US11868312B2
Techniques are provided for an object file system for an object store. Data, maintained by a computing device, is stored into slots of an object. The data within the slots of the object is represented as a data structure comprising a plurality of nodes comprising cloud block numbers used to identify the object and particular slots of the object. A mapping metafile is maintained to map block numbers used to store the data by the computing device to cloud block numbers of nodes representing portion of the data stored within slots of the object. The object is stored into the object store, and the mapping metafile and the data structure are used to provide access through the object file system to portions of data within the object.
US11868310B2
Systems and methods for composite storage of data across tiers of a multi-tenant storage device are provided. In embodiments, a method includes determining attributes associated with each query in a set of queries; determining whether each of the attributes meet respective predetermined threshold values for a first storage tier, a second storage tier and a third storage tier based on statistical data generated for the attributes; updating storage rules for at least one of the first storage tier, the second storage tier and the third storage tier based on the determining; receiving data from the tenant for storage; dividing the data into at least a first portion and a second portion based on the storage rules; and storing the at least the first portion and the second portion on separate ones of the first storage tier, the second storage tier and the third storage tier based on the storage rules.
US11868304B1
In an embodiment, an example computer-implemented method for configuring a hardware accelerator to perform a non-linear function involves: determining a plurality of intervals that partition an input domain of the non-linear function; determining a plurality of subinterval configurations corresponding to different numbers of subintervals for partitioning that interval; generating an error set comprising an error for using a polynomial function to approximate the non-linear function within one or more corresponding subintervals specified by the subinterval configuration; using the error set and resource constraints, selecting one of the subinterval configurations for each of the intervals to generate a configuration set that minimizes a worst-case error across the intervals; selecting one of the subinterval configurations for each of the intervals to generate an improved configuration set that minimizes a cumulative error across the intervals without exceeding the worst-case error; and configuring the hardware accelerator based on the improved configuration set.
US11868298B2
A method includes obtaining, by a first processing entity, first data communication capabilities of a first host device. The first host device and the first processing entity are associated with a first low voltage drive circuit. The method further includes obtaining, by a second processing entity, second data communication capabilities of a second host device. The second host device and the second processing entity are associated with a second low voltage drive circuit. The method further includes reconciling, by one or more of the first and second processing entities, the first and second data communication capabilities to produce reconciled data communication capabilities and determining a data conveyance scheme and a data communication scheme for a one-to-one communication between the first and second low voltage drive circuits based on the reconciled data communication capabilities.
US11868294B2
An image based pairing system to perform operations that include, detecting a peripheral device to be identified for use by a user of the computing device, the peripheral device comprising a display screen that displays a graphical element assigned to a memory location of the peripheral device; identifying the graphical element assigned to the memory location of the peripheral device responsive to the detecting the peripheral device at the client device; causing, by one or more processors of the computing device, display of a presentation of the graphical element assigned to the memory location of the peripheral device among a plurality of graphical elements at the computing device; receiving an input that selects the presentation of the graphical element from among the plurality of graphical elements at the computing device; and establishing a communicative connection between the computing device and the peripheral device.
US11868283B2
The increased use of graph algorithms in diverse fields has highlighted their inefficiencies in current chip-multiprocessor (CMP) architectures, primarily due to their seemingly random-access patterns to off-chip memory. Here, a novel computer memory architecture is proposed that processes operations on vertex data in on-chip memory and off-chip memory. The hybrid computer memory architecture utilizes a vertex's degree as a proxy to determine whether to process related operations in on-memory or off-chip memory. The proposed computer memory architecture manages to provide up to 4.0× improvement in performance and 3.8× in energy benefits, compared to a baseline CMP, and up to a 2.0× performance boost over state-of-the-art specialized solutions.
US11868269B2
Tracking memory block access frequency in processor-based devices is disclosed herein. In one exemplary embodiment, a processor-based device provides a processing element (PE) that is configured to include an access count table for tracking accesses to memory blocks. The access count table is a packed table that comprises a plurality of access count values, each of which corresponds to a memory block of a plurality of memory blocks. Upon detecting a memory access operation (i.e., data-side operations such as memory load operations, memory store operations, atomic increment operations, set operations, and the like, or instruction-side operations such as code fetch operations) directed to a given memory block, the PE increments an access count value corresponding to the memory block. The access count value then can be accessed (e.g., by a process executing on the PE), and used to determine an access frequency for the memory block.
