end, and a channel extending from the central lumen to an external opening. The conductive metal ring is attached to the surface of the central lumen, and the conductive wire is coupled to the conductive metal ring and extends through the channel and the external opening. The steering device for a catheter that has a plurality of lumens with spaced distal openings includes a stylet for disposition within one of the plurality of lumens, and a steering member for disposition within a different one of the plurality of lumens. In the installed position, the stylet and the steering member are connected together at respective distal ends such that a portion of the steering member is disposed outside of the distal end of the catheter.
US09445730B2
Systems and methods of monitoring a subject's neurological condition are provided. In some embodiments, the method includes the steps of analyzing a physiological signal (such as an EEG) from a subject to determine if the subject is in a contra-ictal condition; and if the subject is in a contra-ictal condition, providing an indication (e.g., to the subject and/or to a caregiver) that the subject is in the contra-ictal condition. The systems and methods may utilize a minimally invasive, leadless device to monitor the subject's condition. In some embodiments, if the subject is in a pro-ictal condition, the method includes the step of providing an indication (such as a red light) that the subject is in the pro-ictal condition.
US09445728B2
A device can include a vibration sensor configured to sense blood flow in a lumen of a person; a cuff coupled to the vibration sensor and configured to contact a limb of the person; a mechanical cuff tensioner coupled to the cuff, the mechanical cuff tensioner configured to adjust a compressive force of the cuff on the lumen; a tension sensor operably coupled to the mechanical cuff tensioner, the tension sensor configured to measure a first tension value of the cuff during a first sense by the vibration sensor and to measure a second tension value of the cuff during a second sense by the vibration sensor; and a recorder mechanism configured to record the first tension value, the first measurement by the vibration sensor, the second tension value, and the second measurement by the vibration sensor.
US09445718B2
An optical system for measuring an observed object includes an illuminant component, an imaging component, and an optical component. The illuminant component generates a measuring light. The optical component including a mirror and a beam splitter is located between the illuminant component and the imaging component. The mirror is located between the illuminant component and the observed object, the beam splitter is located between the mirror, the observed object, and the imaging component. The measuring light is projected to the observed object via the mirror and beam splitter, and an imaging light that has been generated from the illuminant component and reflected by the observed object is projected to the imaging component via the beam splitter, the imaging light and the measuring light intersect at the beam splitter. The present invention also provides a measurement method.
US09445715B2
A macular health measurement and storage system comprises a plurality of macular-pigment measurement machine for measuring macular pigment density in humans, a plurality of computers each of which is associated with a corresponding one the macular-pigment measuring machines, and a central host. The plurality of macular-pigment measurement machines include a device for receiving macular pigment data from a patient, at least one data transfer port, and at least one processor that enables the transfer of the macular pigment data from the transfer port. The plurality of computers include a first port coupled to the data transfer port of the corresponding macular-pigment measurement machine for receiving the macular pigment data. Each of the computers includes a second port for transferring patient data. The central host is coupled to the second ports on each of the plurality of computers. The central host includes a storage device for storing the patient data.
US09445704B2
A method of determining the number of doses and the types of a treating chemistry available in the bulk dispensing system, and providing an indication of the determination on a user interface.
US09445701B2
A cleaner and a vertical cleaner are provided. The cleaner includes: a body having a connecting tube; a brush holder, with a rolling brush mounted therein; a motor cover rotatably mounted onto the brush holder around a first axis, defining an accommodating space therein, and having an opening, the connecting tube being configured to connect to the opening rotatably around a second axis different from the first axis; a motor disposed in the accommodating space for driving the rolling brush to rotate relative to the brush holder around a third axis parallel to the first axis.
US09445700B2
A glass-wiping robot comprising a glass-wiping robot housing (1), a power cord (2) extending outward through the housing (1), a protruding mechanism (3) provided on the housing (1) and protruding from the surface thereof, and a power cord positioning sheath (4) provided on the housing (1), where the power cord (2) passes through a central through-hole of the power cord positioning sheath (4) and is fixed. By providing the power cord positioning sheath (4), the glass-wiping robot ensures that the power cord (2) does not interfere with other parts on the surface of the machine body of the glass-wiping robot, prevents the power cord (2) from hanging downward and winding when the glass-wiping robot is working, provides a simplified structure, and greatly improves the operational safety of the glass-wiping robot.
US09445697B2
A toilet lid or seat for use with a toilet includes first and second metallic layers bonded together along an edge to form a shell having a shape and size associated with the toilet lid or seat, the shell having an interior volume. The toilet lid or seat also includes a core structural layer disposed within the interior volume of the shell. The toilet lid or seat further includes a plurality of exterior layers disposed on exterior surfaces of the shell, the exterior layers configured to envelop the toilet lid or seat.
US09445693B2
This application includes embodiments of apparatuses (e.g., bath benches) for improving accessibility to a bathtub. Some embodiments include a bath bench with a primary deck and a folding lateral transfer extension (secondary deck). The secondary deck may be coupled to the primary deck by a dual-axis hinge.
US09445691B1
The present invention relates to eating utensils, such as spoons, forks and knifes that include a riser configured to elevate the distal end of the utensil when the utensil is placed in an upright or inverted position on a planar surface to avoid contamination. The riser includes a riser member having a lower curvature end integrally formed with a handle and an upper curvature end integrally formed with the working end of a spoon, fork or knife A plurality of eating utensils can be stacked one on top of the other for storage or packaging.
US09445687B2
Brewing or preparation chamber (1) which is intended for a beverage-making machine and is suitable for accommodating, and extracting the contents from, a portion capsule (27, 29) which is filled with pulverulent or liquid basic beverage substances and consists fully or partially of electrically conductive material, and the brewing or preparation chamber (1) consists of a first, fixed-location chamber part (2), which is provided with opening means (25) for opening the portion capsule (27, 29) in relation to the beverage outlet and is connected in a fluid-channelling manner to a structure (6, 7, 8) for the outflow of the beverage, and of a second chamber part (3), which can be moved vertically or horizontally in relation to the first chamber part (2), is connected in a fluid-channelling manner, for the purpose of supplying the portion capsule (27, 29) with the extraction liquid, to an extraction-liquid-feeding extraction-liquid pump (37) and is provided with piercing means (11, 12) for opening the portion capsule (27, 29) and for channelling the extraction liquid into the portion capsule (27, 29), wherein the brewing or preparation chamber (1) is opened for the purpose of accommodating a portion capsule (27, 29) and is closed for the purpose of extracting the contents from the portion capsule (27, 29), characterized in that the first chamber part (2) or the second chamber part (3) contains, or the first chamber part (2) and the second chamber part (3) contain, electrically conductive contacts (13, 16, 19, 22) which are electrically insulated from one another and are the ends of an interrupted control circuit (30) of a checking and control device (34).
US09445678B2
A removal safeguard for a knife block, into which at least one knife having a blade can be inserted, includes a cover part, which has at least one recess, and a template, having at least one cut-out, mounted slidably with respect to the cover part, wherein in a first position the recess and the cut-out are aligned to one another in such a manner that a passage of the blade is possible, and in a second position the passage of the blade is blocked.
US09445675B1
A modular apparatus is erected from a kit of component parts to provide for displaying and dispensing selected merchandise at a point-of-purchase placed at a selected site. The merchandise is in the form of packages of selected dimensions to be arranged serially along the apparatus. The kit facilitates transport to the site and erection of the apparatus on-site to accommodate the packages of selected width. Adjustment of the apparatus to the dimensions of the packages is accomplished during erection of the apparatus at the selected site by movement of wall members of the apparatus into guiding juxtaposition with the packages. Rack and pawl arrangements integral with the wall members enable ease of assembly while attaining and maintaining accurate on-site adjustment.
US09445672B2
A portable seat cover device facilitates carrying of a seat cover to position over public chairs. The device includes a cover having a front face, a back face, and a perimeter edge extending around and between the front face and the back face. A bag is coupled to and extends from the perimeter edge of the cover. The bag has a peripheral edge defining an opening into an interior space of the bag. The cover is selectively positionable to occupy the interior space of the bag. A flap is coupled to the peripheral edge of the bag and is selectively extendable over the opening of the bag. A resilient member is coupled to the flap extending around a free edge of the flap. The resilient member engages the cover and the bag inhibiting the cover from coming out of the interior space of the bag.
US09445670B1
A storage rack may include a plurality of sections for holding a respective plurality of items. A first section may include, for example, a first vertical support, a second vertical support substantially parallel to the first vertical support, and a first set of horizontal supports substantially perpendicular to the first vertical support and the second vertical support. The first set of horizontal supports may include a first horizontal support disposed at a first height and a first depth in the first vertical support, and a second horizontal support disposed at the first height and the first depth in the second vertical support. The first horizontal support may extend from an inner wall of the first vertical support towards the second vertical support for a distance that is less than half of the distance between the first vertical support and the second vertical support.
US09445667B2
An adjustable shelving system includes a base member having opposed first and second sides. A plurality of first shelf assemblies are coupled to the first side of the base member, each first shelf assembly being movable between a first rearward configuration perpendicular to the base member and a first forward configuration forwardly offset relative to the rearward configuration. A second plurality of shelf assemblies are pivotally coupled to the second side of the base member, each second shelf assembly being movable between a second rearward configuration perpendicular to the base member and a second forward configuration forwardly offset relative to the rearward configuration. Each shelf assembly includes rollers configured to support the weight of the shelf assembly and enhance movement. Each shelf assembly may include a vertically floatable hinge configured to allow the shelf assembly to move up or down according to changes in elevation of a floor surface.
US09445657B2
A wearable reflective device. The wearable reflective device includes a mirror, a base and a strap. The strap is attached to the base for securing the device to a user. The mirror is connected to the base by a pivotal element and a rotational element, wherein the pivotal element is configured to allow the mirror to pivot along a first plane, the rotational element configured to allow the mirror and pivotal element to rotate in a second plane. The first plane is substantially orthogonal to the second plane.
US09445655B2
A portable device cover integrated with a fluid container compartment comprising a chamber for storing a fluid for either medicinal or hydration purposes while reducing the need of additional fluid containers.
US09445652B1
A mechanism for manually rotating decorative items, such as a gemstone, on an item of jewelry. The mechanism includes a circular ring gear that engages gears formed on a manually rotated crown member and on the mounting securing for the decorative items.
US09445648B2
This invention provides a safety spur which provides the rider a warning of a potentially dangerous foot position while riding a horse. The spur has a tilt sensor, a radio transmitter, and a radio receiver. Optionally, a 3 axis gyroscope may be used in place of a tilt sensor.
US09445646B2
An article of footwear is disclosed that includes an upper and a sole structure secured to the upper. The sole structure incorporates a support element that includes a fluid-filled chamber. The chamber may be bonded to other portions of the sole to secure the chamber within the sole. A surface of the chamber may also be angled to form a corresponding bevel in a lower surface of the sole structure, potentially in a rear-lateral area of the sole structure. A plate may also extend under a portion of the chamber.
US09445644B2
An item of footwear has first and second portions that slide with respect to each other to allow the user to easily put the footwear on and take the footwear off. The footwear may be opened and closed without requiring the user to bend over and manipulate closure mechanisms with his hands. The footwear allows a person's foot to be readily inserted and removed from the footwear when the footwear is open while being secured within the footwear when the footwear is closed.
US09445643B2
An article of footwear includes an upper and a sole assembly. The sole assembly includes a first member that is coupled to the upper and a second member that is moveably coupled to the first member. The first member moves relative to the second member in response to a first input load directed along a first vector, and the first member engages the second member in response to a second input load directed along a second vector.
US09445642B2
An insert system for an article of footwear includes an outer assembly, a first insert assembly and a second insert assembly. The outer assembly is configured to interchangeably receive the first insert assembly and the second insert assembly. The first insert assembly includes a first sleeve member and a first midsole configured to provide enhanced cushioning and support. The first sleeve member includes a tongue and a fastening member that wraps around the tongue. The second insert assembly includes a second sleeve member and a second midsole configured to enhance speed. The second sleeve member is open at a forefoot portion and at a heel portion. The outer assembly includes an aperture on a sidewall of an outer sole portion, where the midsole inserted within the outer assembly is visible through the aperture.
US09445640B2
Articles of footwear may have an upper that includes a knit element and a tongue. The knit element defines a portion of an exterior surface and an opposite interior surface of the upper, with the interior surface defining a void for receiving a foot. The tongue is formed of unitary knit construction with the knit element and extends through a throat area of the upper.
US09445639B1
A motorcycle helmet can include one or more internally mounted sensors within the motorcycle helmet. The sensors can be positioned within an embedded electronics layer which can include electronic components. The components can include logic processing components. The layer can be sandwiched between an outer shell of the helmet and an inner shell of the helmet. A software program executing within the logic processing components can receive input from the sensors in real-time. The software can automatically execute a programmatic action in response to receiving the input.
US09445634B2
A reversible bridesmaid dress, evening gown or evening dress with a hem facing that allows the dress to have one color or pattern on one side and another color or pattern on the other side. When the dress is flipped inside out, it has a completely different appearance than on the other side. The reversible dress can come in a variety of different shapes, types and sizes. The long dresses can bubble up to short ones, and dresses of different colors and lengths may be created from a single reversible dress.
US09445632B2
A three dimensional component for a costume, intended to simulate a three-dimensional body part or other object, comprises an inner soft or cushiony layer of foam, an outer fabric layer, a graphic printed upon the outer layer, and a sonic or ultra high frequency welding of the outer layer to the cushiony layer along the lines defined by the graphic. The sonic well will compress the foam to the fabric and the non-compressed foam and fabric sections will visually and physically provide relatively three dimensional areas.
US09445630B1
A pre-packed tobacco insert device facilitates packing and clean up of tobacco smoked using a hookah. The device includes a bowl having a bottom surface and a perimeter wall coupled to and extending upwardly from the bottom surface defining an interior space. A plurality of apertures extends through the bottom surface of the bowl and pre-packed tobacco is positioned within the interior space. A conduit has an upper end in fluid communication with the interior space of the bowl and an open lower end configured for coupling to the input pipe of a hookah. A cover is coupled to an upper edge of the perimeter wall of the bowl. A plurality of holes extends through the cover wherein the cover is configured for providing ambient air flow into the interior space of the bowl when a user inhales through the hookah.
US09445627B2
An apparatus is provided for forming tobacco rod portions of a smoking article. A conveyor unit is configured to receive a continuous stream of the tobacco material and to transport the continuous tobacco material stream along an elongate path for formation of the continuous tobacco material stream into a continuous tobacco rod, wherein the conveyor unit is housed in a conveyor housing. A suction system is in fluid communication with the conveyor housing through a suction port and is configured to apply suction to the conveyor housing via the suction port so as to draw the continuous tobacco stream into engagement with the conveyor unit. A wear resistant member is engaged with a wall of the conveyor housing and defines the suction port, wherein the wear resistant member is configured to resist wear from interaction with particles associated with the tobacco material.
US09445622B2
Disclosed are methods for improving nitrogenous acid (e.g., creatine) solubility, and products made by the method.
US09445615B2
A fresh potato preservative and method of using the preservative for fresh cut potatoes that significantly extend the shelf life of fresh cut potatoes are provided. The fresh potato preservative preserves the texture, flavor, appearance, and color of the fresh potatoes, particularly exposed surfaces of the fresh potatoes that have been cut, in particular by reducing oxidation of the exposed cut surfaces of the potatoes. The preservative includes the ingredients of sodium chloride, citric acid, ascorbic acid, calcium chloride, sodium acid pyrophosphate, potassium sorbate and a protein-based composition.
US09445613B2
The present invention relates to microparticles and methods of making such microparticles that protect a bioactive substance from heat, humidity and oxidation. A microparticle comprising a bioactive substance, an agglomerating agent, an emulsifier and solid fats is disclosed. A method to produce a microparticle comprising an agglomerated bioactive substance enrobed in a double layer of solid fats and emulsifier is also disclosed.
US09445598B2
Composition and method for treating and/or preventing biological contamination using a biocide composition comprising at least one quaternary ammonium compound and urea. The method includes drying urea, and thereafter combining at least one quaternary ammonium compound and urea and may produce a potent biocide composition that is stable and able to chemically treat biological contamination in a variety of difficult to reach locations. Uses of the composition are also described.
US09445596B2
The present invention relates to compounds involved in nematode signaling.
US09445584B2
A clamp assembly for maintaining two rod sections parallel to each other includes a collar encircling a longitudinal axis for receiving a first rod section, and a retainer attached to the collar. The retainer has a first hook and a second hook. The second hook for receiving a second rod section is attached to the collar and the first hook is connected to the second hook. The clamp assembly has an open configuration in which the retainer hinges from the collar, and a closed configuration in which the first hook at least partially surrounds the collar. The collar includes a band for encircling the first rod section. The band has a first circumferential end and an opposing second circumferential end that meet to form a closure.
US09445572B1
A novel maize variety designated X08F093 and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X08F093 with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X08F093 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. This invention relates to the maize variety X08F093, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X08F093. This invention further relates to methods for producing maize varieties derived from maize variety X08F093.
US09445563B1
Disclosed is the seed of a novel soybean cultivar, designated 10CR103121, a sample of which is deposited under ATCC Accession No. PTA-122786. Also disclosed are plants, or parts thereof, grown from the seed of the cultivar, plants having the morphological and physiological characteristics of the 10CR103121 cultivar, and methods of using the plant or parts thereof in a soybean breeding program.
US09445547B2
A blower apparatus having an airflow diverting unit is described. The disclosed blower apparatus comprises a housing containing an airflow-generating means and an airflow discharge tube physically coupled with the housing. The airflow discharge tube has a first terminal end, a second terminal end, and an aperture protruding a portion of a side surface of the airflow discharge tube. The disclosed blower apparatus also comprises an airflow diverting unit attached to an outer surface of the airflow discharge tube.
US09451732B2
The invention discloses the multistage cooling of an aircraft electronic system (2) with at least one electronic component which delivers heat. The multistage feature results from the use of a plurality of circuits for transferring the waste heat. An internal coolant (14) circulating in a closed circuit which is thermally coupled to the electronic component carries heat from the at least one electronic component to a heat exchanger (6) which delivers the heat to an external coolant which flows and/or circulates from a source outside of the aircraft electronic system (2) through the heat exchanger (6) to a sink outside of the aircraft electronic system (2). The internal coolant flows from the heat exchanger (6) in the direction of the at least one electronic component and/or circulates in a closed circuit.
US09451728B2
An explosion protection housing constructed according to an explosion protection requirement having a temperature control system. The temperature control system includes a temperature control device that includes a pipe coil thermally connected to at least one of the walls of the housing. Optionally, temperature control fluid is directed through the pipe coil by means of circulating pump in order to increase or decrease the temperature of the housing, depending upon the explosion protection requirements.
US09451723B2
In some embodiments, a cooling system for an inductive charger includes a thermal conditioning assembly in fluid communication with an inductive charging assembly. The inductive charging assembly can include a dock and an inductive charging module. The dock can be configured to receive a portable electronic device, such as a cell phone, that is configured to accept inductive charging from the inductive charging module. The thermal conditioning assembly can include a fluid transfer device and a thermal conditioning module, such as a thermoelectric device. In various embodiments, heat (e.g., heat produced during inductive charging) can be transferred from the inductive charging assembly to the thermal conditioning module and/or to a fluid flow produced by the fluid transfer device, thereby cooling the inductive charging assembly and/or the portable electronic device.
US09451718B2
Motor control centers have units or bucket assemblies with a front panel configured to pivot about a long axis associated with a bottom long side thereof and slide radially with respect to the shaft, away from the shaft in an open position to thereby position the front panel a distance away from the shaft to be able to fully open to at least ninety degrees.
US09451712B2
An electrical module arrangement for supplying electrical power to a printed circuit board mounted within the housing of an electrical module, including a plug-in electrical connector mounted in an opening contained in an end wall of the module housing. The connector is of the conductive leaf spring S-shaped type, including two reversely-bent portions defining oppositely directed recesses for receiving a bus bar voltage source and a planar contact of the printed circuit board, respectively. In a modification, the leaf spring is W-shaped including three bends, thereby permitting connection of the PCB contact with two separate parallel spaced bus bar arrangements. A plurality of the modules are supported in side-by-side relation either by mounting the module housings on a common mounting rail, or by connecting the plug-in connectors to a common bus bar mounted on a fixed support.
US09451704B2
A plurality of suspension boards and an inspection substrate are integrally supported by a support frame. In each suspension board, a line is formed on a conductive first support substrate via a first insulating layer. The first support substrate and the line are electrically connected by a first via in the first insulating layer. In the inspection substrate, a conductor layer is formed on a conductive second support substrate with a second insulating layer sandwiched therebetween. The second support substrate and the conductor layer are electrically connected by a second via in the second insulating layer. The first via and the second via have the same configuration.
US09451697B2
A printed circuit board, and method of manufacture, for high speed signals. The printed circuit board has small diameter vias of uniform inside diameter when plated. The uniformity of the inside diameter, at least over the region in which a press fit segment is inserted, is sufficient to make a reliable electrical and mechanical connection to the press fit segment with reduced risk of damage to the press fit segment.
US09451688B2
The present invention relates to a pulsed beam particle accelerator which can be used for particle radiation therapy. More particular, a device and method are provided to control the number of particles within a beam pulse. The particle accelerator comprises means for varying the number of particles within each beam pulse of said pulsed ion beam from a minimum value to a maximum value as function of the value of a beam control parameter. For each particle irradiation the required number of particles for each beam pulse is controlled by defining a value for said beam control parameter based on calibration data.