US11868263B2
A microprocessor includes a virtually-indexed L1 data cache that has an allocation policy that permits multiple synonyms to be co-resident. Each L2 entry is uniquely identified by a set index and a way number. A store unit, during a store instruction execution, receives a store physical address proxy (PAP) for a store physical memory line address (PMLA) from an L1 entry hit upon by a store virtual address, and writes the store PAP to a store queue entry. The store PAP comprises the set index and the way number of an L2 entry that holds a line specified by the store PMLA. The store unit, during the store commit, reads the store PAP from the store queue, looks up the store PAP in the L1 to detect synonyms, writes the store data to one or more of the detected synonyms, and evicts the non-written detected synonyms.
US11868259B2
Embodiments herein described a coherency protocol for a distributed computing topology that permits for large stalls on various interfaces. In one embodiment, the computing topology includes multiple boards which each contain multiple processors. When a particular core on a processor wants access to data that is not currently stored in its cache, the core can first initiate a request to search for the cache line in the caches for other cores on the same processor. If the cache line is not found, the cache coherency protocol permits the processor to then broadcast a request to the other processors on the same board. If a processor on the same board does not have the data, the processor can then broadcast the request to the other boards in the system. The processors in those boards can then search their caches to identify the data.
US11868248B2
A garbage collection process is performed in a storage system which comprises a storage control node, and storage nodes which implement a striped volume comprising a plurality of stripes having strips that are distributed over the storage nodes. The storage control node selects a victim stripe for garbage collection, and an empty stripe in the striped volume. The storage control node determines a data strip of the victim stripe having predominantly valid data based on a specified threshold, and sends a copy command to a target storage node which comprises the predominantly valid data strip, to cause the target storage node to copy the predominantly valid data strip to a data strip of the empty stripe which resides on the target storage node. The storage control node writes valid data blocks of the victim stripe to remaining data strips of the empty stripe, and releases the victim stripe for reuse.
US11868243B2
Methods, systems, and apparatus, including computer programs encoded on computer storage media, for performing topological scheduling on a machine-learning accelerator having an array of tiles. One of the methods includes performing, at each time step of a plurality of time steps corresponding respectively to columns within each of a plurality of wide columns of the tile array, operations comprising: performing respective multiplications using tiles in a respective tile column for the time step, computing a respective output result for each respective tile column for the time step including computing a sum of results of the multiplications for the tile column, and storing the respective output result for the tile column in a particular output RAM having a location within the same tile column and on a row from which the output result will be read by a subsequent layer of the model.
US11868240B2
An information processing device comprises one or more known hardware devices including a processor and memory. An intelligent test program is provided to drive the device to develop a smoke test for a target program the name, use and functionality of which is unknown to the test program. The intelligent test program can generate a report on the functionality of the target program and can capture call back functions associated with the target program in order to automatically develop a smoke test script file for use in subsequent smoke test runs on the device.
US11868237B2
Techniques for monitoring operating statuses of an application and its dependencies are provided. A monitoring application may collect and report the operating status of the monitored application and each dependency. Through use of existing monitoring interfaces, the monitoring application can collect operating status without requiring modification of the underlying monitored application or dependencies. The monitoring application may determine a problem service that is a root cause of an unhealthy state of the monitored application. Dependency analyzer and discovery crawler techniques may automatically configure and update the monitoring application. Machine learning techniques may be used to determine patterns of performance based on system state information associated with performance events and provide health reports relative to a baseline status of the monitored application. Also provided are techniques for testing a response of the monitored application through modifications to API calls. Such tests may be used to train the machine learning model.
US11868235B2
Examples include aggregating logs, where each of the logs is associated with a workflow instance. Each log includes information indicative of an event occurring during the workflow instance. Further, examples include assigning, based on user intent of the workflow instance, a workflow name to each log, where the user intent is indicative of an outcome of execution of the workflow instance and assigning an instance identifier to each log, where the instance identifier corresponds to the workflow instance. Further, identifying a subset of the plurality of logs having an identical workflow name and an identical instance identifier, associating a tracking identifier to the subset, and creating an index of processed logs, wherein each processed log in the index includes the tracking identifier. Further, analyzing the index of processed logs based on a set of rules and identifying, based on the analysis, an error in execution of each the workflow instance.
US11868233B2
A system for read-access of a regulated system, the system comprising a specialized data store, at least one memory, and a flexible reader. The specialized data store able to receive at least a portion of a set of procedures that define a respective set of systematic data and executable operations. The at least one memory including at least one set of data related to the set of procedures.
US11868226B2
A computer-implemented method and system involve providing a script-driven framework to monitor performance of operations on two or more sets of objects to be executed on a target system in parallel on separate threads according to a test scenario with user-defined language stipulations from a script file, and executing the script file through the framework to implement the test scenario on the target system. The language stipulations include an operation hierarchy for each of the two or more sets of objects and at least one synchronization point corresponding to a point in time at which operations on the separate threads are to be synchronized. The framework can be XML-compliant.