US09451686B2
A hybrid plasma reactor includes a reactor body having a plasma discharge space, a gas inlet, and a gas outlet; a hybrid plasma source including a first hybrid electrode and a second hybrid electrode, which face each other while the reactor body is positioned therebetween and provide a current path having one or more turns, to be inductively and capacitively coupled to plasma formed in the plasma discharge space; and an alternating switching power supply for supplying plasma generation power to the first hybrid electrode and the second hybrid electrode. The hybrid plasma reactor can complexly generate capacitively coupled plasma and inductively coupled plasma, thereby achieving a wide operation area from a low-pressure area to a high-pressure area.
US09451685B2
The purpose of the present invention is to solve the problems of conventional high frequency plasma torches and develop a plasma torch which enables quick quenching of high frequency plasma and which overcomes instability resulting from the quick quenching. To accomplish the abovementioned objective, according to one embodiment of the present invention, disclosed is an electromagnetic wave high frequency hybrid plasma torch. The electromagnetic wave high frequency hybrid plasma torch may comprise: an electromagnetic wave oscillator for oscillating electromagnetic waves; a power supply unit for supplying power to the electromagnetic wave oscillator; an electromagnetic wave transmission line for transmitting the electromagnetic waves generated by the electromagnetic wave oscillator; a first plasma-forming gas supply unit for injecting a plasma-forming gas; an electromagnetic wave discharge pipe for generating plasma by the electromagnetic waves introduced from the electromagnetic wave transmission line and the plasma-forming gas injected by the first plasma-forming gas supply unit; a high frequency discharge pipe for introducing an electromagnetic wave plasma flow from the electromagnetic wave discharge pipe; an induction coil structure which is coaxial with the high frequency discharge pipe and which has an interior with an induction coil inserted therein; a cooling water channel for introducing cooling water around the high frequency discharge pipe and discharging the cooling water; and a second plasma-forming gas supply unit for introducing a plasma-forming gas into the high frequency discharge pipe.
US09451682B2
The invention relates to a dimming light bulb for retrofitting a ceiling or lamp fixture wherever a dimming function can be accessed from the regular light switch.
US09451679B2
An illuminating light communication device comprises a constant current source, a smoothing capacitor connected to an output of the constant current source, a load circuit comprising a light emitting diode and connected to the output of the constant current source, a load change element added to the load circuit and thereby partially changing load characteristic of the load circuit, and a switch element configured to determine whether or not the load change element is added to the load circuit in accordance with a binary optical communication signal.
US09451672B2
A light source includes a control unit that controls currents injected into at least one light emitting region and a light emission spectrum conversion region. The at least one light emitting region includes a first light emitting region and a second light emitting region different from the first light emitting region, light that is emitted from the first light emitting region and passes through the light emission spectrum conversion region is combined with the light that is emitted from the first or second light emitting region and does not pass through the light emission spectrum conversion region. The control unit controls the currents injected into the light emission spectrum conversion region and the first light emitting region so that the current density of the light emission spectrum conversion region is smaller than the current density of the first light emitting region.
US09451671B2
An organic light emitting diode system is sufficiently thin and poser efficient to permit its attachment to different configurations such as pocketbooks, brief bags, suitcases and the like. At least one side of the OLED material can have an attachment mechanism to facilitate attachment to a surface in the area to be lighted. The system may include a portable power source that provides electrical power to actuate the OLED material, causing it to generate light. A switch connected to the battery can control power to the OLED material to switch the light on and off. The switch can be manually operated or automatic. The low power consumption of embodiments of the OLED apparatus also provides for unique applications and uses.
US09451667B2
An optical sensor circuit comprises an optical sensor (DET) designed to provide a sensor signal indicative of a color of light incident on the optical sensor (DET), a clock designed to provide a clocked control signal comprising consecutive high and low states, and a controller unit (CU) connected to the optical sensor (DET) and comprising the clock. The controller unit (CU) is designed to process the sensor signal as a color signal (CTS) in a first mode if the clocked control signal is in a high state, wherein the color signal (CTS) is indicative of a color of light emitted by a light emitting device (LED) to be connected at a control terminal (OUT). The controller unit (CU is further designed to process the sensor signal as an ambient color light signal (aCTS) in a second mode if the clocked control signal is in a low state, wherein the ambient color light signal (aCTS) is indicative of a color of ambient light. The controller unit (CU) is also designed to generate a driving signal (PWM) to drive the light emitting device (LED), wherein the driving signal (PWM) depends on the color and ambient color light signals (CTS, aCTS).
US09451661B2
A linear LED driver includes a voltage supply terminal providing a driving voltage, at least one first transistor, each of which has an input terminal coupled to a respective LED, and a bleeder circuit. When the voltage of the output terminal of each of the at least one first transistor is lower than a first threshold and a power voltage is higher than a second threshold, the bleeder circuit will generate a bleeder current to discharge the voltage supply terminal so as to prevent the LEDs from flickering. The bleeder circuit detects the voltage of the output terminal of each of the at least one first transistor. Therefore, whether the LEDs are lighted up can be confirmed so that the bleeder current can be provided at properly time point.
US09451658B2
An induction heater includes an electrically conductive coil that produces an alternating magnetic field when current is applied to the coil. The magnetic field is used to heat metal containers such as tubular containers. The coil extends about a heating path of travel that extends along the longitudinal axis of the coil. A transport device is provided to move the container through the magnetic field such that the longitudinal axis of the container is generally perpendicular to the longitudinal axis of the coil. This allows for heating the container at the twelve and six o'clock positions. The transport device functions to roll the container along the heating path. In a preferred embodiment, the coil is wrapped about a core with a generally rectangular shape. Ferromagnetic members may optionally be used to further shape the magnetic field. The methods and apparatus may be used for regular or irregularly shaped containers.
US09451648B2
There is provided a communication device including an obtaining unit configured to obtain first state information representing a state of a first wireless communication device regarding a direct connection between devices via wireless communication and second state information representing a state of a second wireless communication device regarding the direct connection, and a control unit configured to establish a connection between the first wireless communication device and the second wireless communication device via the wireless communication on the basis of the first state information and the second state information. At least one of the first state information and the second state information is obtained via near-field communication.
US09451647B2
Techniques for unifying multiple logical networks are provided. For example, a method may include receiving, at a computing device, a communication, wherein the communication indicates a plurality of network devices that are detected by a mobile device, and wherein the plurality of network devices detected by the mobile device are in a network. The method may further include determining that multiple network identifiers are associated with the plurality of network devices. The method may further include determining a common network identifier for use with the plurality of network devices in the network, and transmitting the common network identifier to the plurality of network devices.
US09451636B2
The present invention relates to a wireless communication system, and more specifically, disclosed are a method and an apparatus for accessing a channel in a WLAN system. The method for accessing a channel from a station (STA) in a wireless communication system, according to one embodiment of the present invention, comprises the steps of: receiving from an access point (AP) a first frame including a traffic indication map (TIM) and a restricted access window (RAW) parameter set component; determining a RAW in which channel access of the STA is permitted, on the basis of the RAW parameter set (RPS) component; and transmitting a second frame to the AP from within the RAW that is determined, wherein the RPS component includes at least one RAW indication field, each of the at least one RAW allocation fields further includes information related to transmitting a third frame, which includes information on slot allocation, and wherein the third frame can be received by the STA from the AP at a specific time/location in accordance with the information related to transmitting the third frame.
US09451625B2
According to certain embodiments, methods and systems include providing interference characterization data by a network node to a first wireless device for use in performing interference mitigation. A network node may provide telecommunications services for a first wireless device located associated with the network node. Characteristic data associated with at least one characteristic of an interfering signal associated with a second wireless device may be identified. The at least one characteristic may identify at least one transmission mode associated with the interfering signal. The characteristic data associated with the interfering signal associated with the second wireless device may be transmitted to the first wireless device.
US09451624B2
Methods and apparatus are provided for receiver measurement assisted access point control. A method operable by a Wi-Fi network entity includes signaling at least one trigger indication to at least one station served by the Wi-Fi network entity for interference measurements. The method includes receiving interference measurements taken based on the at least one trigger indication from the at least one station. The method includes tuning transmitter parameters based on the received interference measurements.
US09451622B2
Methods and systems are provided for use with wireless networks having one or more cell in which each cell includes a base station (BS), at least one relay station (RS) and at least one mobile station (MS). The at least one relay station can be used as an intermediate station for providing communication between the BS and MS. Methods are provided for an RS to initially access the network, access of the RS by MSs initially accessing the network, methods of allocating OFDM resources for communicating between the BS, RS and/or MS for example dividing transmission resources into uplink and downlink transmissions, and methods of inserting pilot symbols into transmission resources used by the RS. In some embodiments on the invention, the methods are consistent and/or can be used in conjunction with existing standards such as 802.16e.
US09451612B2
A method and system at a network element for providing a soft airtime share of unlicensed spectrum to at least one transmission point. The method includes receiving, from a plurality of transmission points, sensing results, selecting a group of candidate channels, grouping subsets of transmission points into radio access clusters, receiving, from each radio access cluster, a report, and allocating a soft airtime share to a radio access cluster for a channel at a time. Also, at a transmission point, a method and system for obtaining a soft airtime share of a channel in unlicensed spectrum. The method includes sensing a plurality of channels, providing a report, receiving a message assigning at least one radio access cluster, contending with other radio access clusters to send a beacon, receiving coordination beacons from neighboring clusters, self-scheduling and reporting in accordance with the received coordination beacons, and receiving an airtime share.
US09451609B2
A base station is used for a mobile communication system that supports a dual connectivity. The base station includes a controller configured to establish an RRC connection with a user terminal, and to perform a mobility control in the dual connectivity.
US09451605B2
A method for efficiently transmitting and receiving control information through a Physical Downlink Control Channel (PDCCH) is provided. When a User Equipment (UE) receives control information through a PDCCH, the received control information is set to be decoded in units of search spaces, each having a specific start position in the specific subframe. Here, a modulo operation according to a predetermined first constant value (D) is performed on an input value to calculate a first result value, and a modulo operation according to a predetermined first variable value (C) corresponding to the number of candidate start positions that can be used as the specific start position is performed on the calculated first result value to calculate a second result value and an index position corresponding to the second result value is used as the specific start position. Transmitting control information in this manner enables a plurality of UEs to efficiently receive PDCCHs without collisions.
US09451604B2
Described are methods and devices for enabling D2D communications with signal structures that require minimal changes to the current LTE architecture. In the embodiments described, the eNB grants resources to UEs for D2D communication and either initiates or permits a pair of UEs to establish a D2D link. Certain embodiments are designed to minimize changes to the current LTE control signaling structure by having the control signaling always come from the eNB as in a normal cellular link so that the transmitting UE transmits over a data channel (e.g., PUSCH/PDSCH) that the receiving UE is able to decode.
US09451594B2
The teachings herein disclose methods and apparatuses for automatically binding external identifiers to service provider network identifiers. The external identifiers are allocated by an access network for use by a service provider network in identifying given wireless devices to the access network, where the service provider network is external to the access network. The service provider network identifiers are used to identify those same wireless devices within the service provider network, with respect to one or more services. The binding thus enables the service provider network to trigger communications with a targeted wireless device via the access network, by using the external identifier that is bound to the service provider network identifier of the targeted device, and sending trigger signaling to the access network that identifies the targeted wireless device via the external identifier.
US09451588B2
A scheduling method for multimedia broadcast/multicast service (MBMS) is provided according to the present invention, comprising steps of: configuring service specific information and service scheduling information separately from MBMS service data to form an MCCH control message of an MBMS control channel; and transmitting the MCCH control message and the MBMS service data to a receiving end, wherein the service specific information and the service scheduling information are applied with a single-frequency network combining scheme.
US09451587B2
A radio network node receives a page request from a core network node. The page request indicates to page a wireless communication device. The radio network node determines a next occurrence of a monitoring window during which the wireless communication device will monitor a paging channel associated with the radio network node. If the amount of time until the next occurrence of the monitoring window exceeds an amount of time that the radio network node can store the page request, the radio network node discards the page request and sends a response to the core network node indicating that the page request was discarded; the response includes a paging timer value that indicates when the core network node should repeat the page request.
US09451583B2
A bearer management node maintains specific bearers eligible for restoration of communication services, while removing other bearers.
US09451581B1
A current context of a geographic application executing on a user device is determined. Commercial geographic content is selected for presentation at the user device based at least in part on the determined current context, and the commercial geographic content is provided to the user device via a communication network. A first indication is received, indicating that the commercial geographic content was presented at a first level of detail via a user interface of the user device. In response to the first indication, a first metric is updated. As second indication is received, indicating that the commercial geographic content was presented at a second level of detail via the user interface of the user device in response to user input, where the second level of detail is higher than the first level of detail. A second metric is updated in response to the second indication.
US09451579B2
An embodiment of the present application relates to the technical field of wireless communications, in particular to a positioning information determination method and device, for solving the problem of large positioning result errors in the prior art due to the fact that existing positioning methods cannot acquire the height difference between a UE and a base station. The positioning information determination method provided in the embodiment of the present invention comprises: a base station receives an uplink signal from a UE; and the base station determines the angle of arrival, beam declination angle and timing advance of the UE according to the received uplink signal. By determining the angle of arrival, beam declination angle and timing advance of a UE according to the received uplink signal, the base station determines the height difference between the UE and the base station according to the beam declination angle, thus reducing positioning result error and improving positioning precision.
US09451577B2
There is provided a position information processing device including a base station information storage section which stores base station information including position information, a MAC address, and an auxiliary identifier, and position information acquisition section which acquires, based on a MAC address of a base station and an auxiliary identifier acquired by reception of a radio signal transmitted from the base station, position information of the base station from the base station information stored in the base station information storage section.
US09451559B2
The invention has the object of avoiding congestion while reducing differences between parameters for communication among vehicles. The vehicle-mounted device performing communication by radio signals with predetermined vehicle-mounted devices respectively equipped in a plurality of vehicles includes: a radio unit detecting radio signals to measure congestion level; a processor receiving, from each of the predetermined vehicle-mounted devices, a value of, among parameters relating to communication of the predetermined vehicle-mounted devices, a predetermined parameter for which the degree of contribution to congestion increases with increase in the value of the predetermined parameter; and a controller decreasing, when the congestion level measured by the radio unit exceeds a predetermined threshold value, the value of the predetermined parameter of its own device if the value of the predetermined parameter of its own device is greater than the average of the values of the predetermined parameter received at the processor.
US09451557B2
A base station including: a transmitter configured to transmit a first radio signal to a first mobile station, a receiver configured to receive a second radio signal, a processor configured to detect a second mobile station communicates with a communication device differing from the base station, based on a third radio signal from the second mobile station which is contained in the second radio signal, the first radio signal interfering with a radio communication between the second mobile station and the communication device, and to decrease transmission power of the first radio signal, on detecting the second mobile station or failing to detect the second mobile station over a first given period or longer.
US09451546B2
A base station for managing a cell includes a controller configured to perform an on/off operation to turn a downlink transmission of the cell on and off. The controller performs a process of transmitting a periodic radio signal including a cell-specific reference signal.
US09451542B2
A method for receiving a beacon frame comprises the steps of: receiving a first beacon frame which contains guard interval type information; determining a second beacon frame which is to be received after the first beacon frame on the basis of the guard interval type information; and receiving the second beacon frame, wherein the guard interval type information may be information which is related to a guard interval used when the second beacon frame is transmitted.
US09451541B2
A method and system for wireless communication are disclosed. The method comprises: the master device generates a sequence code through a specific encoder and transmits the sequence code to each slave device continuously within a preset period according to the communication demand, wherein the specific encoder is a feedback shift register constructed by a specific polynomial, of which the coefficients and the order are in correlation with the communication demand while all of the coefficients and initial values are not equal to 0 at the same time; the preset period is greater than or equal to the sum of a sleeping period and a detecting period of the slave device, which constitutes a sleeping-and-waking cycle; the slave device receives a continuous section of the sequence code in the detecting period, decodes the sequence code through a decoder corresponding to the encoder, and performs corresponding operation according to the decoding result.
US09451540B2
Embodiments are provided for supporting network selection for wireless networks and network service providers/operators. The embodiments include procedures that integrate wireless network and service provider/operator selection policies and methods. In an embodiment, the UE obtains a network selection policy from a network, and hence generates a list of candidate wireless networks according to the network selection policy. The UE then selects from the list a wireless network to connect to according to a service provider selection policy. Such procedures improve Access Network Discovery and Selection Function (ANDSF) based wireless local area network (WLAN) selection with service provider selection capability. The procedures also collaborate ANDSF based policy and existing I-WLAN selection, and resolve conflicts between 3GPP WLAN selection and ANDSF policy for WLAN selection.
US09451538B2
Disclosed are a method and an apparatus for active scanning in a wireless LAN. The method for active scanning in a wireless LAN may comprise the steps of: a first station (STA) transmitting a first probe request frame to an access point (AP); and a first STA receiving a probe response frame from the AP, wherein the probe response frame is a response for the probe request frame, and the first probe request frame comprises fast initial link setup (FILS) capability information which can indicate whether the first STA supports FILS.
US09451537B2
Disclosed are a scanning method and scanning apparatus in a wireless LAN. The scanning method in a wireless LAN comprises: a step in which an access point (AP) receives a first probe request frame from a first station (STA); a step in which the AP unicasts a first probe response frame to the first STA as a response to the first probe request frame; a step in which the AP receives a second probe request frame from a second STA for a specific time interval after unicasting the first probe response frame to the first STA; and a step in which the AP broadcasts a second probe response frame as a response to the second probe request frame for a specific time interval. Thus, scanning processes can be quickly performed.
US09451529B2
Upon receiving a routing control message from another communication terminal (B1), a communication terminal (A1) uses a MANET routing control unit (A133) to update and manage route information when a routing domain described in the routing control message matches the routing domain of the communication terminal (A1) itself. When the communication terminal itself does not belong to the routing domain, the communication terminal uses a DTN routing control unit (A132) to update and manage route information to another routing domain, and uses a route information advertisement unit (A134) to advertise the route information to another routing domain and the routing domain to which the communication terminal (A1) itself belongs, for another communication terminal (B1).
US09451522B2
The present application relates to methods and devices for handling a link in a cellular network environment. A method for handling a link between a network and a mobile terminal is provided. The network comprises a first base station serving the terminal and a second base station. The method comprises the steps: determining a mobility of the terminal; determining location information of the second base station; on the basis of the determined mobility and the location information, selecting a procedure to handle the link; and initiating to perform the selected procedure. One aim is to improve the quality of the link. A corresponding apparatus is also provided.
US09451516B2
The method for data transmission includes: updating, when a first air interface is unavailable, connection context information corresponding to service(s) of a user equipment on the first air interface, wherein the user equipment is connected to a core network through a first access network via the first air interface; sending a first message to the user equipment, wherein the first message carries updating information related to the updated connection context information; and performing data transmission with the user equipment according to the updated connection context information. This technical solution helps preventing services corresponding to data transmission performed via the first air interface from being interrupted when the first air interface is unavailable.
US09451515B2
A user equipment (UE) located in an extended-range area of a neighbor base station cell in a communication network, such as a low-power cell in a heterogeneous network, can inform its serving base station, such as a macro cell overlying the low-power cell, of the UE's capability of canceling interference from other cells' transmissions. That capability information enables the serving cell to decide based on more information whether range extension of the neighbor cell is beneficial for a number of UEs, and can result in more efficient radio resource utilization.
US09451511B2
A user device determines a set of connection information at a current location of the device. The current connection information set includes one or more of current location information, current wireless channel information, current radio access technology information, and a current wireless channel quality metric. The device adds the current connection information set to a database of connection information that stores a plurality of sets of alternate connection information. Each alternate connection information set includes one or more of alternate location information, alternate wireless channel information, alternate radio access technology information, and an alternate wireless channel quality metric. The device determines whether to output through a user interface of the device, an indication of an alternate location from the database of connection information based on the current connection information set and at least one of the alternate connection information sets.
US09451502B2
Embodiments of the present invention disclose a service control method and system, an evolved NodeB, and a packet data network gateway, to perform resource scheduling on a packet. The method provided in an embodiment of the present invention includes: receiving, by an evolved NodeB, a packet; determining, by the evolved NodeB, a service control policy corresponding to the packet according to correspondence between a service application type and a service control policy and a service application type corresponding to the packet; and performing, by the evolved NodeB, resource scheduling on the packet according to the service control policy corresponding to the packet. Embodiments of the present invention further include a service control system, an evolved NodeB, and a packet data network gateway.
US09451501B2
A wireless access node and method for performing signaling aggregation for a plurality of User Equipment devices (UEs) through a hub UE are provided. The wireless access node in one example includes a communication transceiver configured to allocate traffic channels and signaling channels between the wireless access node and the plurality of UEs and a processing system configured to determine whether a signaling load exceeds a predetermined signaling load threshold, if the signaling load exceeds the predetermined signaling load threshold, then select a hub UE from among the plurality of UEs, with remaining UEs comprising one or more secondary UEs, allocate a plurality of traffic channels between the wireless access node and the hub UE, and relay all signaling for the one or more secondary UEs through the hub UE via signaling aggregation using one or more traffic channels of the plurality of traffic channels.
US09451500B2
A technique for controlling network routing in a network (100) is provided. The network (100) includes a first end node (102) and a second end note (104). The end nodes are connectable along a first routing path (106) by at least one link (113). The network (100) further provides a second routing path (108) including the first end node (102) and the second end nodes (104). As to a method aspect of the technique, one or more queues (402) are provided. Each of the queues (402) serves at least one tunnel (Tunnel_1; Tunnel_2) along the first routing path (106). A switching of the tunnel (Tunnel_1) to the second routing path (108) is triggered based on a combination of two pieces of information. A piece of information includes information as to a queue build-up at the queue (504) serving the tunnel (Tunnel_1). Another piece of information includes information as to a capacity of the link (113) of the first routing path (106).
US09451488B2
The present invention relates to a wireless communication system, and more specifically, disclosed are a method and an apparatus for channel state information feedback. A method for a user equipment reporting channel state information in the wireless communication system, according to one embodiment of the present invention, comprises: receiving information on a CSI-reference signal (CSI-RS)-related parameter; receiving the CSI-RS on the basis of the CSI-RS-related parameter; and reporting to the base station CSI feedback information generated on the basis of the CSI-RS, wherein the CSI-RS-related parameter can be applied as a CSI-RS port or a port group unit, wherein an independent CSI-RS transmission power ratio indication parameter can be provided for each subframe set.
US09451485B2
Disclosed herein are technologies for detecting misleading identifiable wireless signal (IWS) sources by a mobile device. When a mobile device attempts to estimate its location or route based upon ambient IWS sources, such estimations presume that the ambient IWS sources are unique, stationary, and relatively short ranged. A misleading IWS source is one that does not adhere to one or more of those presumptions. This Abstract is submitted with the understanding that it will not be used to interpret or limit the scope or meaning of the claims.
US09451477B2
A method and system for implementing a drive test are provided in the present document. The method includes: a mobility management entity sending activation message including measurement configuration information of Minimization of drive test (MDT) to a base station; after receiving the activation message, if determining that it is appropriate for a corresponding UE to perform a corresponding MDT measurement, the base station sending the measurement configuration information to the UE. With the present document, a MDT configuration information interaction between a core network and the base station can be effectively implemented in a communication system, which enables the base station to better select an appropriate UE according to local information and enables the base station to utilize measurement information reported by the UE to achieve an object of MDT, thereby reducing maintenance and operation costs of the current communication network and enhancing the network performance.
US09451474B2
The present disclosure discloses a method and network device for providing a multicast aware beamforming mechanism in a WLAN. Specifically, a network device receives a multicast message to be transmitted to a plurality of client devices. The network devices then selects a first subset of client devices of the plurality of client devices for focusing a directional radiation pattern, and transmits the multicast message using the directional radiation pattern to the plurality of client devices. Note that, the multicast message is successfully received by each of the plurality of client devices. Further, the plurality of client devices includes (a) the first subset of client devices that are located in an approximate direction of the focus of the directional radiation pattern and (b) a second subset of client devices that are located in a different direction than the focus of the directional radiation pattern.
US09451473B2
Systems and methods for analyzing and forecasting network traffic are disclosed. In some implementations, multiple points are received. Each point represents a time value and a network traffic value. For each point in the multiple points, the network traffic value is decomposable into a trend component, a seasonality component, a burst component, and a random error component. A trend equation is generated for calculating the trend component based on the time value. A seasonality equation is generated for calculating the seasonality component based on the time value. A burst equation is generated for calculating the burst component based on the time value. A random error equation is generated for calculating the random error component. A network traffic equation is generated for calculating the network traffic value based on the time value by combining the trend equation, the seasonality equation, the burst equation, and the random error equation.
US09451471B2
A method for determining a cell placement efficiency number for a wireless cell by computing a first radius R1, wherein the first radius R1 defines a first region that comprises a first threshold TH1 of the total cell traffic. A second radius R2 is computed, wherein the second radius R2 defines a second region that comprises a second threshold TH2 of the total cell traffic. A cell placement efficiency value is then computed using R1 and R2.
US09451468B2
A method for reducing interference between wireless networks for industrial devices. The method includes the steps of: obtaining a first resource schedule of a first wireless network manager; obtaining a second resource schedule of a second wireless network manager; determining whether there are resource conflicts between the first resource schedule and the second resource schedule; and providing, when at least one resource conflict is determined, a new wireless resource schedule for the first wireless network manager to avoid at least part of the determined resource conflicts. A corresponding multi-network manager, system and computer program product are also presented.
US09451459B2
The present invention relates to a system constituted by a mobile network operator (MNO), a subscription manager (SM), and an embedded UICC (eUICC), wherein the MNO system or the SM stores an eUICC certificate that can verify the identity of the eUICC, transfers the eUICC certificate to the MNO system or the SM in a provisioning or MNO changing process, verifies the identity of a corresponding eUICC using the received eUICC certificate, and encrypts and transfers a profile to the eUICC only if the verification is successful so that the eUICC may be verified during the provisioning or MNO changing processes.
US09451457B2
A method for enhancing high availability in a secure telecommunications network includes: switching from a first operational mode to a second operational mode based on an exchange of at least a first message and a second message between at least one specific remote node of the plurality of remote nodes and one or a plurality of further network nodes using Dynamic Host Configuration Protocol (DHCP). The first message includes a request from the at least one specific remote node of the plurality of remote nodes and the second message includes an answer to the first message by a network management node. The second message includes a one-time password.
US09451456B2
A sleeve that acts as a server is provided. In one embodiment, the sleeve may be configured to attach to a mobile device. The sleeve may include a server configured to wirelessly connect to the mobile device.
US09451453B2
A system and method for securing communications between a plurality of users communicating over an optical network. The system utilizes a fixed or tunable source optical generator to generate entangled photon pairs, distribute the photons and establish a key exchange between users. The distribution of entangled photon pairs is implemented via at least one wavelength selective switch.
US09451447B2
A method and system is disclosed for performing a wireless location of a mobile communication device for detecting, monitoring and/or controlling one or more interactive mobile services capable of being activated by a user of the mobile device. When the mobile device is operated by the user, a wireless location is performed for determining whether such an interactive service, requested by the user, can be provided to the user. In one embodiment, a determination is made as to whether the mobile device resides in a container, e.g., a vehicle, for determining whether the interactive mobile service can be accessed by the user.
US09451446B2
A method for receiving identity information for a mobile communication device is provided. The method comprises a memory module on the mobile communication device receiving, over a wireless communication link, a device identifier and an authentication key, wherein no identity information had previously been provided to the memory module. The memory module may be one of a subscriber identity module (SIM), a universal integrated circuit card (UICC), a universal subscriber identity module (USIM), or a removable identity module (R-UIM).
US09451436B2
Method, apparatus, and computer program product example embodiments enhance wireless communications device discovery processes. In an example embodiment, a method comprises detecting, by an apparatus, a sequence of wireless device advertising channel messages in a first communications protocol during device discovery scans of the first communications protocol; and multiplexing, by the apparatus, transmission of a sequence of wireless device discovery messages in a second communications protocol, with the detected sequence of wireless device advertising channel messages in the first communications protocol, in response to the detecting of the sequence of wireless device advertising channel messages in the first communications protocol.
US09451431B1
To enable multiple message originators to share an SMS shortcode, a service provider that administers the shared shortcode determines which of the recipients of an outbound SMS message have subscribed to SMS services of the particular originator. Only messages to recipients that have specifically opted in to receive messages from the particular originator are sent by the service provider through an SMS gateway. To opt-in to SMS message services, a user sends an opt-in message to the service provider. The content of the opt-in message includes a code that uniquely identifies one of the plurality of originators.
US09451430B2
A method for delivering data in at least two short messages being concatenated to each other wherein a short message is delivered from an originating party to a destination party through a short message service center, an acknowledgement indicating a successful delivery of the delivered short message is received by the originating party from the short message center, and in response to the receipt of the acknowledgement indicating a successful delivery of the previous short message, at least one other short message is delivered to the destination party. A server implementing at least part of the method steps is also described.
US09451419B2
A method and a system for operating a subscriber unit to seamlessly switch between a trunked mode operation (TMO) and a direct mode operation (DMO) in a communication system. The communication system includes one or more subscriber units communicating in trunked mode operation on a first communication channel via a base station and the subscriber units communicating in direct mode operation on a second communication channel via a direct mode gateway station. When the subscriber units communicate in the TMO and when the signal quality on the first communication channel is below the predetermined threshold, the subscriber units automatically switch to the direct mode operation. When the subscriber units communicate in DMO and when the signal quality on the second communication channel is below the predetermined threshold, the subscriber units automatically switch to the trunked mode operation.
US09451407B2
Methods, systems, and apparatus for locating the seek and find RF device are provided. An exemplary embodiment of a seek and find RF device receives a first RF cell phone signal from a requesting party device, wherein the first RF cell phone signal includes at least a location query requesting location information of the seek and find RF device, and wherein the location query is directed to the seek and find RF device using a mobile device identifier. The seek and find RF device receives at least three GPS satellite signals and determines a location of the seek and find RF device based upon the at least three GPS satellite signals. The seek and find RF device then transmits a second RF cell phone signal, wherein the second RF cell phone signal includes the determined location, and wherein the second RF cell phone signal is directed to the requesting party device using a device identifier.
US09451404B2
A system (1200) and a method (700, 800) are provided for determining the position of a mobile unit (MU) in communication with a network in an environment. A database (720) is provided with coefficients of a polynomial function representative of a relationship between received signal strength indicators (RSSIs) of network access points (APs) and physical distances (PDs) between reference points and each AP. RSSIs are obtained (725) at the MU from the APs and a physical distance is calculated (730) between the MU and each AP based on the RSSIs and the coefficients for each AP. The position of the MU is next calculated (735) based on the calculated PDs. When the environment comprises sub-regions with variable signal propagation characteristics, the method (800) determines coefficients for each sub-region and determines the sub-region in which the mobile unit is located with a fingerprint positioning method (802).
US09451400B2
A method and apparatus determines a physical location of a wireless infrastructure device. At least one coarse location data from an associated terminal device is determined. Additional coarse location data are stored and accumulated. The device location is considered accurate by determining that enough received coarse location data has been received.
US09451394B2
Structures and protocols are presented for signaling a status or decision concerning a wireless service or device within a region to a network participant or other communication device (smartphone or motor vehicle, e.g.).
US09451389B2
The subject matter described herein relates to methods and systems for communicating digital greeting and informational content using a near field communication (NFC) devices, the content herein are of digital media type representing text, audio, video, image, and document formats. In one of the embodiments, unique programmed NFC stickers can be used conjunction with NFC enabled devices, such as a Smart Phone, to upload a personalized video or audio greeting on Central Server, doing so the sender activates the NFC sticker for distribution, when distributed, the recipient can tap on the same sticker and play the greeting message using the Smart Phone. In another embodiment, retail consumers can tap on NFC tags or sticker with Smart Phone to view product informational content that has been hosted on the Central Server by retailers and manufactures or by any organization that has similar needs.
US09451388B1
A framework for processing a number of commands for controlling a number of electronic devices includes a number of control servers and a number of terminals. Each control server controls corresponding one or more electronic devices. Each control server communicates with one or more terminals. Each control server receives commands from the corresponding terminals to control the corresponding electronic devices. Each control server sets an authority level of each of the corresponding terminals. A first control server is able to authorize a second control server to control one or more of the electronic devices controlled by the first control server. The terminals communicating with the second control server have a higher authority level than the terminals communicating with the first control server for controlling the one or more electronic devices that the first control server authorized the second control server to control.
US09451386B2
Briefly, in accordance with one or more embodiments, a base station schedules resources for one or more machine-to-machine devices in one or more machine-to-machine groups for a periodic duration persistently. The base station allocates resource blocks for the one or more devices within the scheduled resources, and then receives data packets transmitted from the one or more devices in the allocated resource blocks. The base station may pre-allocate a control channel to be used by the one or more devices during an idle mode for a periodic duration. Uplink synchronization may be performed if one or more of the devices wakes from the idle mode, and the base station may receive data from one or more of the devices in the pre-allocated control channel.
US09451382B1
Mobile agents can be deployed to mobile devices within specific regions of interest to achieve specific goals in respect of events occurring in the region of interest. In order to ensure that the agent can persist within the region of interest until the agent goals are achieved, the agent is configured to locate other devices within the region of interest and to propagate itself, by moving or copying itself, to those other devices. The region of interest may be a mobile and/or dynamic region of interest defined by, for example, a proximity to one or more mobile wireless access points or by an overlapping peer-to-peer communication range of a plurality of mobile devices that are configured to support the agent.
US09451381B2
Methods and apparatus for deploying and configuring WiFi capable devices are described. A WiFi capable device such as security camera, temperature monitor and/or other device intended for use with a home network including a gateway device is preconfigured with WiFi network connection information, e.g., a network identifier such as a first SSID corresponding to a first WiFi LAN network used to supply configuration information. The gateway device is preconfigured to act as an access point for the configuration network to which the first SSID corresponds. The gateway device also supports one or more additional LAN networks, e.g., home networks which can be used for data traffic. The additional LAN networks may include an Ethernet network, a coax cable network, a powerline network and/or an additional WiFi network corresponding to a second SSID. A WiFi capable device is configured via the first network to communicate traffic data via the second network.
US09451375B2
An implantable microphone, comprising a rigid housing, a sensor membrane for exposure to surrounding soft tissue, the sensor membrane being arranged to seal an opening of the housing, a transducer for generating an output signal corresponding to the deflection of the sensor membrane, and a compliant suspension arrangement located opposite to the sensor membrane for being exposed to soft tissue and for supporting the housing on soft tissue in a manner that the housing is moveable relative to said soft tissue upon acceleration of the housing and the soft tissue, the suspension arrangement comprising means for adjusting the spring constant of the suspension arrangement when the microphone is implanted.
US09451364B2
A chemical analysis system is disclosed wherein, in evacuating a preconcentrator housing (2) prior to desorption, a pump system (13) reduces an internal pressure of the preconcentrator housing to a level substantially equal to an internal pressure of a chemical analyzer such that flow restrictors and/or membranes (15) between the chemical analyzer (7) and the preconcentrator housing (2) may be omitted. The chemical analysis system includes a chemical analyzer (7), a preconcentrator housing (2) coupled to the chemical analyzer, the preconcentrator housing enclosing a temperature control element (5, 18) and a sorbent material (1), the temperature control element configured to heat the sorbent material to adsorb or desorb a chemical of interest; and a pump system (13) coupled to the preconcentrator housing and the chemical analyzer, the pump system configured to evacuate the preconcentrator housing prior to desorption of the chemical of interest.
US09451363B2
An advantage of Ambisonics representation is that the reproduction of the sound field can be adapted individually to nearly any given loudspeaker position arrangement. The invention allows systematic adaptation of the playback of spatial sound field-oriented audio to its linked visible objects, by applying space warping processing as disclosed in EP 11305845.7. The reference size (or the viewing angle from a reference listening position) of the screen used in the content production is encoded and transmitted as metadata together with the content, or the decoder knows the actual size of the target screen with respect to a fixed reference screen size. The decoder warps the sound field in such a manner that all sound objects in the direction of the screen are compressed or stretched according to the ratio of the size of the target screen and the size of the reference screen.
US09451358B2
An adjustable microphone. The microphone includes a MEMS microphone, a charge pump, a preamplifier, a first analog-to-digital converter, a root mean square (RMS) power detector, and a logic circuit. The MEMS microphone is configured to provide a signal indicative of sound detected by the MEMS microphone. The charge pump provides a bias voltage to the MEMS microphone. The preamplifier receives the signal from the MEMS microphone, and outputs an amplified signal indicative of sound detected by the MEMS microphone. The first analog-to-digital converter receives the amplified signal and converts the amplified signal to a digital signal. The root mean square power detector is configured to detect a power level of the amplified signal and output an indication of the power of the amplified signal. The logic circuit receives the RMS power detector output and a control input, and adjusts the operation of the microphone based on the control input.
US09451357B2
A basal end cover having a cable entry portion, and an earphone case which accommodates a bone conduction microphone and a bone conduction speaker, being assembled to the basal end cover, with the earphone case including a rigid resin ear plug having a microphone accommodating space in which the bone conduction microphone to be disposed on the distal end side is accommodated, and a speaker accommodating space in which the bone conduction speaker to be disposed on the basal end side is accommodated, and a sensing cover formed of a material softer than that of the ear plug defining the microphone accommodating space, and a bone-conducted sound is picked up by the bone conduction microphone through the sensing cover is provided.
US09451334B1
A mobile application is disclosed enabling a first sporting event spectator to efficiently record game actions and a second sporting event spectator to simultaneously record real-time video of the game actions. Using a mobile device having a touch screen, the first user can efficiently, and with limited user interaction, indicate fast paced game actions of players engaged in a sport. Using a separate mobile device, or a video system in communication with a network, the second user can record video of a presently occurring game in which the game actions occur. A system in communication with the first and second users' devices can receive indications of game actions, and receive video of the game, and associate each indicated game action with a portion of the video of the game action. The system may, for example, use these associations to generate an index that enables users to view descriptions of the game actions and jump to corresponding video clips.
US09451333B2
Disclosed herein is a transmission apparatus, including: an application data transmission section adapted to transmit data of an application for HbbTV; and an AIT transmission section adapted to transmit an AIT including an application profile which represents one or more additional functions to the application and is configured from a first bit region of high-order n bits and a second bit region of Lower-order (16−n) bits which represent presence or absence of functions allocated to bit positions thereof with a bitmap structure and wherein, in the first bit region, values for changing over the functions to be allocated to the bit positions in the second bit region are set.
US09451331B2
Embodiments of the invention are generally directed to proxy device operation in a command and control network. An embodiment of a method includes discovering one or more devices in a first network at a proxy device, generating by the proxy device virtual devices representing the one or more devices, and advertising by the proxy device the one or more virtual devices on a second network. The method includes receiving by the proxy device a command for a first virtual device of the one or more virtual devices from a command device, the command device being outside the first network, the command being received via the second network, and the first virtual device representing a target device located in the first network. The method further includes forwarding the command to the target device via the first network.
US09451329B2
Methods, systems and computer program products are provided for providing content recommendation by obtaining metadata associated with a media object, extracting from the metadata a plurality of terms associated with the media object, and mapping at least a portion of the plurality of terms to buckets. A query vector having attributes corresponding to the buckets is used to perform a query on a database storing media object documents having attributes corresponding to the buckets.
US09451324B2
A client server arrangement for downloading media content filters from a server device to a client device. The media content filters define portions of a separate audio visual presentation containing potentially objectionable subject matter. Depending on user selections, identified portions of the audio/visual presentation may be skipped and/or muted during play. In one particular implementation, the client device, e.g., a DVD player, is configured to initiate a connection with a server device. Upon successful connection, the server device transmits one or more media content filters to the client device. The client device may be configured to determine whether a particular media content filter is available, to facilitate deletion of some existing media content filters in order to secure adequate memory space, and to ensure that the media player has an active account, before initiating a connection with the server device. The server device may be configured to determine whether the media player is associated with an active user account, whether a requested filter is available, and whether adequate memory space is available at the media player, before transmitting media content filters to the client device.
US09451322B2
In accordance with a method a plurality of subscriber systems are provided, the systems being coupled via a Wide Area Network (WAN) and comprising a first subscriber system. The first subscriber system has processing and non-volatile storage and is suitably programmed for providing a subscriber service to a first subscriber. The first system is disposed in an unsecured location, which is associated with the first subscriber. Subsequently, the subscriber service is provided to the first subscriber. Separately, a task is provided to the first subscriber system via the WAN and is executed on the first subscriber system. An activity record for the execution of the task is logged, based on an amount of at least one of the processing and the non-volatile storage consumed on the first subscriber system during execution of the task.
US09451321B2
A method includes storing metadata associated with content from at least one content source, determining that the content is being presented, receiving data representing a biometric attribute associated with a content consumer, determining that the content consumer is consuming the content, and updating the metadata associated with the content in response to determining that the content consumer is consuming the content.
US09451310B2
Methods, systems, and articles of manufacture consistent with the present invention provide an electronic marketplace that matches units of content from secondary content providers with suitable vacancies from primary content providers. Vacancies may constitute, or be included in, any digital transmission containers, such as a television or radio programming, web pages, and the like. Specifically, the electronic marketplace automatically matches content offered by secondary content providers with vacancies offered by primary content providers thus filling the vacancies in these containers through a real-time content trading, placement, and distribution system. To do so, attributes associated with the vacancies and with units of secondary content are used to trade and match suitable vacancies with suitable content. This invention enables both secondary content owners and vacancy owners (primary content providers) to obtain the full commercial benefit of their secondary content and containers.
US09451307B2
A device, method, and computer-readable media for managing interrupt times for content items based on metadata encapsulating user behavior. A user controls the playback of content items such as audio or videos. The content items may be episodes in a programming series. Tags are associated with the content items. These tags include metadata having playback time of the received user interactions. In turn, the device processes the tags to identify user interaction that include stop events for the content items. The tags are processed based on a sliding time window. The playback times of the stop events are selected as potential interrupt times that the device may include recommendations for unaired episodes. The selected interrupt times are also used to identify inconsistencies in the metadata.
US09451304B2
Sound feature priority alignment techniques are described. In one or more implementations, features of sound data are identified from a plurality of recordings. Values are calculated for frames of the sound data from the plurality of recordings. The values are based on similarity of the frames of the sound data from the plurality of recordings to each other, the similarity based on the identified features and a priority that is assigned based on the identified features of respective frames. The sound data from the plurality of recordings is then aligned based at least in part on the calculated values.
US09451302B2
Provided are a fusion device, system and method for implementing an Internet Protocol Television (IPTV) service. The fusion device integrates a Content Delivery Network (CDN) component and a network component. The CDN component receives a media service request initiated by a Set Top Box (STB), searches in a service policy template database for a service policy template matching a service type carried by the request, initiate a network support request to the network component, and uses the service policy template to provide a service for the STB after receiving a success response message fed back by the network component; and the network component searches in a network policy template database for a network policy template matching a service policy after receiving the network support request, executes the network policy template, feeds back a success response message when the execution succeeds, and uses the network policy template to provide a network resource support for the CDN component. The disclosure fuses a content delivery function and a network service function, which effectively ensures service quality of the IPTV service.