US11868213B2
Techniques are provided for incremental backup to an object store. A request may be received from an application to perform a backup from a volume hosted by a node to a backup target within the object store. A set of changed files within the volume since a prior backup of the volume was performed to the backup target is identified, along with metadata associated with the set of changed files. The metadata is utilized to identify changed data blocks comprising data of the set of changed files that was modified since the prior backup. The changed data blocks are backed up to the object store.
US11868207B2
System, method, and computer program for intelligent self-healing optimization for fallout reduction
As described herein, a system, method, and computer program are provided for intelligent self-healing optimization for fallout reduction. A set of self-healing rules are stored that are configured to provide resolutions to failures detected in a computer process. Data associated with use of the self-healing rules is collected. The data is processed using a machine learning model to generate one or more recommendations for optimizing the set of self-healing rules. The one or more recommendations are output.
US11868205B1
A self-correcting secure computer system is provided. The computer system includes a read-only memory (ROM) device, a random access memory (RAM) device, and at least one processor in communication with the ROM device and the RAM device. The at least one processor is programmed to receive an activation signal, retrieve, from the ROM device, data to execute an operating system, and execute, on the RAM device, the operating system based on the data from the ROM device.
US11868187B2
A circuit board includes a board body, a card slot, a release structure, and a transmission mechanism. The card slot is disposed on the board body and adapted for inserting an expansion card. The release structure is rotatably disposed beside the card slot. The transmission mechanism includes a contact part and a stressed part that are linked to each other, wherein the contact part is connected to the release structure. When the stressed part receives an external force, the contact part is moved correspondingly, so that the release structure is rotated relative to the card slot, thereby releasing the expansion card.
US11868184B2
A metal backplate is composed of two parallel plain parts and a flexible part lying two plain parts, and the flexible part has a first surface and a second surface deployed underneath the first surface. The flexible part is etched or etched partially with a plurality of curved first openings which form a first array in a staggered arrangement in order to weaken the flexible part B with rigidity property to be one with bending-resilience property; at the same time, which form in staggered rows or in alignments on the upside and the reverse side of the first surface in order to decrease the unidirectional stress concentration and the warpage problem of the display panel.
US11868173B2
An integrated circuit device having functional circuitry driven by a clock signal includes onboard clock generation circuitry. The clock generation circuitry includes an input configured to accept a frequency reference signal, at least one variable loading capacitor coupled to the input for converting the crystal resonator signal into a calibrated clock signal, and calibration circuitry configured to calibrate the at least one variable loading capacitor based on a reference voltage. The input configured to accept a frequency reference signal may be configured to accept a crystal resonator signal.
US11868169B2
Systems, methods and apparatus for enabling access to secure data. A first module is arranged to generate a limited use passcode and make the passcode available to a user. A second module and a third module are arranged to communicate whereby to enable detection of the third module being in proximity to the second module. A fourth module is arranged to receive a passcode via user input. The apparatus is arranged to enable access to secure data in dependence on the fourth module receiving a valid passcode generated by the first module and the third module being in proximity to the second module.
US11868157B2
A conductive sheet includes a transparent substrate and a plurality of thin metal wires formed in a mesh shape on one surface of the transparent substrate. The plurality of thin metal wires includes an n-sided polygon formed in a virtual pattern and an inverted virtual pattern and six connecting lines. The virtual pattern and the inverted virtual pattern obtained by flipping the virtual pattern horizontally are densely laid such that intersection points disposed on respective sides of the virtual pattern and the inverted virtual pattern are overlapped with each other and that opening regions formed by the plurality of thin metal wires are aperiodically arranged.
US11868147B2
A system may be configured to monitor an amount of a gas species in a processing chamber using Optical Emission Spectrometry. The gas measurement may be provided as feedback to a control process that generates a target setpoint for a gas flow controller into the process chamber. This real-time process may increase/decrease the flow rate of the gas in order to maintain a process deposition mode within a transition region between primarily metallic deposition and primarily compound deposition.
US11868144B2
In a drone system in which a drone and a movable body operate in coordination with each other, the drone performing a predetermined operation in an agricultural field, the movable body being capable of moving with the drone aboard and allowing the drone to make a takeoff and a landing, the plan determining section determines a flight plan for the drone and a movement plan for the movable body in accordance with the flight plan, and the instructing section instructs the drone to execute an operation in accordance with the flight plan and instructs the movable body to move or to be on standby in accordance with the movement plan.