US09451299B2
The invention provides a method and apparatus that addresses and resolves the issues currently affecting the ability to offer Enhanced TV, in particular, those issues concerning timing and synchronization, interaction with other modules in the STB, and distribution.
US09451298B2
To increase the efficiency of a cache and delivery resource control of video data streams in a network.A meta file including information used by a client terminal to acquire a predetermined number of video data streams of given content deliverable by a delivery server via a network is generated. When a transmission request is received from a client terminal, the meta file is transmitted to the client terminal via the network. The meta file includes an index regarding a cache of each of the video data streams.
US09451292B2
In some embodiments, an encoding method for generating an extended dynamic range (EDR) channel in response to an input video channel, such that the EDR channel's code values consist of code values in a range from a standard black level, X, through a standard white level, Z, and an additional code value set. The EDR channel is displayable with standard dynamic range and standard precision by a standard dynamic range video system which maps to the level, X, any of the EDR channel's values less than X, and maps to the level, Z, any of the EDR channel's values greater than Z, and is displayable with an extended dynamic range greater than the standard dynamic range and/or a precision greater than the standard precision by an EDR video system. Other aspects are systems configured to perform embodiments of the encoding method, and methods and systems for displaying EDR video.
US09451291B1
A method and apparatus for scalable symmetric data compression and decompression (codec), optimized for real-time processing of high-resolution continuous-tone 2D input, such as video and images. Following a dyadic n-level DWT decomposition of input, the coding of subbands is spatially partitioned to enable strong parallelism that maps into concurrent encoding threads, based on typical artifacts of H-bands on initial levels—large areas of contiguous zeros interspersed with sparse and highly redundant non-zero values. Variable length codewords of both non-zero values and their positions are mapped into a linear bitstream by a combined limited sequential and parallel procedure of at most log2 n iterations, with both lossless and lossy variants enabled. The compressed bitstream of self-delimiting entries is decoded in a symmetric iterative procedure that delivers to decoding threads the non-zero values and position codewords for final image restoration.
US09451288B2
A video coding system may initiate coding of a new coding session with reference to an “inferred key frame” that is known both to an encoder and a decoder before a coding session begins. The inferred key frame need not be transmitted between the encoder and decoder via the channel. Instead, the inferred key frame may be stored locally at the encoder and the decoder. Frames coded at the onset of a video coding session may be coded with reference to the inferred key frame, which increases the likelihood a decoder will receive a frame it can decode properly and accelerate the rate at which the decoder generates recovered video data. Inferred key frames may be used as prediction references to recover from transmission errors.
US09451284B2
A video coder can select which reference pictures should be signaled in a parameter set such as a picture parameter set (PPS) and which reference pictures should be signaled in a slice header such that when a video decoder constructs a reference picture set, the video decoder does not need to reorder the reference picture set to construct an initial reference picture list for a slice of video data.
US09451281B2
Disclosed are a method for inducing a prediction motion vector and an apparatus using the same. An image decoding method can include: a step of determining the information related to a plurality of spatial candidate prediction motion vectors from peripheral predicted blocks of a predicted target block; and a step of determining the information related to temporal candidate prediction motion vectors on the basis of the information related to the plurality of spatial candidate prediction motion vectors. Accordingly, the present invention can reduce complexity and can enhance coding efficiency when inducing the optimum prediction motion vector.
US09451279B2
Provided is a method for decoding a moving picture. The method has the steps of generating a prediction block of a current block and generating a residual block of the current block. To generate the prediction block, a reference picture index and motion vector difference of the current block are obtained from a received bit stream, and spatial and temporal motion vector candidates are derived to construct a motion vector candidate list. A motion vector candidate corresponding to a motion vector index is determined as a motion vector predictor, and a motion vector of the current prediction unit is restored to generate a prediction block or the current block. Therefore, the motion vector encoded effectively using spatial and temporal motion vector candidates is correctly recovered and the complexity of a decoder is reduced.
US09451278B2
A motion vector coding unit executes processing including a neighboring block specification step of specifying a neighboring block which is located in the neighborhood of a current block; a judgment step of judging whether or not the neighboring block has been coded using a motion vector of another block; a prediction step of deriving a predictive motion vector of the current block using a motion vector calculated from the motion vector of the other block as a motion vector of the neighboring block; and a coding step of coding the motion vector of the current block using the predictive motion vector.
US09451276B2
An image decoding method is provided which includes a time information determination step of determining time information of a current picture, a first reference picture referred to by the current picture and a second reference picture referred to by the current picture; a scaling parameter calculation step of calculating a scaling parameter based on a time distance between the first reference picture and a second reference picture; a weighting coefficient determination step of determining two weighting coefficients based on the scaling parameter; a predictive pixel value generation step of generating a predictive pixel value of the current picture by scaling a pixel value of the first reference picture and a pixel value of the second reference picture using the two weighting coefficients determined in the weighting coefficient determination step; and a decoding step of decoding the current picture using the predictive pixel value.
US09451275B2
A method for reducing data size of digital images is provided. The method includes receiving a Joint Photographic Experts Group (JPEG) encoded image, and performing an entropy decode on the image. The method also includes generating a fingerprint for each JPEG coefficient block, and processing the fingerprints to determine the identity of any duplicate or similar JPEG coefficient blocks. The method further includes generating metadata identifying the duplicate or similar JPEG coefficient blocks, and compressing non-duplicate and/or non-similar JPEG coefficient blocks. The method also includes transferring the metadata and the non-duplicate and/or non-similar JPEG coefficient blocks to a remote system.
US09451274B2
To allow improved high dynamic range image encoding, we describe an image encoding unit (551) arranged to encode a high dynamic range image (IM_HDR-in) comprising: a first receiver (901) for receiving a lower dynamic range (SELR); a first code mapping unit (904) arranged to encode in a first image (Im_1) all pixels of the high dynamic range image (IM_HDR-in) with luminances within the lower dynamic range (SELR); a second receiver (902) for receiving a maximal redundancy (MAXRED), which specifies to which amount luminances already encoded in the first image (Im_1) need to be redundantly encoded again; an image processing unit (903) arranged to determine, based upon the maximal redundancy (MAXRED), which pixels of the high dynamic range image (IM_HDR-in) need to be encoded in a second image (Im_2); a second code mapping unit (905) arranged to encode in the second image (Im_2) luminances of the pixels of the high dynamic range image (IM_HDR-in) which need to be encoded in the second image (Im_2); and a formatter (906) arranged to output the first and second image as a high dynamic range encoding S(Im_1, Im_2), and related realizations such as transcoders, decoders, signals, etc.
US09451263B2
Provided is an intra prediction apparatus that adaptively filters reference pixels according to an intra prediction mode and a size of a prediction block, and generates the prediction block using reference pixels determined by the intra prediction mode. The reference pixels are adaptively filtered according to the size of the prediction block for intra prediction modes existing between a horizontal mode and an intra prediction mode having a direction of 45° with reference to the horizontal mode. When the reference pixels for a second directional intra prediction mode are filtered, the reference pixels for a first directional intra prediction mode, that is closer to the intra prediction mode having the direction of 45° with reference to the horizontal mode than the second directional intra prediction mode is, are also filtered. Accordingly, an image compression ratio can be improved.
US09451255B2
The present invention provides an image encoding/decoding technique that is capable of achieving the higher compression efficiency. An image encoding method comprises: an intra prediction step which performs intra prediction on a block basis to generate a predicted image; a subtraction step which calculates the difference in prediction between the predicted image generated by the intra prediction step and an original image; a frequency conversion step which performs frequency conversion processing for the difference in prediction; a quantization step which subjects the output of the frequency conversion step to quantization processing; and a variable-length encoding step which subjects the output of the quantization step to variable-length encoding processing; wherein the intra prediction encoding step predicts a target pixel to be encoded by use of pixel values of two reference pixels between which the target pixel to be encoded is located.
US09451252B2
In one example, a video coder, such as a video encoder or video decoder, is configured to code a video parameter set (VPS) for one or more layers of video data, wherein each of the one or more layers of video data refer to the VPS, and code the one or more layers of video data based at least in part on the VPS. The video coder may code the VPS for video data conforming to High-Efficiency Video Coding, Multiview Video Coding, Scalable Video Coding, or other video coding standards or extensions of video coding standards. The VPS may include data specifying parameters for corresponding sequences of video data within various different layers (e.g., views, quality layers, or the like). The parameters of the VPS may provide indications of how the corresponding video data is coded.
US09451249B2
A method is provided for decoding an image. An advanced motion vector prediction (AMVP) candidate list is constructed using available motion vector candidates of a left motion vector candidate, an above motion vector candidate and a temporal motion vector candidate. A motion vector predictor is selected among motion vector candidates of the AMVP candidate list using an AMVP index. A motion vector is generated using the motion vector predictor and a differential motion vector. A prediction block is generated using the motion vector and a reference picture index. A quantized block is inversely quantized using a quantization parameter to generate a transformed block and inversely transform the transformed block to generate a residual block. A reconstructed block is generated using the prediction block and the residual block.
US09451247B2
A camera testing apparatus includes a frame assembly, a control unit, and a plurality of first light sources and second light sources coupled to the frame assembly and in communication with the control unit. Each of the first and second light sources is in one of an illuminated first state or a non-illuminated second state, and each of the plurality of first and second light sources is adapted to be within a field of vision of a camera disposed remote from the first and second light sources. The control unit sends a first command to each of the first light sources to change a first operational parameter. The control unit sends a second command to a first one of the second light sources to illuminate at a first brightness and a third command to a second one of the second light sources to illuminate at a second brightness.
US09451243B2
Autostereoscopic display device (1) comprising rows and columns of colour sub-pixels and a lenticular array (9) in registration with the display, the lenses of which being slanted with respect to the general column pixel direction in order to enable square, or near-square, 3D pixels.
US09451240B2
A 3-dimensional (3D) image acquisition apparatus capable of simultaneously obtaining a color image and a depth image in a single shooting operation is provided. The apparatus includes a light source for radiating illumination light having a predetermined wavelength onto an object; a lens unit having at least four object lenses; an image sensor including at least four sensing regions for individually receiving light focused by the object lenses and for generating images; and at least three optical shutters individually facing at least three of the at least four object lenses and for modulating incident light with predetermined gain waveforms.
US09451225B2
A method and system for color enabled local area contrast enhancement, are provided by generating a first copy of an image; processing the first copy to locally enhance visual contrast in the image; generating a second copy of the image; processing the second copy of the image to provide at least one visual cue to radiant flux within the image incident on the focal plane pixels; displaying a combined image formed from the combination of the locally enhanced first copy and flux mapped the second copy.
US09451217B2
A system and method for providing video surveillance may include providing digital television services to a customer via middleware. The middleware may include digital rights management services. Digital surveillance services may be provided to the customer via the middleware. In providing digital surveillance services to the customer, the customer may be enabled to access surveillance equipment via the middleware from a remote location using a telecommunications device, where the telecommunications device is authorized to access the surveillance equipment by the digital rights management services.
US09451213B2
A distance measuring apparatus (11) optically detects a measuring target, thereby measuring an object distance, which is the distance to the measuring target. The orientation of an optical axis of a lens is set to be different from an advancing direction of light incident from the measuring target. The lens is configured to form an image from the incident light, thereby obtaining an image of the measuring target. The distance measuring apparatus includes an imaging relative quantity calculating means (31, 32) for obtaining an imaging position indicative of a position of the image with respect to the lens for each of a plurality of wavelengths possessed by the incident light, thereby calculating an imaging relative quantity, which is a quantity indicative of a relative relationship between the imaging positions; storage means (17) for storing correlation information (18), which is information determined by a chromatic aberration characteristic of the lens and the orientation of the optical axis in order to indicate a correlation between the imaging relative quantity and the object distance; and distance calculating means (33) for calculating the object distance by checking the imaging relative quantity against the correlation information (18).
US09451212B2
To realize a service of data content that can interlock with AV content of programs without providing a band for broadcasting data content in a broadcast band for digital television broadcast, provided is a reception apparatus that receives an audio and/or video (AV) content, the apparatus including: an extraction section to extract trigger information from the AV content, the trigger information being related to an application program that is executed interlocking with a progress of the AV content, the trigger information including a trigger type; and a control section to control one of an activation of the application program, a dispatch of an event of the application program being executed, and an end of the application program being executed in accordance with the trigger type included in the extracted trigger information.
US09451207B2
A method, apparatus and computer program for displaying video and accompanying text data on a display are provided. The method includes receiving media content that includes video and determining whether text data associated with the video is to be presented on the display alongside the video. If associated text data is not to be presented, then the video content is output as normal, with the video content occupying a first area of the display (such as the entire display). If associated text data is to be presented, then the video output is automatically resized such that the video occupies a smaller area of the display, and the associated text data is automatically displayed alongside the video. By allowing for dynamic resizing it is possible to display subtitles or closed captions alongside portions of video content without obscuring the video.
US09451205B2
The present invention relates to a signal transceiving apparatus and a signal transceiving method. One embodiment of the present invention provides a signal transceiving method comprising: a step of generating HD video from UHD video and obtaining residual data of the UHD video, remaining after converting the HD video from the UHD video; and a step of transmitting the converted HD video to a base layer stream and the residual data to an enhancement layer stream.
US09451184B2
A photo conductive antenna irradiated with light pulse and generating terahertz wave includes a first layer formed by a semi-insulating substrate, a second layer located on the first layer and formed using a material having lower carrier mobility than carrier mobility of the semi-insulating substrate, a first electrode and a second electrode located on the second layer and applying a voltage to the first layer, a first region in which the second layer is formed on the first layer, and a second region in which the second layer is formed on the first layer, wherein the second region is located between the first electrode and the second electrode in a plan view, and the light pulse is applied to the second region.
US09451176B2
Provided is an image signal processor, including: an integrator configured to integrate each frame of an image signal; a first flicker corrector configured to extract a flicker component from the integrated value obtained by the integrator, the flicker component depending on a frequency of a light source, and to reduce a flicker component from the integrated value sequentially; and a second flicker corrector configured to generate a reference image without a flicker component based on the correction result of the integrated value corrected by the first flicker corrector, and to correct a flicker of the image signal based on the reference image.
US09451172B2
A method and an apparatus for correcting a multi-exposure motion image are disclosed, where the method includes determining a luminance mapping function, where the luminance mapping function is a luminance mapping relationship between a reference frame and multiple extended frames; mapping a luminance of an extended frame by using the luminance mapping relationship to obtain a virtual frame; calculating a global motion vector between the virtual frame and the reference frame; correcting a pixel of the extended frame according to the global motion vector to obtain a first extended frame after correction; detecting a pixel of the first extended frame according to the reference frame to obtain a local error pixel of the first extended frame; and correcting a luminance of the local error pixel of the first extended frame to obtain a second extended frame after correction.
US09451164B2
Methods of processing a frame in a video sequence of digital images are provided. The methods include determining a global motion vector for the frame relative to a previous frame in the sequence, deriving a jitter function from the global motion vector, the jitter function including an estimate of undesired motion of the frame relative to the previous frame, and determining whether the frame is blurred above a first predetermined threshold. If the frame is blurred above the first predetermined threshold, stabilizing the frame using the jitter function and applying a deblur function to the frame.
US09451162B2
The disclosure includes a camera array comprising camera modules, the camera modules comprising a master camera that includes a processor, a memory, a sensor, a lens, a status indicator, and a switch, the switch configured to instruct each of the camera modules to initiate a start operation to start recording video data using the lens and the sensor in the other camera modules and the switch configured to instruct each of the camera modules to initiate a stop operation to stop recording, the status indicator configured to indicate a status of at least one of the camera modules.
US09451161B2
Certain embodiments of the present invention include a system and methods for providing a video image display technology with separate video perspective displays. Each perspective display may be tailored and adapted in real-time to the differing roles of each user, e.g., one or more medical professionals of a surgical team. As an example, one video perspective display may be a panoramic perspective display for a primary surgeon and a second video perspective may be a detailed perspective display for the surgical assistant.
US09451142B2
A single chip vision sensor of an embodiment includes a pixel array and one or more circuits. The one or more circuits are configured to search an image for one or more features using a model of the one or more features. A method of an embodiment in a single chip vision sensor includes obtaining an image based at least partially on sensed light, and searching the image for one or more features using a model of the one or more features. A system of an embodiment includes the single chip vision sensor and a device. The device is configured to receive one or more signals from the single chip vision sensor and to control an operation based at least partially on the one or more signals.
US09451139B2
The invention provides a portable optical instrument including: a body portion to which a lens barrel which holds a lens is fixed; a pop-up light emitting unit which projects illumination light forward; and a sighting device which includes an optical element which includes a concave-surface-shaped reflection surface and a sighting device light source opposed to the reflection surface, the sighting device forming a reflection light of the sighting device light source, wherein the optical element is disposed between the light emitting unit and the body portion.
US09451132B2
Devices, methods, and software are disclosed for capturing a frame of image data having a representation of a feature. In an illustrative embodiment, a device includes an imaging subsystem, one or more memory components, and a processor. The imaging subsystem is capable of providing image data representative of light incident on said imaging subsystem. The one or more memory components include at least a first memory component operatively capable of storing an input frame of the image data. The processor is in communicative connection with executable instructions for enabling the processor for various steps. One step includes receiving the input frame from the first memory component. Another step includes generating a reduced resolution frame based on the input frame, the reduced resolution frame comprising fewer pixels than the input frame, in which a pixel in the reduced resolution frame combines information from two or more pixels in the input frame.
US09451111B1
A method of determining a media class using an optical translucence sensor (OTS) in an imaging device. A media sheet for processing by a media processing device (MPD) in the imaging device passes through an OTS positioned on a media path prior to the MPD. The OTS has an output that is periodically sampled in several predefined interest zones to provide a plurality of intrinsic variables related to the media sheet. The intrinsic variables are combined with extrinsic variables to form a variables data set that is normalized then fed to a controller having a predefined set of media class determining equations for determining a media class for the media sheet. A media class determining equation is provided for each class of media expected to be used in the imaging device. The determined media class is then used to set one or more operating parameters for the media processing device.
US09451110B2
In an image forming apparatus, a notification processing portion is capable of suspending execution of a copy process by a process executing portion, and notifying a determination result of a size determining portion, in a case where an operation to execute the copy process has been performed and where the size determining portion has determined that documents having a size smaller than or equal to a size of a sheet on which a image forming portion can form an image, and having a width, in the document width direction, larger than a width, in the sheet width direction, in which the image forming portion can form an image, are placed on the document placement portion.
US09451108B1
An image forming apparatus includes an apparatus main body, an opening/closing portion that is opened or closed relative to the apparatus main body, a first member configured to move as the opening/closing portion is opened or closed, a second member that contacts the first contact portion in the first member and interlocks with the first member, a sensor configured to generate a signal corresponding to a position of the second member, and a recess portion that is provided in one of the first contact portion and the second contact portion and engages with another portion of the first contact portion and the second contact portion, in which the recess portion has a surface inclined relative to a movement direction of the first contact portion.
US09451100B2
A method in an electronic device is provided. The method includes identifying an output characteristic of at least one peripheral device, converting or reconfiguring output information of an event generated by at least one application program based on the identified output characteristic, and transmitting the converted or reconfigured output information of the event to the at least one peripheral device.
US09451098B2
Methods and devices for dynamic VSIM provisioning on a multi-SIM wireless device having a first SIM as a Universal Integrated Circuit Card (UICC) and a virtual SIM (VSIM). A provisioning server may receive updated information from the wireless device, and based at least partially on the received information, determine whether the SIM profile on the VSIM of the wireless device should be changed. To change the SIM profile, the provisioning server may determine whether remote credential management procedures are enabled. If so, the provisioning server may select a new SIM profile from a plurality of SIM profiles, and provision the new SIM profile in the VSIM using remote credential management procedures. If remote credential management procedures are unavailable, the provisioning server may select a remote SIM from a plurality of remote SIMs associated with the provisioning server, and run the remote SIM to execute authentication processes for the wireless device.
US09451079B2
A system is provided which is capable of connecting a call without degrading the security level in a mobile terminal network, even when a call addressed to a user equipment (UE) arrives via the Internet or a home network. A femto base station receives a packet addressed to a UE via the Internet or a home network, and starts a paging procedure. The UE establishes an RRC connection to the femto base station. The UE transmits, to the femto base station, a paging response addressed to the SGSN. The femto base station performs NAS verification. If the femto base station detects the paging response to a paging request that the femto base station itself has issued, the femto base station changes the service type of the service request received from the UE from the paging response to signaling.
US09451066B1
An apparatus to create decorative artwork on the back of a cell phone protector case including a cell phone protector case having at least a partially transparent back wall with a partially transparent interior surface, a decorative inset card with a decorative image thereon and one or more colored rhinestones which are affixed on the back of the cell phone protector case at the location where the multicolored image is shown through so that the color of the rhinestone matches the color of the image on the decorative insert card which shows through the transparent back wall and transparent interior wall.
US09451065B2
Housings for electronic devices including adaptive plugs, and the use of adaptive plugs in methods of manufacturing housings. The housing may include an opening, and an adaptive plug releasably positioned within the opening. A method of forming a housing may include forming an opening within the housing, disposing a curable material within the opening of the housing, and curing the material to form an adaptive plug. The adaptive plug may be positioned within the opening of the housing. The method may also include performing at least one surface treatment on the housing. A method of protecting an edge of an opening in a housing may include providing the housing including the opening, forming an adaptive plug within the opening of the housing, and forming a barrier on the edge of the opening using the adaptive plug.
US09451062B2
A mobile communication device may include one or more cameras located on edges of the mobile communication device. The mobile communication device may further include logic configured to obtain image data from at least one of the one or more cameras; detect a change in an environment of the mobile communication device based on the obtained image data; and provide image data from the at least one of the one or more cameras in a display insert window on a display of the mobile communication device.
US09451060B1
Techniques and apparatus for controlling access to a personal communication structure (PCS) are described. The PCS may include independently accessible compartments at least partially enclosing respective subsystems of the PCS. The independently accessible compartments include an electronics compartment, a communications compartment, and a display compartment. The electronics, communications, and display compartments at least partially enclose a power distribution subsystem, a communications subsystem, and a display subsystem, respectively. The PCS also includes an access controller operable to provide access independently to respective interiors of at least a subset of the compartments to authorized users.
US09451048B2
Methods and systems for identifying information of a broadcast station and information of broadcasted content are provided. In one example, a method includes receiving at a client device media content rendered by a media rendering source, and the client device making an attempt to determine an identity of the media content based on information stored on the client device. The method also includes based on the attempt of the client device to determine the identity of the media content, determining an identity of the media rendering source. The method further includes based on the attempt of the client device to determine the identity of the media content and on determining the identity of the media rendering source, sending information indicative of the media content to a content recognition server to determine the identity of the media content.
US09451044B2
Just in time delivery of a consistent user profile to overlapping user sessions, where a first user session issues a request for a first file of a user profile to a server agent. Upon receiving the request, the server agent retrieves the first file from a base user profile, and just in time delivers the retrieved first file to the first user session. The user, via a second user session executing simultaneously with the first user session, issues a request to the server agent for the first file and a second file of the user profile. Upon receiving the request, the server agent identifies a modified version of the first file in a provisional user profile, retrieves the modified first file from the provisional user profile and the second file from the base user profile, and just in time delivers both files to the second user session.
US09451035B2
Methods, systems, and computer-readable media for a location information server to gather location updates by sending location-update-requests through a push notification service to a mobile device are disclosed. The mobile device provides location updates in response to the push-based location-update-requests received through the push notification service. The mobile device can switch from a self-initiated location update mode to a push-based location update mode depending on the current state of the mobile device. The mobile device can also choose an appropriate positioning system for self-locating based on the information embedded in the location-update-request received through the push notification service. The information embedded in the pushed location-update-request can be a precision requirement or context information that can be used to determine a precision requirement for the location update.
US09451032B2
A computer system can perform service discovery in a content-centric network (CCN) by receiving a registration interest associated with a service from a service provider, and generating a confirmation content object in response to the registration interest. The confirmation content object includes at least a name for the service and an admission token. The computer system then returns the confirmation content object to the service provider, thereby enabling the service provider to provide the service to the CCN.
US09451027B1
A system for optimizing remote direct memory accesses (RDMA) is provided. The system includes a first computing device and a second computing device disposed in signal communication with the first computing device. The first and second computing devices are respectively configured to exchange RDMA credentials during a setup of a communication link between the first and second computing devices. The exchanged RDMA credentials include cache line size information of the first computing device by which a cache aligned RDMA write operation is executable on a cache of the first computing device in accordance with the cache line size information by the second computing device.
US09451020B2
A method and system of distributed communication of independent autonomous vehicles to provide redundancy and performance are disclosed. In one embodiment, a set of autonomous vehicles operates in a geographically proximate area through which peer-to-peer communication sessions are established between nearby ones of the set of autonomous vehicles through an ad-hoc network based on a present geo-spatial location of each one of the set of autonomous vehicles in communication proximity to preferred adjacent ones of the set of autonomous vehicles. A central server directly coupled to each of the set of autonomous vehicles establishes centralized communication paths with each of the set of autonomous vehicles through a wide area network. The centralized server processes a communication from adjacent ones of the set of autonomous vehicles when an error condition is detected in an operational mode of a non-functional vehicle that has lost communication with the central server.
US09451017B2
A transaction monitoring and tracing system which combines transactional performance monitoring aspects with infrastructure performance and utilization measures, like e.g. used memory or CPU load of transaction executing computing infrastructure. The system uses two types of agents deployed to the monitored system, a transaction and process agent, which is deployed to a process executing monitored transactions, and a host agent, which is deployed to a computer system executing processes monitored by a transaction and process agent. The transaction and process agent provides transaction tracing and process infrastructure measurements, the host agent provides host or operating system infrastructure measurements. All three types of measurements are tagged by the corresponding agent in a way that allows a later correlation of corresponding tracing and measurement data by an external monitoring node. Combining transactional and infrastructure monitoring allows fast detection of non-transactional root causes of monitored transaction performance degradations.
US09451009B2
A remotely accessible integrated development environment, and a sub-system for deploying applications to a remote device is disclosed. The sub-system may further comprise a rendering engine which is configured based upon a platform of the remote device, wherein the rendering engine is configured to communicate with, and receive applications from, a remotely accessible application server.
US09451001B2
A method and system for annotating Playable Media Files in a social network having a plurality of members, wherein the method includes receiving the Playable Media File from a first member, receiving an annotation from another member, and embedding the annotation in the Playable Media File.
US09450994B2
In a mobile device, a method of interacting with a first social networking website by way of a network includes communicating indirectly with the first social networking website by interacting with an intermediate web server by way of the network, the intermediate web server in turn being in communication with the first social networking website. The method further includes determining, based at least in part upon a user input received at the mobile device, that the mobile device should communicate directly with the first social networking website in a manner not involving the intermediate web server. The method also includes communicating with the first social networking website directly in the manner not involving the intermediate web server. In another embodiment, the method relates to interacting with a plurality of social networking sites including a first social networking website and a second social networking site.
US09450991B2
A system and methods for increasing the granularity of privacy control in a group communication session are presented. A privacy rule is established for a participant in the session. The privacy rule specifies for different identity sharing triggers whether the participant identity is to be shared with other participants in the session. The privacy of the participant is able to be different dependent on the particular identity sharing trigger. The privacy rule is set by participant initiating the session, a separate server, or the participant. In the last case, the participant is able to specify privacy for a media or data stream when requesting the floor to transmit the stream. The identity of the participant is automatically modified dependent on session context information.
US09450990B2
A transmission management system receives, when a terminal and a relay device is connected, domain information that indicates a management system capable of executing control associated with start of communication using the relay device. The management system can allow another management system to execute control based on the domain information even if the management system cannot execute the control.
US09450989B2
The concept of a centralized communication log is provided. Anchor points, and specifically Session Initiation Protocol (SIP) anchor points, serve as a media and call control point that is established on a per-user basis which can then be leveraged by a communication log service. Such a communication log service is able to determine accurate and real-time communicant information for a communication session and populate a centralized communication log with the same. Such a communication log is, therefore, accurate with respect to multiple users in a system, highly available, and scaled horizontally.
US09450986B2
Solution for autonomously securing the use of a portable drive with a computer network. A data store is written and maintained that contains entries corresponding to a plurality of portable drives initialized for use with the computer network, each entry corresponding to at least one identifiable drive. Events are monitored as they occur on the computer network involving use of each of the plurality of portable drives. Predefined security policy determination criteria is applied, which can include drive mobility assessment criteria and drive content sensitivity criteria, to determine a drive-specific security policy for each one of the plurality of portable drives. A set of at least one policy enforcement action is executed that corresponds to a determined drive-specific security policy in response to detected usage activity for each one of the plurality of portable drives.
US09450985B2
Systems and methods for computer automated validation of server configurations are provided. A method for validation of a target environment, comprises assembling a validation script from a plurality of script fragments, inserting the assembled validation script into the target environment, executing the validation script in the target environment, gathering results of the executing, and reporting the results to at least one user.
US09450978B2
In one embodiment, network data is received at a first node in a computer network. A low precision machine learning model is used on the network data to detect a network event. A notification is then sent to a second node in the computer network that the network event was detected, to cause the second node to use a high precision machine learning model to validate the detected network event.
US09450976B1
Website security may be managed based on known site attributes and placing limits on communication outside a site. One example may include at least one of identifying a site that is currently operating within a first process, comparing the site to known sensitive sites, and responsive to identifying the site as being a known sensitive site, enabling a data traffic limiting operation to limit data traffic in at least one other process apart from the first process.
US09450973B2
A method, non-transitory computer readable medium and apparatus for providing network security monitoring in a communications network are disclosed. For example, the method receives communications traffic associated with a sensor network from a sensor that is a member of the sensor network, analyzes the communications traffic to determine if an attack is occurring on the sensor network, and generates an alarm if the attack is occurring on the sensor network.
US09450972B2
In one embodiment, a device in a network receives a set of output label dependencies for a set of attack detectors. The device identifies applied labels that were applied by the attack detectors to input data regarding a network, the applied labels being associated with probabilities. The device determines a combined probability for two or more of the applied labels based on the output label dependencies and the probabilities associated with the two or more labels. The device selects one of the applied labels as a finalized label for the input data based on the probabilities associated with the applied labels and on the combined probability for the two or more labels.
US09450961B2
A mechanism is described for facilitating dynamic adjustments to features of computing devices according to one embodiment. A method of embodiments, as described herein, includes automatically monitoring usage patterns relating to a user of computing device. The usage patterns may be based on audio user characteristic or visual user characteristics relating to usage of the computing device. The method may further include automatically monitoring environment patterns relating to the usage of the computing device. The environment patterns may be based on surrounding environment having the user and the computing device. The method may further include facilitating dynamic adjustment of one or more features of the computing device based on one or more of the usage patterns, environment patterns, and user preferences.
US09450958B1
In one implementation, a computer system maintains one or more permissions associated with a credential held by a first user, where at least one of the one or more of permissions is delegatable by the first user to one or more other users. The computer system receives an indication that the first user has chosen to delegate a particular permission from amongst the one or more permissions to a second user, wherein the particular permission is needed to perform a particular type of action. Based on the first user indicating a choice to delegate the particular permission to the second user, the computer system associates the delegation of the particular permission with the second user. Based on delegating the particular permission with the second user, the computer system enables the second user to perform the particular type of action.
US09450954B2
In one implementation, form field(s) of a form of a website or application are populated with data obtained using a digital identity, and the populated form field(s) are submitted to the website or application. A form field specification specifying information about the form fields of the form is obtained. A user selects or creates a digital identity. Data is obtained using the digital identity, and the data is used to provide values to the form. The data is submitted to the website or application. In another implementation, a username and password are automatically generated. The username and password that are generated meet parameters that may be specified by the website or application. The username and password are submitted to the website or application for a purpose such as registration or authentication, and stored away for future authentication.
US09450946B2
Methods and apparatus, including computer program products, implementing and using techniques for providing user credentials over a network to a remote computer application. User credentials for the remote computer application are stored in a central repository that is accessible through the network. A request is sent to a service to perform, on behalf of a user, a particular task involving the remote computer application. It is determined whether the service has been granted permission to act on behalf of the user with respect to the remote computer application. When the service has permission to act on behalf of the user, the service is used to retrieve the user's credentials for the remote computer application from the central repository and to supply the retrieved user credentials to the remote computer application.
US09450945B1
A cloud service access and information gateway receives, from a user device, a request to access a cloud service. The cloud service access and information gateway determines a context of the request and compares the context of the request to a cloud service access policy. If the context of the request satisfies the cloud service access policy, the cloud service access and information gateway determines a type of information associated with the request and compares the type of information associated with the request to an information control policy. If the type of information satisfies the information control policy, the cloud service access and information gateway grants the user device access to the cloud service.
US09450939B2
A method and apparatus for service login to a service provider sites have been disclosed. The method including: receiving a login request from a user, wherein the login request comprises at least both terminal's login information input by the user and third party account information pertaining to the user; after successful verification on the third party account information, determining by the service provider, whether the terminal's login information input by the user matches to reference login information, wherein the reference login information comprises specific information of the user to further identify user's identity; if the terminal's login information matches to at least a portion of the reference login information, delivering service to the terminal according to the third party account information.
US09450931B2
Technologies are provided in embodiments to manage an authentication confirmation score. Embodiments are configured to identify, in absolute session time, a beginning time and an ending time of an interval of an active user session on a client. Embodiments are also configured to determine a first value representing a first subset of a set of prior user sessions, where the prior user sessions of the first subset were active for at least as long as the beginning time. Embodiments can also determine a second value representing a second subset of the set of prior user sessions, where the prior user sessions of the second subset were active for at least as long as the ending time. Embodiments also determine, based on the first and second values, a decay rate for the authentication confidence score of the active user session. In some embodiments, the set is based on context attributes.
US09450928B2
Automated secure registration techniques for communication devices are provided which address the problem of allowing multiple clients to gain access to one system, and thus provide a solution to the “reverse single sign-on” problem. For example, a method for registering a group of two or more communication devices in a communication network comprises the following steps. A group challenge message is sent from a network device to the group of two or more communication devices. The network device receives one or more response messages to the group challenge respectively from one or more of the group of two or more communication devices, wherein the response message from each of the responding communication devices in the group comprises a group credential corresponding to the group.
US09450920B2
For allowing a simple and reliable differentiation of UEs behind a GW from an AF side a method for providing access of an User End device (UE) to a service provided by an Application Function (AF) within a network structure is claimed, wherein the UE is authenticated by a Gateway (GW) to which the UE is attached and which provides access to the AF via a Broadband Access Network (BB Access Network). The method is characterized in that the GW informs a state database (SDB) on service flow requests to or from the authenticated UE towards the AF, that the GW additionally sends NAT (Network Address Translation) or NAPT (Network Address and Port Translation) binding information of a respective NAT or NAPT binding created by the GW regarding the authenticated UE and a respective service flow request to the SDB and that the SDB sends the NAT or NAPT binding information or an UE identifier to the AF, so that the AF—after having received the service flow request from the GW—can correlate the authenticated UE with the service flow request. Further an according network structure is claimed, preferably for carrying out the above mentioned method.
US09450918B2
Systems and methods for providing security, monitoring, and control of mobile communications device activity including at least one mobile communication device with software operable thereon for receiving rules provided by an authorized user of the device(s) and in accordance with those rules administering actions to provide for controlling, monitoring, and security data stored or generated on the device(s), including logging data and activities related to the mobile communications device, blocking and filtering calls, messages, websites, emails, and combinations thereof, via wireless communication with a remote server computer having a corresponding software module operable thereon for managing and implementing the rules.
US09450914B2
An addressing redirection mechanism is initiated at a first networking device in a computing network in order to enable the first networking device to perform one or more distributed proxy addressing operations on behalf of a connected second networking device. An address request transmitted from a first host device to a second host device to obtain addressing information of the second host device is received at the first networking device, and the first networking device inspects the address request to identify addressing information for the first host device. The first networking device is configured to forward the addressing information for the first host device to the second networking device.
US09450902B2
Disclosed herein is a technique for marking email threads as important. When an email thread is marked as important, all email messages belonging to the email thread are marked as important in an email user interface. Also, notifications are generated for any incoming messages belonging to the email thread that has been marked as important.
US09450897B2
A method and system for determining and sharing rich presence status of a user is presented. Multiple types of presence status options are associated with user's status based on location, activity, availability, transit status, and user's text updates, which the user can selectively share on their mobile device with different groups of users, and make one or more aspects of their presence status broadly available to everyone. Also a system to determine status based on auto-updates and manual updates is presented.
US09450886B2
Embodiments of the present invention provide a bandwidth adjustment method, a bus controller, and a signal convertor. The method includes: obtaining, by a bus controller, a first frequency and a first channel number; sending a bandwidth negotiation request carrying the first frequency and the first channel number to a bus controller of a first peer end to determine whether or not the bus controller of the first peer end is capable of controlling a physical component of the first peer end to receive data via a channel corresponding to the first channel number according to the first frequency; and receiving a negotiation result sent by the first peer end and controlling the physical component to transmit data according to the negotiation result. In the technical solutions of the embodiments of the present invention, bandwidth adjustment is flexible and the loss of data is avoided.
US09450882B2
In one embodiment, a method includes obtaining a potential bandwidth deduction at a call agent, the call agent being associated with an intercluster call admission control (CAC) arrangement in which bandwidth is shared, the potential bandwidth deduction being associated with a session. The method also includes determining whether the potential bandwidth deduction is a duplicate bandwidth deduction, deducting the potential bandwidth deduction from a bandwidth bucket when it is determined that the potential bandwidth deduction is not the duplicate bandwidth deduction, and ignoring the potential bandwidth deduction when it is determined that the potential bandwidth deduction is the duplicate bandwidth deduction.
US09450880B2
According to one embodiment, a method comprises an operation of determining whether an ingress control message is locally terminated control traffic on a digital device prior to the ingress control message being forwarded to a hardware processor of the digital device for processing. A priority is assigned to the ingress control message based on information within the ingress control message, if the ingress control message is determined to be locally terminated control logic.
US09450876B1
Workloads can be intelligently placed across a group of resources in order to attempt to balance or otherwise manage the level of wear among various components of those resources. Devices such as solid state drives or other NAND-type devices can have a limited number of operations that can be performed before those devices become unreliable, such that it can be desirable to monitor the wear level of each of these devices. As it can be easier to manage resources with similar wear levels for large groups of resources, it can be desirable to attempt to level the relative amount of wear among at least groups of these resources. Attempts can be made to level across a fleet or resources, within pools of resources, and/or within the resources themselves, such as where a server includes multiple devices with potentially different wear levels, such as multiple NAND-type devices.
US09450866B2
Exemplary methods for controlling forwarding table performance include a first network device in a control plane determining a first performance requirement of a first forwarding table in a forwarding plane based on an overall performance requirement of a plurality forwarding tables in the forwarding plane. In one embodiment, in response to determining the first forwarding table in the forwarding plane can be generated to satisfy the first performance requirement, the methods include the first network device sending a first message that includes the first performance requirement to a second network device in the forwarding plane, causing the second network device to generate the first forwarding table that satisfies the first performance requirement. In one embodiment, the exemplary methods include the second network device generating the first forwarding table that satisfies the first performance requirement included in the first message.
US09450858B2
At a first network device, a plurality of paths through a network from a source network device to a destination network device are determined. A vacant bandwidth is calculated for each of the plurality of paths. A primary path is selected from the plurality of paths based on the vacant bandwidth, and a standby path is selected from the plurality of paths based on the vacant bandwidth.
US09450853B2
A system for providing a secure management agent for high-availability continuity for cloud systems includes a computer processor and logic executable by the computer processor. The logic is configured to implement a method. The method includes receiving operating parameters and threshold settings for a plurality of computing clouds. Secure relationships are established with the plurality of computing clouds based on the operating parameters. Data is mirrored across the plurality of computing clouds. Threshold data is then monitored for the plurality of computing clouds to maintain a continuity of resources for the plurality of computing clouds.
US09450829B2
In one embodiment, a packet and a segment ID stack is received at a node. The segment ID stack includes a plurality of segment IDs, one or which is a first area-segment ID that identifies a first area of a subdivided network. One of a plurality of forwarding tables at the node is selected based on the first area-segment ID. Thereafter, the packet is forwarded based on information contained in the selected forwarding table.
US09450824B2
This disclosure relates generally to compensating for the impact of fluctuations in network communications and, more particularly, to systems and methods for optimizing transmission of web content. In one embodiment, a web content transmission optimization method is disclosed that includes receiving a request to transmit web content. The method may also include identifying, based on the request, a response that includes one or more response objects corresponding to the web content. The method may further include restructuring, by one or more processors, the response based on one or more configuration parameters. The method also comprises scheduling the restructured response and transmitting the requested web content according to the scheduled restructured response.
US09450819B2
Autonomic network sentinels are disclosed. An occurrence of a particular network condition is detected at a network entity. The network entity compares the particular network condition with one or more sample set rules of a first sample set of rules associated with the first network entity. The first sample set of rules comprise one or more rules from a full set of rules stored at a rule base. Each rule from the full set of rules represents a network condition and an action to be taken in response to an occurrence of the network condition. In response to determining that the particular network condition matches a particular rule from the first sample set of rules, the network entity notifies the rule base or one or more second network entities of the match.
US09450813B2
A method of automatically configuring a data network, the data network including a controller and a virtualization host with a hypervisor installed thereon, the method including creating a virtual switch in the hypervisor and communicatively coupling the virtual switch to a first physical network interface in the virtualization host. Further, the method includes receiving a request to boot an operating system image in a virtual machine in the hypervisor, the operating system image having network connectivity requirements. The method also includes creating a first virtual port in the virtual switch based upon the network connectivity requirements of the operating system image and creating a first virtual network adapter in the virtual machine in the hypervisor. Further, the method includes communicatively coupling the first virtual network adapter to the first virtual port in the virtual switch and configuring networking attributes of the first virtual network adapter in the virtual machine.
US09450805B2
A generic centralized, software-defined networking configuration for connecting network is defined as a generic multi-layer topology network entities interconnected either vertically or horizontally regardless of the employed network topology/graph). This centralized configuration enables establishment of a connection between any two networking entities by 1) bypassing intermediate protocol layers and 2) eliminating any handshaking between peer elements of the same layer. The centralized software-defined controller notifies in parallel all involved network entities along a connection path to take all necessary actions (i.e. reconfiguration) to establish the new connection. The centralized controller has authority to control only entities that are software-defined SD.
US09450802B2
A method of serving a resource from an HTTP server system having a stateless microkernel architecture and one or more link resource servers is provided. The method may include generating a data object in response to an HTTP request, sending the data object to each of the link resource servers, and at each link resource server receiving the data object from the handler and examining the data object for pre-determined information to perform a linking operation. The method may further include if the data object includes the pre-determined information, performing the linking operation by returning one or more links to the handler linking to related information provided by the link resource server. The method may further include if the data object does not include the pre-determined information, not performing the linking operation and instead returning one or more stop condition links indicating that the pre-determined information is not included.
US09450768B2
A method for subscriber tracing comprises capturing user plane packets in a network apparatus implementing a 3GPP policy and charging enforcement functionality PCEF. Packet-specific metadata is added to a captured user plane packet. The packet-specific metadata may be used for facilitating subscriber-specific troubleshooting of core network elements.
US09450761B2
According to one embodiment, a memory system includes a host interface, a first storage unit which stores data in a nonvolatile manner, and a memory controller. The memory controller includes a management information generating unit which generates command information for every command received from a host through the host interface and a digital signature calculating unit which generates a digital signature from the command information using a secret key. The management information generating unit generates management information which contains the command information and the digital signature for the every command.
US09450756B2
A method and a system for authenticating an entity based on a symmetric encryption algorithm are provided. The method includes the following steps: 1) an entity A sends an authentication request message to an entity B; 2) after receiving the authentication request message, the entity B sends an authentication response message to the entity A; 3) the entity A determines the validity of the entity B according to the received authentication response message. The implementation cost of the system can be reduced by using the authentication according to the invention.
US09450749B2
A one-time-pad encryption system where encrypted one-time-pad keys can be distributed to users on physical media or on a computer network from a central server. Each one-time-pad key has a key identification number that facilitates key management. Each encrypted data set includes a header specifying an offset within the one-time-pad key for commencement of decryption so that messages can be decrypted in any order. Before encryption begins, the length of remaining unused key is compared to the length of the data set to be encrypted. Encryption control buttons are added to a word processor and other programs as an addition to the user interface.
US09450734B2
Provided is a wireless communication mobile station device by which a throughput can be improved in multicarrier communication. In the device, a group control section (107) controls a subcarrier group, of which CQI is to be reported, among a plurality of subcarrier groups to periodically change, by following pattern information. For instance, the group control section (107) changes the subcarrier group whose CQI is to be reported, by frame or TTI (Transmission Time Interval). Furthermore, the group control section (107) specifies the subcarrier group whose CQI is to be reported, to an SINR detecting section (108) and a CQI generating section (109).
US09450728B2
Systems and methodologies are described that facilitate arrangement and transmission of control information in a wireless communication system. As described herein, a scheduled transmission of acknowledgement (ACK) signaling and channel quality information (CQI) signaling in a common subframe can be adapted for network implementations with limited link budget wherein ACK signaling is configured for repetition over multiple subframes to ensure a desired error rate level for the ACK signaling. To these ends, various aspects described herein facilitate modification of a coding rate applied to ACK signaling to be transmitted with data based on a repetition factor of the ACK signaling. Additionally and/or alternatively, various aspects described herein facilitate dropping of CQI signaling and transmission of only ACK signaling on subframes where CQI and ACK signaling are to be transmitted substantially simultaneously and ACK transmission is configured for repetition over multiple subframes.
US09450726B2
A method of performing link adaptation in a wireless local area network system by a mobile station The mobile station receives a first physical layer protocol data unit (PPDU) transmitted by an access point (AP) via multi-user multiple input/multiple output (MU MIMO) transmission to a plurality of mobile stations. The first PPDU includes a first feedback sequence identifier that includes a value identifying the plurality of mobile stations. When the mobile station is one of the plurality of mobile stations identified by the value included by the first feedback sequence identifier, a modulation and coding scheme (MCS) is estimated based on the first PPDU. The mobile station transmits a second PPDU to the AP. The second PPDU includes channel information about the estimated MCS and a second feedback sequence identifier. The second feedback sequence identifier includes the value included by the first feedback sequence identifier.
US09450724B2
A method for transmitting a sounding reference signal (SRS) in a wireless communication system is provided. A user equipment receives downlink control information from a first serving cell and transmits a SRS through a second serving cell. If the first serving cell is a FDD cell and the second serving cell is a TDD cell, the downlink control information includes an aperiodic SRS request. If the first serving cell is the TDD cell and the second serving cell is the FDD cell, the downlink control information does not include the aperiodic SRS request.
US09450716B2
Communication methods for receiving and demodulating in mobile devices signals from multiple locations and for providing baseband position finder signal. Providing in a first cross-correlator and filter cross-correlated in-phase and quadrature-phase filtered baseband signals from a digital input signal and in a second cross-correlator spread spectrum signals from a voice input signal. Providing Orthogonal Frequency Division Multiplex (OFDM) signal from a video input signal. Combining baseband position finder signal with one or more of cross-correlated in-phase and quadrature-phase filtered baseband signals, or cross-correlated in-phase and quadrature-phase spread spectrum baseband signals, or OFDM baseband signal, into a combined baseband signal and modulating and transmitting combined signal. Touch screen control signal for control of mobile devices.
US09450710B2
A method and apparatus for compressing resources used for transmitting acknowledgment signals from User Equipments (UEs). An acknowledgment signal is in response to detections from a UE of one or more Physical Downlink Control CHannels (PDCCHs) in respective one or more Transmission Time Interval (TTIs) within M TTIs. Each PDCCH is transmitted over Control Channel Elements (CCEs). Resources account for both CCEs in a same TTI and for TTIs within the M TTIs. A Hybrid Automatic Repeat reQuest (HARQ) Acknowledgment Resource Offset (HRO) field in a Downlink Control Information (DCI) format is used to compress resources in both CCE and TTI domains. For the first TTI of the M TTIs, all HRO values compress resources in the CCE domain while for all remaining TTIs, half HRO values compress resources in the CCE domain and half HRO values compress resources in the TTI domain.
US09450691B2
A method is disclosed for synchronizing network subscribers in an on-board network of a vehicle, the method comprising: receiving a message dependent on a first clock present in a first network subscriber by at least one second network subscriber if a predetermined condition has been satisfied, and synchronizing a second clock in the second network subscriber on the basis of the message dependent on the first timer if the predetermined condition has been satisfied.
US09450690B2
In various embodiments, a plurality of automated monitoring and control system modules (automated monitoring and control system module) are individually connected to respective receiving devices via the audio and video output ports of each respective receiving device. Each automated monitoring and control system module may be configured to receive a testing program from a centralized monitoring system for the receiving device based on identification data of the receiving device and execute the received testing program for the receiving device. Each automated monitoring and control system module is connected to the centralized monitoring system over a local area network (LAN) or the Internet in order to send testing results, diagnostic data and captured video and audio data for further processing by the centralized monitoring system.
US09450679B2
An optical receiver includes: an optical receiving device configured to generate an analog received signal that represents a received modulated optical signal; an A/D converter configured to generate a digital received signal from the analog received signal; an E/O circuit configured to generate an optical digital signal from the digital received signal; an O/E circuit configured to generate an electric digital signal from the optical digital signal; and a digital signal processor configured to recover a data signal from the electric digital signal.
US09450674B2
A method and apparatus of compensating for compact digital domain chromatic dispersion. The distortion of an optical signal due to chromatic dispersion is compensated by a digital signal processing in the electrical domain, either prior to the optical transmitter or following the receiver. The circular coefficient approximation and sub-band processing reduce the amount of computations to execute a given level of chromatic dispersion compensation compared to a direct finite impulse response filter implementation.
US09450647B2
Described herein are techniques related to one or more systems, apparatuses, methods, etc. for a wireless fidelity (Wi-Fi) based wireless docking station arrangement.
US09450646B2
An NFC initiator device requests a passive communication mode by modulating a request onto a first carrier signal. In response thereto, the target device transmits a second carrier signal while still receiving the first carrier signal from the initiator device. The target device may modulate data onto the second carrier signal to convey information to the initiator device. The initiator device may detect changes in the load provided by the target device to interpret the data conveyed by the target device.
US09450636B2
An intrinsically safe audio power circuit includes redundant electronic fuses disposed between the power input of an audio power amplifier and the battery source of the portable two-way radio device. The electronic fuse circuits are connected in series with each other, and each electronic fuse circuit includes a series switch transistor that can shut off the flow of current between the battery and the audio power amplifier. Each electronic fuse circuit also includes a current sense portion, and when the current through the electronic fuse circuits reaches a current threshold, it will shut off its series switch transistor using an active bias circuit in order to ensure sufficiently rapid shut off.
US09450635B2
Apparatus and methods for cableless connection of components within chassis and between separate chassis. Pairs of Extremely High Frequency (EHF) transceiver chips supporting very short length millimeter-wave wireless communication links are configured to pass radio frequency signals through holes in one or more metal layers in separate chassis and/or frames, enabling components in the separate chassis to communicate without requiring cables between the chassis. Various configurations are disclosed, including multiple configurations for server chassis, storage chassis and arrays, and network/switch chassis. The EHF-based wireless links support link bandwidths of up to 6 gigabits per second, and may be aggregated to facilitate multi-lane links.
US09450626B2
An apparatus including: at least one differential amplifier configured to amplify a radio frequency signal; a mixer configured to mix the radio frequency signal from the at least one differential amplifier with a local oscillator signal; and a low-pass filter coupled to the mixer, the low-pass filter includes a capacitor and at least one variable resistor configured to tune the low-pass filter.
US09450625B2
Methods, systems, and computer readable media for wideband frequency and bandwidth tunable filtering are disclosed. According to one aspect, the subject matter described herein includes a wideband frequency and bandwidth tunable filter that splits a filter input signal into first and second input signals, modifies the first input signal to produce a first output signal, modifies the second input signal to produce a second output signal having an intermediate frequency response, and combines the first and second output signals while adjusting their relative phases and/or amplitudes to produce a filter output signal with the target frequency response. Adjustment includes splitting the second input signal into third and fourth input signals, which are modified and then combined to produce the second output signal having the intermediate frequency response.
US09450613B2
A circuitry comprising a syndrome generator configured to generate a syndrome based on a parity check matrix and a binary word comprising a first set of bits and a second set of bits is provided. For the first set of bits an error correction of correctable bit errors within the first set is provided by the parity check matrix and for the second set of bits an error detection of a detectable bit errors within the second set is provided by the parity check matrix.
US09450610B1
A nonvolatile memory controller includes memory storage configured to store a two-index look-up table that includes a Log-Likelihood Ratio (LLR), hard-and-soft-decision bits associate with the LLR and a neighboring cell read pattern associated with the LLR. Read circuitry is configured to perform a plurality of reads of a cell of a nonvolatile memory storage module at different read voltage levels to generate target cell hard-and-soft-decision bits and configured to read neighboring cells to generate neighboring cell reads. Neighboring cell processing circuitry combines the neighboring cell reads to generate a neighboring cell read pattern. Look-up circuitry accesses the two-index look-up table using the target cell hard-and-soft-decision bits and the neighboring cell read pattern to identify the corresponding LLR for use in Low-Density Parity Check (LDPC) decoding of a codeword stored in the nonvolatile memory storage module.
US09450589B2
In some embodiments, a tight loop mode is provided is which most, if not all of, the clock distribution circuitry may be bypassed during an initial frequency lock stage.
US09450588B2
A voltage controlled oscillator (VCO) includes a sensing circuit, where the sensing circuit is configured to generate a plurality of compensation control signals. The VCO further includes a voltage-to-current converter comprising a plurality of current sources which are configured to generate a current signal in response to the plurality of compensation control signals. Additionally, the VCO includes a plurality of switching circuits, each of the plurality of switching circuits being configured to selectively enable or disable a corresponding one of the plurality of current sources in response to a corresponding one of the plurality of compensation control signals. Furthermore, the VCO includes a current controlled oscillator configured to generate an oscillating signal in response to the current signal.
US09450582B2
A programmable buffer system includes a plurality of programmable resources. Each of the programmable resources includes, in an unconfigured state, a buffer with multiple entries, an input multiplexer, and an output multiplexer. Configuration information registers specify whether each of the programmable resources is configured as one of a group consisting of: a logic block, a shift register, and a state record, and which of a plurality of timer signals is to be provided to each of the plurality of programmable resources.
US09450581B2
A drive capability of a dynamic logic circuit is improved. A logic circuit includes a dynamic logic circuit, a first output node, a first transistor that is diode-connected, and a capacitor. The dynamic logic circuit includes a second output node. The first transistor and transistors in the dynamic logic circuit have an n-type conductivity or a p-type conductivity. The first output node is electrically connected to a first terminal of the capacitor, and the second output node is electrically connected to a second terminal of the capacitor. A first terminal of the first transistor is electrically connected to the first output node, and a first voltage is input to a second terminal of the first transistor.
US09450580B2
An integrated circuit including a global supply bus, a gated supply bus, a functional circuit coupled to the gated supply bus, a programmable device that stores a programmed control parameter, and a digital power gating system. The digital power gating system includes gating devices and a power gating control system. Each gating device is coupled between the global and gated supply buses and each has a control terminal. The power gating control system controls a digital control value to control activation of the gating devices. The power gating control system is configured to perform a power gating operation by adjusting the digital control value to control a voltage of the gated supply bus relative to the voltage of the global supply bus. The power gating operation may be adjusted using the programmed control parameter. The programmable device may be a fuse array or a memory programmed with programmed control parameter.
US09450575B2
A current comparator may include a current comparison block configured to compare current flowing through first and second input terminals; a first current control unit configured to control current flowing through the first input terminal in response to a voltage of a first node; a second current control unit configured to control current flowing through the second input terminal in response to a voltage of a second node; a first driving unit configured to drive the first node with a first voltage higher than a read voltage in a non-comparison period, and drive the first node with the read voltage in a comparison period; and a second driving unit configured to drive the second node with a second voltage higher than a reference voltage in the non-comparison period, and drive the second node with the reference voltage in the comparison period.
US09450559B2
An impedance matching device includes a first variable capacitor connected to an RF power source and including a first shaft moving linearly, a first linear motion unit axially coupled to the first shaft of the first variable capacitor to provide linear motion, a first insulating joint connecting the first shaft to a first driving shaft of the first linear motion unit, and a first displacement sensor adapted to measure a movement distance of the first driving shaft of the first linear motion unit.
US09450556B2
Surface mount components and related methods involve thin film circuits between first and second insulating substrates. The thin film circuits may include passive components, including resistors, capacitors, inductors, arrays of such components, networks, or filters of multiple passive components. Such thin film circuit(s) can be sandwiched between first and second insulating substrates with internal conductive pads which are exposed to the outside of the surface mount component and electrically connected to external terminations. External terminations may include at least one layer of conductive polymer. Optional shield layers may protect the surface mount components from signal interference. A cover substrate may be formed with a plurality of conductive elements that are designed to generally align with the conductive pads such that conductive element portions are exposed in groups along surfaces of a device.
US09450547B2
A system and method for packaging a semiconductor device that includes a wall to reduce electromagnetic coupling is presented. A semiconductor device has a substrate on which a first circuit and a second circuit are formed proximate to each other. An isolation wall of electrically conductive material is located between the first circuit and the second circuit, the isolation wall being configured to reduce inductive coupling between the first and second circuits during an operation of the semiconductor device. Several types of isolation walls are presented.
US09450538B2
It is disclosed a mixer arrangement for complex signal mixing comprising a first harmonic rejection mixer, and a second harmonic rejection mixer. Each of the harmonic rejection mixers comprises mixer unit cells wherein each mixer unit cell comprises a differential input, transconductance elements corresponding to the differential input, and a switching network arranged to switch signals from the transconductance elements to a differential output, and the first and the second harmonic rejection mixers have mutual quadrature phase relationship. The first and the second rejection mixer share a plurality of mixer unit cell, each comprising an input for receiving a signal to be mixed, an input for receiving control signals derived from a local oscillator signal, and one output for each of the first and second harmonic rejection mixers. A radio circuit comprising such a mixer arrangement and a communication apparatus comprising such a radio circuit are also disclosed.
US09450533B2
An electric fan has a drive motor having a fan rotor, an apparatus for generating a rotation speed signal (n_i), an apparatus for generating a power level signal (P_i) that represents power consumed; a first regulator (n_RGL) for regulating the rotation speed signal (n_i) to a predefined target value (n_s); a second regulator (P_RGL) for regulating the power level signal (P_i) to a predefined power level signal target value (P_s) that corresponds to a predefined minimum consumed power level (P_min), where the first regulator (n_RGL) and the second regulator (P_RGL) apply at least one control output signal (SW) to the drive motor and interact in such a way that, during operation, the at least one control value (SW) in a first state is determined by the first regulator (n_RGL), and in a second state is determined by the second regulator (n_RGL).
US09450527B2
Apparatus for generating and supplying electrical power to AC loads on an aircraft may include a prime mover, an exciter generator rotatably coupled to the prime mover and a main generator with a main generator rotor electrically coupled to the exciter generator to receive AC power from the exciter generator. One or more capacitors may be electrically coupled to the main generator rotor to increase a power factor of the main generator rotor.
US09450525B2
An electric motor control system includes an inverter, an element temperature observation data acquiring device, a rotational speed upper limit setting device, and a rotational speed limiter. The inverter includes switching elements. The element temperature observation data acquiring device is configured to acquire element temperature observation data indicating an observation value of a temperature of the switching elements of the inverter. The rotational speed upper limit setting device is configured to set a rotational speed upper limit of an electric motor in accordance with the observation value of the temperature of the switching elements so as to satisfy a first condition that a voltage applicable to the switching elements in a case where the electric motor is operated at the rotational speed upper limit is lower than or equal to a withstand voltage of the switching elements.
US09450518B2
An on-chip power converter and an on-chip switching power supply implemented using a film bulk acoustic resonator (FBAR) in place of an inductor. This MEMS device offers high inductance density and high Q factor. FBARs can be conveniently fabricated in a CMOS compatible process. FBARs also shows better EMI results than conventional inductors.
US09450514B2
The present disclosure discloses a method and an apparatus implementing the method for minimizing a circulating current of parallel-connected inverters. The method can include, for at least one parallel-connected inverter, measuring a common-mode voltage of the inverter, and controlling a cycle length of the switching cycle on the basis of the common-mode voltage.
US09450511B1
A full wave rectifier (270) for use as part a differential signal detector (400) detects both high and low envelopes of differential signals (RXa, RXb) at a pair of differential inputs (202, 204) and provides a sense signal (VSENSE) at an output (220) thereof. The differential signal detector (400) includes both the full wave rectifier (270) and a voltage reference source (260) having a circuit architecture in common, and a comparator for comparing the sense signal (VSENSE) with a reference voltage (VREF). The circuit configuration of both the full wave rectifier (270) and the voltage reference source (260) include first and second differential input circuits (271 and 273, 261 and 263) each including a pair of field effect transistors (2722, 2742 and 2762, 2782; 2622, 2642 and 2662, 2682) of different conductivity type having respective source terminals (2728, 2748; 2768, 2788; 2628, 2648; 2668, 2688) coupled together.
US09450505B2
An optoelectronic component device includes a first group of optoelectronic components including at least one first optoelectronic component, wherein the at least one first optoelectronic component provides electromagnetic radiation of a first color valence, a second group of optoelectronic components including at least one second optoelectronic component, wherein the at least one second optoelectronic component provides electromagnetic radiation of a second color valence, and a phase dimmer, wherein the phase dimmer is designed in such a way that a first operating mode and a second operating mode are provided, wherein the phase dimmer actuates the first and the second group of optoelectronic components in such a way that, in the first operating mode, a first array of optoelectronic components of the optoelectronic component device is energized and, in the second operating mode, a second array of optoelectronic components of the optoelectronic component device is energized.
US09450504B2
Rectifier circuit including a pair of input terminals, a pair of output terminals, and a first circuit interconnecting the pair of input terminals. The first circuit includes an energy storing element and a rectifier bridge, wherein the rectifier bridge includes at least one controllable switching element per bridge branch. An output of the rectifier bridge supplies the pair of output terminals and wherein the at least one controllable switching element per bridge branch is configured to provide a temporary conducting path via the rectifier bridge which bypasses the pair of output terminals and which short-circuits a series connection of the energy storing element and an energy source connectable to the pair of input terminals. A converter for synchronized switch harvesting on inductor including such a rectifier circuit and a method for rectifying an electrical current generated by an energy source are also described.
US09450496B2
A multi-stage power converter includes a pre-regulator circuit configured to provide a regulated output voltage, at least one DC/DC converter, and a control circuit coupled to the pre-regulator circuit and the DC/DC converter. The DC/DC converter is configured to provide an output voltage and an output current to a load. The DC/DC converter includes an input, an output, and at least one power switch. The input of the DC/DC converter is coupled to the pre-regulator circuit. The control circuit is configured to regulate the output voltage of the DC/DC converter and vary the regulated output voltage of the pre-regulator circuit as a function of the output current of the DC/DC converter.
US09450491B2
A circuit including: a three-level buck converter having: a plurality of input switches and an inductor configured to receive a voltage from the plurality of input switches, the plurality of input switches coupled with a first capacitor and configured to charge and discharge the first capacitor; a second capacitor at an output of the buck converter; and a switched capacitor at an input node of the inductor, wherein the switched capacitor is smaller than either the first capacitor or the second capacitor.
US09450487B2
A DC to DC converter includes an inductor having a first terminal and a second terminal, the first terminal coupled to an input of the DC to DC converter and the second terminal being coupled to an output of the DC to DC converter. A first switch is coupled between the second terminal and a current sensor. The switch controls current flow through the inductor and generates an inductor current signal representative of the current flow through the sensor. A slope generator generates a slope compensation signal. A first mixer adds the slope compensation signal to the inductor current signal. A sample and hold circuit samples a portion of the slope compensation signal. A second mixer subtracts the sampled portion of the slope compensation signal from the output of the first mixer, wherein inductor charging is terminated in response to the output of the first mixer.
US09450484B2
An AC-DC power converter includes a rectifying unit for generating a rectified voltage, an output stage for converting the rectified voltage into a DC voltage for a load, a controller for controlling the output stage, and a start-up circuit. The start-up circuit includes a start-up voltage generator coupled to the rectifying unit and configured to generate a start-up voltage from the rectified voltage and to output the start-up voltage to the controller to provide power for operation of the controller before the output stage starts outputting power. The start-up voltage generator includes a first depletion mode transistor having a first terminal configured to receive the rectified voltage, a second terminal configured to output at least partially the start-up voltage, and a gate terminal which is grounded.
US09450483B2
An apparatus and a method for controlling an inverter are disclosed. The apparatus determines a 3-phase current by receiving a 2-phase current from a leg-shunt resistor arranged at an emitter terminal of a lower switching element in an inverter unit of an inverter, and determines whether there is an abnormality generated in the 3-phase current, to correct the abnormality in the current.
US09450478B1
A controller for a power converter that may sense whether the power converter is in a light load condition. If the power converter is a light load condition, the switching frequency may be within the audible noise range. Once the controller senses the light load condition, the controller may modulate the switching frequency of the power switch such that the switching frequency is no longer within the audible noise range. The controller comprises of a current limit generator coupled to generate an initial current limit signal and receive a feedback signal. The controller may sense a light load condition of the power converter and output a light load signal. As a result of the light load signal, the controller may modulate the initial current limit in response to the light load signal indicating a light load condition.
US09450474B2
A motor, comprising an electronics housing, a stator having a stator bushing, and a rotor. The motor can be fastened to a fastening wall by means of the stator bushing. The motor according to the invention has an air conducting element and an air conveying element. The air conveying element is connected to the rotor in a rotationally fixed manner. The air conducting element surrounds the stator bushing and forms a flow space between the air conducting element and an outer circumference of the stator bushing. The flow space is open on the side of the electronics housing in the direction of the fastening wall through at least one flow gap. The air conducting element opens with an intake opening via a sealing gap in a rotor-side throughflow opening of the air conducting element.
US09450473B2
According to one embodiment, a motor for a vehicle includes a casing accommodating a rotor and a stator iron core inside thereof, and supporting each of both axial ends of the rotor shaft via a bearing, an air inlet port formed in a portion of the casing outside the bearing in the radial direction, and a fan provided between the rotor iron core and the bearing and rotating with the rotor shaft, wherein a portion of the casing positioned outside impellers of the fan in the axial direction forms a first housing and a second housing constituting a discharge channel, and the first housing includes a guide wall extending toward the outside in the radial direction, and the second housing includes a thinned wall portion located inside the guide wall in the axial direction to constitute the discharge channel between the thin wall portion and the guide wall.
US09450462B2
An axial flux machine comprising a rotor mounted about an axis of rotation and having two axial faces. A first stator ring is positioned on the rotor adjacent to a first axial face, to define an air gap, between the first stator ring and first axial face. The first stator ring is formed by stator ring segments, each having a radially inner and outer edge. A second stator ring is positioned on another side of the rotor, adjacent to the second axial face, to define an air gap between the second stator ring and second axial face. The second stator ring is, also, formed by stator ring segments, each having a radially inner and outer edge and corresponding to a first stator ring segment. The stator ring segments are deflectable in unison in response to axial deflection of the rotor, to maintain the air gaps, due to link elements.
US09450457B2
In a method of manufacturing a spindle motor, a sheet preferably made of a thermoplastic resin is closely adhered to an upper surface of a base portion of a spindle motor such that the sheet covers a base hole of the base portion. Next, heat is applied to a region of the sheet which coincides with the base hole to define a sheet hole continuous with the base hole. Thereafter, a coil is arranged over the base portion, and a conducting wire defining the coil is extended through the sheet hole and the base hole to be drawn downwardly out of the base portion. The sheet hole is thus defined after the sheet is closely adhered to the base portion. In addition, the sheet hole is defined by melting the resin through application of the heat. It is therefore easy to arrange the sheet and define the sheet hole.
US09450451B2
According to one embodiment, a system includes a battery to charge power and discharge a direct-current power to a converter, the converter supplying the converted power to a power system, detectors detecting a voltage at a point between the converter and power system, a current output from the converter and effective power from the voltage value and a current value detected, units computing an angular frequency of the voltage output from the converter, based on an effective power value and an output target value of effective power and an output voltage target value of the converter, based on a current value, a set voltage value and an angular frequency, and a controller controlling the converter according to the output voltage target value.
US09450440B2
An embodiment provides an apparatus, including: apparatus components; a battery pack comprising a high charge rate cell component, the battery pack supplying power to one or more of the apparatus components; a processor; and a memory device accessible to the processor and storing code executable by the processor to: apply a normal rate of charge to a cell component of the battery pack; accept user input to switch the normal rate of charge to a second rate of charge which is higher than the normal rate of charge; and apply the second rate of charge to the high charge rate cell component based on the user input. Other aspects are described and claimed.
US09450431B2
One embodiment of the invention is directed to a rechargeable battery pack configured to provide power to a device that also accepts at least one standard non-rechargeable battery. The rechargeable battery pack comprises a housing for housing at least one battery cell and recharging circuitry. The at least one battery cell and the recharging circuitry is be housed substantially within the housing. The recharging circuitry is coupled with the at least one battery cell. The recharging circuitry is configured to charge the at least one battery cell when the battery pack is inserted into the device that also accepts at least one non-rechargeable battery. The rechargeable battery back further comprises a protection circuit coupled with the recharging circuitry.
US09450427B2
In a method for determining the state of charge of an electrical accumulator, individual cell voltages are recorded, and the highest and/or the lowest individual cell voltage is ascertained. A present maximum charge and/or a present minimum charge of the appertaining accumulator cell is determined using a characteristic curve and the highest and/or the lowest individual cell voltage.
US09450423B2
Disclosed is a wireless power transmission apparatus. The wireless power transmission apparatus includes a mounting member, an upper transmission coil on the mounting member, a lower transmission coil under the mounting member, a first terminal connected with an outer connection part of the upper transmission coil and an inner connection part of the lower transmission coil, and a second terminal connected with an inner connection part of the upper transmission coil and an outer connection part of the lower transmission coil. The upper transmission coil and the lower transmission coil are bilaterally symmetrical to each other about a central axis between the first and second terminals.
US09450422B2
Disclosed is an apparatus for use in wireless energy transfer, which includes a first resonator structure configured to transfer energy non-radiatively with a second resonator structure over a distance greater than a characteristic size of the second resonator structure. The non-radiative energy transfer is mediated by a coupling of a resonant field evanescent tail of the first resonator structure and a resonant field evanescent tail of the second resonator structure.
US09450420B1
Devices and methods for conveying energy through a watertight enclosure can include placing at least one means for converting electrical energy into vibrational mechanical energy in direct contact with the enclosure. At least one means for harvesting the vibrational mechanical energy from the enclosure into electrical energy can also be placed in direct contact on the enclosure, on the opposite side of the enclosure from the conversion means. The conversion means and harvesting means both operate at a matching frequency ω. A plurality of transducers generating vibrations at frequency ω can be used in conjunction with harvester, or vice versa. Or, a plurality of transducers operating at discrete frequencies ωn can be used in conjunction with a plurality of harvesters operating at matching frequencies ωn. These configurations can be used to transmit electrical energy through the watertight enclosure without breaking the watertight integrity of the enclosure.
US09450393B2
An enclosure system for receiving a cable includes an enclosure having an inner chamber and an open position exposing the inner chamber and a closed position covering the inner chamber. A cable receiving port in a wall of the enclosure extends along a longitudinal axis from outside of the enclosure into the inner chamber. The cable receiving port is configured to receive a cable therein when the cable is advanced axially into the port without rotation of the cable when the enclosure is in the closed position. A mating member is associated with the cable receiving port that limits rotation of the cable when the cable is advanced axially into the port. An axial retention member is associated with the cable receiving port that limits axial movement of the cable out of the port when the cable is advanced axially into the port to a lock position.
US09450388B2
A multi-function wire stripping band tool generally for electricians that has a wire stripping system for a controlled cut and strip of the insulation from a wire. The tool includes an elongated body member having a longitudinal cavity and a transverse opening therein which communicates with the longitudinal cavity and one end of the body member. A stationary cutting blade is disposed in the inner end of the longitudinal cavity, and a movable cutting blade is movably mounted within an upper end of the longitudinal cavity. A spring is disposed between and engaged with a push button actuator so as to urge the movable blade to an open and retracted position. The wire stripping system is engaged with a handle region of the hand tool, and permits stripping in a direction that is perpendicular a longitudinal axis of the multi-function hand tool. The wire stripping system may be used from either side of the hand tool, and may be provided with a plurality of first and second operably engaged housings for securing a number of tool bit members.
US09450384B2
Method and apparatus for minimizing exposure to live parts in the panelboard allow safe insertion and removal of a circuit breaker from the panelboard. The method and apparatus provide a shutter assembly that automatically closes off access to conductors in the panelboard until a circuit breaker is inserted in the panelboard. Inserting the circuit breaker in the panelboard causes the shutter assembly to open and allow the circuit breaker to contact the conductors. When the circuit breaker is removed from the panelboard, access to the conductors is automatically closed off again. Such a shutter assembly allows operators to safely insert and remove a circuit breaker and other electrical device from the panelboard.
US09450381B1
After forming a first trench extending through a top semiconductor layer and a buried insulator layer and into a handle substrate of a semiconductor-on-insulator (SOI) substrate, a dielectric waveguide material stack including a lower dielectric cladding layer, a core layer and an upper dielectric cladding layer is formed within the first trench. Next, at least one lateral bipolar junction transistor (BJT), which can be a PNP BJT, an NPN BJT or a pair of complementary PNP BJT and NPN BJT, is formed in a remaining portion of the top semiconductor layer. After forming a second trench extending through the dielectric waveguide material stack to re-expose a portion of a bottom surface of the first trench, a laser diode is formed in the second trench.
US09450377B1
A laser diode assembly contains a plurality of laser diode chips packaged closely in a row. Each laser diode chip is bonded on both P-side and N-side to first and second sub-mounts. The sub-mounts are then attached to a cooling carrier, with both bonding surfaces perpendicular to the top surface of the carrier. The direction of laser radiation is parallel to the carrier top surface, and the distance between the top of the active area of the laser diode chip and the carrier is preferably in a range of half a pitch between individual laser sources packaged in a row or preferably in a range of 0.2 mm to 1 mm to allow efficient cooling for high power operation. The sub-mounts may be electrically conductive, or they may be of insulating material at least partially covered with a conducting layer. A laser diode chip is bonded uniquely to a set of sub-mounts or may share a sub-mount with another laser diode chip.
US09450374B2
There is provided a system for remote pumping of a Raman fiber amplifier comprising a pump laser located remotely from the Raman fiber amplifier and a laserhead and one or more optical fibers to optically couple the high power pump light from the remote pump laser to the Raman fiber amplifier where a seed laser light is amplified wherein the pump laser for producing a high power laser light of a predetermined pump wavelength comprises a first fiber laser emitting light at the predetermined pump wavelength and one (second) or two (third) laser emitting light at a wavelength lower than the predetermined pump wavelength and multiplexed with light from the first laser into an optical fiber providing Raman gain at the predetermined pump wavelength to convert the second (and optionally also the third) laser light to light at the predetermined pump wavelength.
US09450363B2
An adaptor may include a base modular unit that includes a plurality of surface connectors, a first port and circuitry. At least one surface connector may couple to an expansion modular unit. Circuitry or logic may provide information from the first port to the at least one surface connector.
US09450358B2
Technology is provided for a powered slide rail. The powered slide rail includes an outer segment including a first elongate conductor, a middle segment slidably nested with the outer segment that includes a second elongate conductor, and a first conductive element connected to the second elongate conductor and positioned for sliding contact with the first elongate conductor. An inner segment is slidably nested with the middle segment and includes a second conductive element positioned for sliding contact with the second elongate conductor.
US09450355B2
A USB plug connector (100) includes an insulative housing (1) having a main portion (11) and a tongue portion (12), a number of contacts (2), and a metal shell (3). The tongue portion has an upper surface (16), a lower surface (17), a pair of lateral surfaces (18), and a frontal vertical surface (121). A pair of recesses (122) is defined on both sides of the upper surface and the lower surface. An interspace (181) is defined between each lateral surface of the tongue portion and the main portion. The metal shell includes a front wall (31), a pair of horizontal walls (32), and a pair of vertical walls (34). Each vertical wall includes a rigid beam (342) inserted in the interspace and a pair of wing portions (343) received in the recesses. A method for manufacturing the USB plug connector is also disclosed.
US09450347B2
A power cord includes a plug having blades configured to be inserted into blade insertion holes of an electrical outlet, respectively. The power cord further includes thermal sensors provided for the blades one each. When a temperature detected with any of the thermal sensors is higher than a prescribed temperature, electric power is stopped from being supplied to a load from the blades.
US09450344B2
A modular electrical connector with separately shielded signal conductor pairs. The connector may be assembled from modules, each containing a pair of signal conductors with surrounding partially or fully conductive material. Modules of different sizes may be assembled into wafers, which are then assembled into a connector. Wafers may include lossy material. In some embodiments, shielding members of two mating connectors may each have compliant members along their distal portions, such that, the shielding members engage at points of contact at multiple locations, some of which are adjacent the mating edge of each of the mating shielding members.
US09450342B2
An plug connector assembly (1) includes a mating member (10) including a front mating end (101) and a rear mating end (102), a cable (30) electrically connected with the mating member, a first shell (50) formed by sheet metal drawing and having a closed circumference, a second shell (60) formed by sheet metal drawing and having a closed circumference. The first shell includes a first front end (51) telescoped with the rear mating end, and a first rear end (52) opposite to the first front end. The second shell (60) includes a second front end (61) telescoped with the first rear end, and a second rear end (62) opposite to the second front end and telescoped on the cable.
US09450341B2
An electrical plug connector has an insulative housing, two terminal sets, a shielding-grounding plate and a shell. The terminal sets are mounted in the insulative housing and each terminal set has multiple conductive terminals. The shielding-grounding plate is mounted in a rear end of the insulative housing and has a shielding body mounted in the rear end of the insulative housing and located between the terminal sets and two resilient hooking arms formed on and protruding forward respectively from two opposite sides of the shielding body and extending in the insulative housing. The shielding-grounding plate is located above the conductive terminals of the two terminal sets and shields the terminal sets such that each terminal set would not interfere with the other terminal set with cross talk when implementing signal transmission.
US09450337B2
An electrical plug connector includes an insulating housing, two terminal sets, and a metallic component. The insulating housing includes a front portion and a rear portion, and a receiving cavity is formed inside the front portion. The two terminal sets separately include a plurality of terminals and are arranged in an upper-row terminal set and a lower-row terminal set. Each terminal includes a contact portion disposed in the receiving cavity, a retaining portion retained in the insulating housing, and a soldering portion disposed in the rear of the insulating housing. The metallic component includes a plate body and two latches. The plate body is disposed in the rear portion and clamped between the upper-row and lower-row terminal sets. The two latches are separately disposed at two sides of the plate body and symmetrical to each other. The plate body and the two latches are formed in one piece.
US09450324B2
A power connector for a vehicle includes a receptacle with a central opening that can receive a cylindrical connector. Within the central opening are a center contact and a number of electrical contacts arranged in a generally circular configuration around the center contact. The receptacle further includes an extension area on either side of the central opening that hold one or more additional electrical contacts. A pair of covers are configured to open to expose the additional contacts and the center contact with the surrounding circular configuration of contacts. With both covers open, all the contacts in the receptacle are exposed.
US09450318B2
In the terminals of the first electrical connector, the elastic arm portions are formed such that their width dimensions in the array direction of the above-mentioned terminals are smaller than the securing arm portions; in the terminals of the second electrical connector, the sections that correspond to the securing arm portions are formed such that their width dimensions are smaller than the sections that correspond to the elastic arm portions; on the elastic arm portions side, the terminals of the first electrical connector are formed such that their width dimensions are smaller than the terminals of the second electrical connector; and on the securing arm portions side, the terminals of the second electrical connector are formed such that their width dimensions are smaller than the terminals of the first electrical connector.
US09450315B2
An electrical connector for connecting a conductor with three fixations and particularly suitable for medium and high voltage applications. The connector body includes a body part with an inner profile adapted to receive the conductor and a cover part provided with two keepers that are fastened to the body part for providing the first and the second fixation of the conductor to the body part, respectively. The third fixation of the conductor is provided by an inner keeper that is partially covered by the two outer keepers. The inner keeper includes a contact element that is disposed transversally over the conductor and attached to the body part by a U-bolt. The outer keepers and the inner keeper are shaped so that at least one of the outer keepers covers, at least partially, the inner keeper.
US09450313B2
An electrical connector includes a body and at least one terminal. The body has a top surface and a bottom surface opposite to each other, multiple receiving holes running through the body from the top surface to the bottom surface, and at least two protruding blocks protruding downward from the bottom surface and located around each of the receiving hole. A gap exists between the two protruding blocks. Each of the protruding blocks has a stopping surface toward the gap. The terminal is disposed in the receiving hole. The terminal has a fixing portion and two clamping arms extending downward from the fixing portion along a plate surface for clamping a tin ball. Bottom ends of the two clamping arms are located in the gap. The stopping surfaces are configured to stop the clamping arms and prevent the clamping arms from moving in a plate thickness direction.
US09450310B2
Surface scattering antennas provide adjustable radiation fields by adjustably coupling scattering elements along a wave-propagating structure. In some approaches, the scattering elements are complementary metamaterial elements. In some approaches, the scattering elements are made adjustable by disposing an electrically adjustable material, such as a liquid crystal, in proximity to the scattering elements. Methods and systems provide control and adjustment of surface scattering antennas for various applications.
US09450309B2
A broadband antenna element formed of conductive material on a planar substrate is disclosed. The element has two lobes defining a cavity with declining in width from a widest to narrowest point to form a wideband antenna. Angled corners communicating with linear side edges along with stepped angles of the edges defining the cavity, enhance reception and transmission gain.
US09450306B1
An apparatus includes an antenna structure with a core shaped as a toroid that is designed to be worn on a human digit. A first and second contact are located on the core. A conductive path connects the first contact and the second contact and includes a first set of windings that traverse a circumference of the core in a substantially parallel manner; and a second set of windings that traverse the circumference of the core in a substantially parallel manner. The windings are such that, from a vantage point exterior to the core, the first set of windings is substantially perpendicular to the second set of windings.
US09450304B1
A directional beam switching antenna capable of transmitting/receiving in six directions with 60 degree beam width in six steps. The antenna advantageously uses frequency selective surfaces to block radiation of electromagnetic (EM) waves in unwanted directions and promote transmission of the EM waves in one or more selected directions. The frequency selective surface is made of a single layer of repeated metallic strips and active elements. In the preferred embodiment, only fifteen active elements are used in each of six sections of the antenna, thereby providing a simple, low cost design. The frequency selective surfaces have a high reflection co-efficient when the active elements are in their On state, and a high transmission co-efficient when the elements are in their Off state. Directional transmission is achieved by controlling the state of the active elements.
US09450302B2
An antenna module includes a grounding element, first and second radiating conductors, and a decoupling unit. The grounding element has first and second grounding ends. The first radiating conductor includes a first feed-in end that is adjacent spacedly to the first grounding end and that is configured to be fed with a first RF signal. The second radiating conductor includes a second feed-in end that is adjacent spacedly to the second grounding end and that is configured to be fed with a second RF signal. The decoupling unit is connected electrically between a portion of the first radiating conductor and a portion of the second radiating conductor that are proximate to each other, and is one of a decoupling capacitor and a decoupling inductor.
US09450301B2
A method of controlling pests includes placing a pest control station in an area of interest. The pest control station includes an internal chamber. The method includes placing a pest control apparatus within the internal chamber of the pest control station. The pest control apparatus has a transmitting device including an antenna and a housing sealingly enclosing the antenna. The housing substantially isolates the antenna from the environment. The method also includes activating the antenna of the transmitting device to emit an electromagnetic field to define a region of influence. The housing of the transmitting device is made from a material that reduces the region of influence of the antenna by less than 50%.
US09450292B2
An antenna with a curved shape may be mounted behind a curved antenna window. The antenna may have an antenna resonating element such as an inverted-F antenna resonating element and may have an antenna ground. The antenna resonating element may be formed from patterned metal traces on a flexible printed circuit. The flexible printed circuit may have ground traces that run along a peripheral edge of the flexible printed circuit. The antenna ground may be formed from a metal can with walls surrounding a cavity having an opening. The metal can may have a lip formed from bent portions of the walls. The flexible printed circuit may be soldered to the lip so that the ground traces are shorted to the can. A cable connector may be mounted on a bent tab in the flexible printed circuit that extends through a notch in the lip.
US09450287B2
Broadband antenna for wireless communication device is disclosed. The broadband antenna includes a grounding portion, a feeding portion, a connecting portion, a first radiation body connected to an end of the connecting portion, and second radiation body connected to another end of the connecting portion opposite to the first radiating body. The first radiating body and the second radiating body are symmetrical to each other with respect to the connecting body. The feeding portion is connected to an end of the first radiating body away from the second radiating body, the grounding portion is connected to an end of the second radiating body away from the first radiating body.
US09450283B2
An RF power device that includes a transistor with a compact impedance transformation circuit, where the transformation circuit includes a lumped element CLC analog transmission line and an associated embedded directional bilateral RF power sensor that is inductively coupled to the transmission line to provide detection of direct and reflected power independently with high directivity.
US09450281B2
A transit structure of a waveguide and a SIW is provided. According to the present invention, a SIW and a waveguide are directly connected so that when a signal is transited with a reduced loss and a signal is transmitted while satisfying a frequency band width required for an automotive radar. Further, signal transmission characteristic at every frequency in a bandwidth may be uniformly maintained. Further, an additional dielectric substrate is not required so that a reduced size, a reduced weight, and a reduced cost may be achieved and a process of bonding different substrates is not required.
US09450277B2
The invention is directed to systems and methods for the recycling of lithium ion batteries or the like. The system methods include comminution and destruction of used batteries, controlling the explosive reaction of the battery components during processing, and processing the materials into a suitable form for sampling and recycling.
US09450262B2
The invention pertains to a process for manufacturing certain (per)fluoroionomer liquid compositions, comprising, inter alia, at least one of fluorination and treatment with a polar solvent, to the liquid compositions therefrom having an improved solids content/surface tension/liquid viscosity compromise, to the use of the same for manufacturing composite membranes and to composite membranes obtainable therefrom.
US09450261B2
A fuel cell system capable of improving the voltage controllability of a converter provided in the system is provided. A controller judges whether or not a passing power of a DC/DC converter falls within a reduced response performance area for the number of active phases as of the present moment. When the controller determines that the passing power of the DC/DC converter falls within the reduced response performance area, the controller determines the number of phases which avoids the driving within the reduced response performance area, and outputs a command for switching to the determined number of phases (phase switching command) to the DC/DC converter.
US09450259B2
An impedance measuring device outputs an AC signal having a predetermined frequency to each of a positive electrode terminal and a negative electrode terminal of the fuel cell. The impedance measuring device includes a detection unit that detects an AC potential difference between the positive electrode terminal and a midpoint of the fuel cell, and an adjustment unit that adjusts an amplitude of the AC signal to adjust a detection signal to a predetermined value. The impedance measuring device includes an in-phase component extraction unit that multiplies the detection signal by an in-phase signal and extracts a resistance component of the detection signal, and a calculation unit that calculates a positive real axis impedance on the basis of the resistance component and the output signal. The impedance measuring device includes an orthogonal component extraction unit that multiplies the detection signal by an orthogonal signal and extracts a capacitance component of the detection signal, and a reproduction unit reproduces a vector value of the detection signal on the basis of the extracted capacitance component and resistance component. The adjustment unit adjusts the amplitude of the AC signal so that the reproduced vector value equals the predetermined value.
US09450250B2
Catalysts of the present invention are not corroded in acidic electrolytes or at high potential and have excellent durability and high oxygen reducing ability. The catalyst includes a metal oxycarbonitride containing two metals M selected from the group consisting of tin, indium, platinum, tantalum, zirconium, titanium, copper, iron, tungsten, chromium, molybdenum, hafnium, vanadium, cobalt, cerium, aluminum and nickel, and containing zirconium and/or titanium. Also disclosed is a process for producing the catalyst.
US09450247B2
A preparation method of an oligomer-polymer is provided. A maleimide is reacted with a barbituric acid to form a first oligomer-polymer. The first oligomer-polymer is then reacted with a phenylsiloxane oligomer to form a second oligomer-polymer. The phenylsiloxane oligomer is a compound represented by formula 1: Ph-Si(OH)xOy formula 1, wherein x is 0.65 to 2.82 and y is 0.09 to 1.17.
US09450246B2
Disclosed are carbon particles for a negative electrode of a lithium ion secondary battery, the carbon particles having a pore volume of pores having a size of 2×10 to 2×104 Å, of 0.1 ml/g or less with respect to the mass of the carbon particles; having an interlayer distance d(002) of a graphite crystal as determined by an X-ray diffraction analysis, of 3.38 Å or less; having a crystallite size Lc in the C-axis direction of 500 Å or more; and having a degree of circularity of the particle cross-section in the range of 0.6 to 0.9. Therefore, the carbon particles for the negative electrode of the lithium ion secondary battery enables to have high capacity and have superior rapid charge characteristics, a negative electrode for a lithium ion secondary battery using the carbon particles, and a lithium ion secondary battery can be provided.
US09450245B2
The present invention relates to a nonaqueous electrolyte secondary battery comprising an anode (3), a cathode (2) and a nonaqueous electrolyte. The anode forming this battery includes composite particles having a carbon material included in a metallic material. As the metallic material, metal capable of electrochemically reacting with lithium in a nonaqueous electrolyte is included.
US09450238B2
The present invention provides a hydrogen absorption alloy, which includes chemical composition represented by the general formula M1tM2uM3vCawMgxNiyM4z wherein 16×(d−1.870)/(d−r)≦v≦16×(d−1.860)/(d−r); 1.6≦w≦3.2; 4.1≦×≦5.1; 3.2≦(y+z)/(t+u+v+w+x)≦3.4; t +u+v+w+x+y+z=100; M1 is one or more elements selected from La, Pr, and Nd; M2 is one or more elements selected from V, Nb, Ta, Ti, Zr, and Hf; M3 is one or more elements selected from Sm, Gd, Tb, Dy, Ho, Er, Tm, Yb, and Lu; M4 is one or more elements selected from Co, Mn, Al, Cu, Fe, Cr, and Zn; d is an average atomic radius of the elements selected as M1; and r is an average atomic radius of the elements selected as M3; and an electrode and a secondary battery using the same.
US09450236B2
An electricity-storing device includes a first electrode, a second electrode of opposite polarity as the first electrode, and a separator. The first electrode includes a current collector foil, an active material layer formed on at least one surface of the current collector foil, and an electrical resistance layer formed on the at least one surface of the current collector foil so as to be adjacent to and in direct contact with the active material layer, at least a portion of an interface between the active material layer and the electrical resistance layer including a mixed phase where constituents from the active material layer and the electrical resistance layer intermingle.
US09450232B2
To provide a method for producing a lead-acid battery negative plate for use in a storage battery which provides improved deteriorated rapid discharge characteristics by preventing an interfacial separation between a negative active material-filled plate and a carbon mixture-coated layer, which is a problem in a negative plate having such a configuration that the carbon mixture coated layer is formed on the surface of the negative active material-filled plate.A coating layer of a carbon mixture is formed at least in a part of a surface of a negative active material-filled plate. The carbon mixture is prepared by mixing two kinds of carbon materials consisting of a first carbon material having conductive properties and a second carbon material having capacitive capacitance and/or pseudo capacitive capacitance and a binding agent. Subsequently, a sufficient amount of lead ions are generated enough to be moved from the negative active material-filled plate into the carbon mixture-coated layer. Thereafter, a formation treatment or an initial charge treatment is performed to precipitate lead so that the carbon mixture-coated layer and the negative plate are connected and integrated, at least in a part of a respective interfacial surface thereof, by the precipitated lead.
US09450231B2
The present invention relates to a method for preparing a positive electrode that is made up of a composite material containing at least one active positive electrode made of iron and phosphate and at least one water-soluble polymer having ionic conduction properties in the presence of a lithium salt, said method comprising at least one step for mixing ingredients of the composite material through extrusion so as to obtain an extruded composite material and wherein said extrusion step is carried out by means of a co-kneader or extruder in the presence of an aqueous solvent and at a temperature from 20° to 95° C. The invention also relates to the positive electrode obtained according to said method, to the use of said electrode for manufacturing a lithium battery, and to the lithium battery having such electrode built therein. The electrode is particularly characterized in that it contains a level of active material greater than 60 wt %.
US09450227B2
A thermostatic valve, coupled to an electrochemical power source and having: a valve body; a first fluid inlet for a hot electrolytic fluid; a second fluid inlet for a cold electrolytic fluid; an outlet supplying a mixed electrolytic fluid; and regulating means for adjusting the mixing. The valve body defines a first opening, in communication with the second fluid inlet for the cold electrolytic fluid; and a second opening, in communication with the first fluid inlet for the passage of the hot electrolytic fluid; the regulating means include an adjustment baffle, interposed between the first and second openings and the outlet, and rotatably drivable to vary a useful passage section and adjust the mixing. The first and second openings are designed to mix the electrolytic fluids in different proportions, maintaining the flow rate and introduced load losses unvaried, as the rotation angle of the adjustment baffle varies.
US09450217B2
A pouch battery including an electrode assembly, and a pouch case comprising a receiving part accommodating the electrode assembly, wherein corners or vertices of the receiving part are coated with a UV curing agent.
US09450213B1
The present disclosure provides a device and a method for transferring a display panel. The device includes a carrier configured to transfer the display panel, and a light-shielding plate secured onto the carrier and configured to shield a display region of the display panel when the display panel enters an irradiation region.
US09450212B2
A manufacturing method of an organic light emitting diode display includes: setting, on a mother substrate, a plurality of panel areas of which boundary lines contact each other in a row direction and a column direction; forming a plurality of display units in the plurality of panel areas, respectively; forming a plurality of thin film encapsulations on the plurality of display units, respectively; and cutting the mother substrate along the boundary lines to divide the mother substrate into a plurality of display panels. Forming of the plurality of thin film encapsulations includes forming the thin film encapsulations in panel areas positioned in a first column among the plurality of panel areas and forming the plurality of thin film encapsulations in panel areas positioned in a second column adjacent to the first column.
US09450206B2
An organic light-emitting apparatus including: a substrate; an organic light-emitting device disposed on the substrate and including a first electrode, a second electrode, and an intermediate layer disposed between the first electrode and the second electrode; and an encapsulation layer provided to cover the organic light-emitting device. The encapsulation layer includes a first inorganic layer including a first fracture point, and a first fracture control layer provided on the first inorganic layer to seal the first fracture point.
US09450197B2
A flexible display apparatus includes a plurality of pixels on a display area of a flexible substrate. A pad area is on a non-display area of the flexible substrate. A driving integrated circuit is electrically connected to the pad area. A support layer is on a surface of the flexible substrate opposite to a surface facing the driving integrated circuit. An adhesion layer attaches the support layer to the substrate. The adhesion layer has a first thickness in an area corresponding to the driving integrated circuit, and a second thickness in another area. The second thickness is less than the first thickness.
US09450196B2
An organic light emitting diode display device includes a first substrate; a conductive line formed on a first surface of the first substrate; an organic light emitting diode and an encapsulation layer on the conductive line; a second substrate on the encapsulation layer; a conductive pad connected to the conductive line and arranged in a through hole passing through the first substrate; and a driving circuit unit on a second surface opposite the first surface of the first substrate and connected to the conductive pad.
US09450194B2
A heteroarene derivative including a nitrogen-boron coordinate bond, represented by the following formula (1). In the formula (1). Z1 is a group represented by the following formula (2); Z2 is a substituted or unsubstituted aryl group including 6 to 30 ring carbon atoms or a substituted or unsubstituted heteroaryl group including 5 to 30 ring atoms; L is a substituted or unsubstituted arylene including 6 to 30 ring carbon atoms, a substituted or unsubstituted heteroarylene including 5 to 30 ring atoms, —O—, —S—, —(CR2R3)n— (wherein n is an integer of 1 to 8).
US09450192B2
The present invention provides a carbazole derivative of formula (I) for an organic electroluminescent device: wherein Y represents a heteroatom selected from N, O, P, S, or a bicyclic or tricyclic heterocyclic ring; and Ar1 and Ar2 each independently represent an alkyl or aryl substituted or unsubstituted aromatic hydrocarbon, or an alkyl or aryl substituted or unsubstituted heterocyclic aromatic hydrocarbon.
US09450182B2
In various embodiments, a memory storage element for storing two or more bits of information is formed by connecting two resistive change elements in series whereby the first resistive change element is made of a first material and the second resistive change element is made of a second material and the melting point of the first resistive change element material is greater than the melting point of the second resistive change element material such that the set and reset states of the two elements can be written and read.
US09450171B2
A thin film piezoelectric element of the present invention includes a substrate and a piezoelectric thin film stack formed on the substrate. The piezoelectric thin film stack includes a top electrode layer, a bottom electrode layer and a piezoelectric layer sandwiched between the top electrode layer and the bottom electrode layer, wherein the piezoelectric layer includes a first piezoelectric layer and a second piezoelectric layer whose compositions have different phase structures. The present invention can obtain high piezoelectric constants, enhanced coercive field strength and good thermal stability, thereby enabling larger applied field strength without depolarization and achieving a large stroke for its applied device.
US09450169B2
Provided is a transducer. The transducer includes a permanent magnet that generates a magnetostatic field, a patch disposed below the permanent magnet and formed of a material that deforms according to a magnetic field, an insulator disposed on a top surface of the patch, and a coil wound around the patch and the insulator in a certain form and allowing a magnetomotive field to be induced on the patch according to an applied current. The wound coil has a form in which directions of the magnetostatic field generated by the permanent magnet and the magnetomotive field generated by winding the coil are orthogonal to each other.
US09450167B2
An acoustic resonator comprises: an acoustic resonator device comprises: a composite first electrode disposed over a substrate, the composite first electrode comprising: a first electrically conductive layer provided over the substrate; a first interlayer disposed on the first electrical conductive layer; a buried temperature compensation layer disposed over the first interlayer; a second interlayer disposed over the temperature compensation layer; a second electrically conductive layer disposed over the second interlayer, a piezoelectric layer disposed over the composite first electrode; and a second electrode disposed over the piezoelectric layer.
US09450161B2
A method of manufacturing a light-emitting device, includes: disposing a first conductive paste on a substrate and sintering the first conductive paste to forma first bonding layer; disposing a second conductive paste on a semiconductor light-emitting element and sintering the second conductive paste to form a second bonding layer; polishing surfaces of the first bonding layer and the second bonding layer; and causing a third conductive paste to intervene between the first bonding layer and the second bonding layer and sintering the third conductive paste to bond the first bonding layer and the second bonding layer together.
US09450160B2
A reflecting resin sheet provides a reflecting resin layer at the side of a light emitting diode element. The reflecting resin sheet includes a release substrate and the reflecting resin layer provided on one surface in a thickness direction of the release substrate. The reflecting resin layer is formed corresponding to the light emitting diode element so as to be capable of being in close contact with the light emitting diode element.
US09450143B2
A gallium and nitrogen containing optical device has a base region and no more than three major planar side regions configured in a triangular arrangement provided from the base region.
US09450140B2
A thin film deposition apparatus used to manufacture large substrates on a mass scale and that allows high-definition patterning, and a method of manufacturing an organic light-emitting display apparatus using the same, the apparatus includes a loading unit fixing a substrate onto an electrostatic chuck; a deposition unit including a chamber maintained in a vacuum state and a thin film deposition assembly disposed in the chamber, separated from the substrate by a predetermined distance, to deposit a thin film on the substrate fixed on the electrostatic chuck; an unloading unit separating the substrate on which a deposition process is completed, from the electrostatic chuck; a first circulation unit sequentially moving the electrostatic chuck on which the substrate is fixed, to the loading unit, the deposition unit, and the unloading unit; and a second circulation unit returning the electrostatic chuck separated from the substrate to the loading unit from the unloading unit, wherein the first circulation unit passes through the chamber when passing through the deposition unit.
US09450134B2
According to one embodiment, a photocoupler includes a light emitting element, a light receiving element, a bonding layer, input terminals, output terminals and a molded resin body. A light emitting element includes a transparent support substrate, a semiconductor stacked body, and first and second electrodes. A light receiving element includes a light reception surface, a first electrode, and a second electrode. A bonding layer is configured to bond the first surface of the support substrate to the light reception surface side of the light receiving element. The bonding layer is transparent and insulative. Input terminals are connected to the first and second electrodes of the light emitting element. Output terminals are connected to the first and second electrodes of the light receiving element. The light reception surface is included in the light emitting surface. An input electrical signal is converted into an output electrical signal.
US09450130B2
A wire management device is disclosed. The device comprises a clip comprising an upper planar member and a lower planar member, each planar member having an inner and outer surface, wherein the inner surface of the upper planar member includes a post extending toward the inner surface of the lower planar member, a stem extending from the outer surface of the lower planar member, the stem including two outwardly-extending flanges, each of the first and second outwardly-extending flanges including an edge portion extending toward the outer surface of the lower planar member, and a transverse passage extending along the outer surface of the lower planar member, the transverse passage extending across the stem, wherein the stem has a recessed portion along the transverse passage.
US09450128B2
A multi-layered film, a backsheet for photovoltaic modules, a method of manufacturing the same, and a photovoltaic module are provided. The multi-layered film having excellent reliability and adhesive strength under high heat/moisture conditions and also showing excellent weather resistance and durability may be provided by forming a primer layer including an oxazoline group-containing polymer on a substrate and forming a resin layer including a fluorine-based polymer on the primer layer. The primer layer and resin layer of the multi-layered film may be manufactured at a low cost under a low drying temperature using a solvent having a low boiling point, so that the manufacturing costs can be reduced and the quality of the product can be prevented from being deteriorated by thermal deformation or thermal shock. The multi-layered film may be effectively used for a backsheet for photovoltaic modules so that the photovoltaic module can exhibit excellent durability even when exposed to external environments for a long time.
US09450126B1
A solar cell module including a substrate and solar cells mounted on the substrate, the substrate including a base layer, a first insulation layer positioned over the base layer, a second insulation layer positioned over the first insulation layer and defining a surface, a first bus bar layer positioned between the first and second insulation layers, the first bus bar layer including at least one bus bar extending across the substrate, and a second bus bar layer positioned over the second insulation layer, the second bus bar layer including bus bars, wherein the solar cells are mounted on the surface and are electrically interconnected by the bus bars of the second bus bar layer.
US09450125B2
A stretchable photovoltaic apparatus according to the present invention includes: a stretchable substrate including islands protruded from a base such that the islands are separated by a trench, and a notch formed in an edge of each of the islands; a photovoltaic cell mounted on the stretchable substrate; and an interconnector of which at least a portion is positioned inside the notch, the interconnector electrically connecting the neighboring photovoltaic cells in one pair. According to the present invention, a semiconductor device may be configured in the form of a stretchable array. Therefore, the present invention is expected to be applied to various industrial fields such as a solar cell field, a display field, a semiconductor device field, a medical field, a clothing field, a measurement field, and a filming field.
US09450113B2
Forming a metal layer on a solar cell. Forming a metal layer can include placing a patterned metal foil on the solar cell, where the patterned metal foil includes a positive busbar, a negative busbar, a positive contact finger extending from the positive busbar, a negative contact finger extending from the negative busbar, and a metal strip, and one or more tabs. The positive and negative busbars and the positive and negative contact fingers can be connected to one another by the metal strip and tabs. Forming the metal layer can further include coupling the patterned metal foil to the solar cell and removing the metal strip and tabs. Removing the metal strip and tabs can separate the positive and negative busbars and contact fingers.
US09450111B2
A Schottky barrier diode includes a substrate, a buffer layer formed on the substrate, an upper layer formed on the buffer layer, a first electrode layer formed on the upper layer as an anode of the Schottky barrier diode, a second electrode layer formed on the upper layer as a cathode of the Schottky barrier diode, and a first n-type doping region formed in the upper layer and under the first electrode layer, and contacting the first electrode layer. An edge of the first n-type doping region and an edge of the first electrode layer are separated by a first predetermined distance at a first direction at which the first electrode layer faces the second electrode layer.
US09450110B2
The semiconductor device includes a p-anode region disposed on an n-drift region, and a p-diffusion region disposed so as to be in contact with the p-anode region on the n-drift region. A resistance region disposed so as to be in contact with the p-diffusion region on an n− region, a plurality of p-guard ring regions, and a stopper region disposed away from the p-guard ring regions are provided. By providing the p-diffusion region, withdrawal of holes that concentrate to the p-anode region at the time of reverse recovery is suppressed, so that the semiconductor device has a high reverse recovery tolerance.
US09450108B2
A nonvolatile semiconductor memory device includes a semiconductor portion, a first oxygen-containing portion provided on the semiconductor portion, a silicon-containing portion provided on the first oxygen-containing portion, a first film provided on the silicon-containing portion and including a lamination of a first portion containing silicon and oxygen and a second portion containing silicon and nitrogen, a first high dielectric insulating portion provided on the first film and having an oxide-containing yttrium, hafnium or aluminum, a second oxygen-containing portion provided on the first high dielectric insulating portion, a second high dielectric insulating portion provided on the second oxygen-containing insulating portion and having an oxide-containing yttrium, hafnium or aluminum, a third oxygen-containing portion provided on the second high dielectric insulating portion, and a second film provided on the third oxygen-containing portion.
US09450106B2
Disclosed is a thin film transistor (TFT) of a display apparatus which reduces a leakage current caused by a hump and decreases screen defects. The TFT includes an active layer and a first gate electrode with a gate insulator therebetween, and a source electrode and a drain electrode respectively disposed at both ends of the active layer. The gate electrode branches as a plurality of lines and overlaps the active layer. The active layer includes one or more channel areas between the source electrode and the drain electrode, one or more dummy areas, and a plurality of link areas between the one or more channel areas to connect the one or more channel areas in one pattern. A length of each of the one or more dummy areas extends from an edge of a corresponding channel area.
US09450097B2
A method of doping a fin field-effect transistor includes forming a plurality of semiconductor fins on a substrate wherein each semiconductor fin of the plurality of semiconductor fins has a top surface and sidewalls. The method includes forming a gate stack over the top surface and sidewalls of each semiconductor fin. The method includes removing a portion of a first semiconductor fin exposed by the gate stack. The method includes growing a first stressor region connected to a remaining portion of the first semiconductor fin. The method includes exposing a second semiconductor fin to a deposition process to form a dopant-rich layer comprising an n-type or a p-type dopant on the top surface and the sidewalls of the second semiconductor fin. The method includes diffusing the dopant from the dopant-rich layer into the second semiconductor fin using an annealing process.