US11868130B2
A system and method for decision making for autonomous vehicles. The method includes determining if a decision scenario is present; generating a first random number; communicating the first random number to a receiver via visible light communication; receiving a second random number and determining a priority order based on the generated random numbers. The priority is communicated to all relevant units to determine the order in which the vehicles should proceed. An optical random generator may be used to generate the random number associated with each vehicle.
US11868125B2
In a general aspect, a handheld controller device includes a housing and a trigger assembly. The housing is configured to be held in the hands of a user. The trigger assembly includes a pair of triggers extending outward from a side of the handheld controller device and configured to move along respective trigger paths. A coupling assembly is disposed inside the housing and connected to the pair of triggers. The coupling assembly is configured to transfer motion between the pair of triggers such that, when either of the triggers moves towards the housing along its respective trigger path, the coupling assembly moves the other trigger an equal distance away from the housing along its trigger path. Circuitry in the housing includes one or more sensors and a microcontroller configured to receive sensor signals and, in response, generate aircraft control data (e.g., for a flight simulation or remotely controlled flyable aircraft).
US11868124B2
The embodiments are and include at least an apparatus, system and method for forming print material particles for additive manufacturing (AM) printing. The apparatus, system and method include at least a melt chamber comprising a polymer melt; a vertical extruder that fluidically receives the polymer melt; an atomizer that atomizes the polymer melt from the vertical extruder and that distributes the atomized polymer melt; a fall chamber comprising a plurality of zones into which the atomized polymer melt is distributed; and a collector to receive the print material particles formed of the atomized polymer melt after falling through the plurality of zones.
US11868117B2
An industrial automation component may receive design information associated with an arrangement of one or more industrial automation components in an industrial automation system and identify a first portion of the industrial automation components in the industrial automation system that is unable to interface with a second portion of industrial automation components based on the design information. The industrial automation component may then generate a list of industrial automation components based on the first portion of the industrial automation components and the second portion of industrial automation components, wherein each of the list of industrial automation components is configured to translate a first set of data associated with the first portion of the industrial automation components to a second set of data configured to be at least partly interpretable by the second portion of industrial automation components.
US11868116B2
The present disclosure provides a method and an Internet of Things system for regulating a gas in-home pressure based on smart gas. The method includes: determining a gas in-home pressure regulation scheme, and the gas in-home pressure regulation scheme including a pressure regulation parameter of a gas device; generating, based on the gas in-home pressure regulation scheme, a pressure regulation instruction; regulating, based on the pressure regulation instruction, a gas in-home pressure of at least one floor; and transmitting the gas in-home pressure regulation scheme to a smart gas user terminal.
US11868112B2
A multi-point measurement system and a multi-point measurement method are provided. The multi-point measurement system is for measuring a device under testing and comprises a plurality of sensors and a computing device. The sensors are respectively attached to a plurality of measuring points of the device under testing. The computing device comprises a computing unit and a storage unit; the computing unit comprises a learning module, and the computing device establishes communication connections to the sensors respectively. The sensors generate original sensing data and transmit them to the storage unit for storage. The computing unit inputs processed sensing data obtained by preprocessing the original sensing data into the learning module for data analysis, and obtains a plurality of reference values corresponding to the sensors respectively. At least two adjacent sensors form a group; the computing unit sequentially inputs the processed sensing data corresponding to the sensors in the group into the learning module for a merge operation, and obtains a plurality of merged reference values corresponding to the groups respectively. The computing unit performs a determination operation using the merged reference values corresponding to each group and the reference values corresponding to the sensors in the group and generates a suitability determination for the measuring points.
US11868105B2
A method and an apparatus for dynamically determining a yaw control precision. The method comprises: during a predetermined time period, collecting a plurality of wind speed data and a plurality of wind direction data, and processing the collected plurality of wind speed data and plurality of wind direction data; on the basis of the processed wind speed data and wind direction data, establishing a model of the corresponding relationship between wind speed, wind direction angle change, yaw control precision, yaw fatigue, and power loss; and, on the basis of the current wind speed data, wind direction data, predetermined yaw fatigue range, and predetermined power loss range, by means of the corresponding relationship model, determining the yaw control precision corresponding to the current wind speed and current wind direction angle change.
US11868098B2
Methods and systems are disclosed for determining a plan to optimize key performance indicators (KPIs) of an industrial process. Such a plan is determined based on generating a query for information associated with the KPIs and based on receiving user-provided object information corresponding to the KPIs. The method includes receiving, at a user interface, one or more KPIs associated with an industrial process. The method includes generating, based on the one or more KPIs, at least one query for information associated with the KPI. The method includes receiving, at the user interface, a response to the at least one query. The method includes determining, by an artificial intelligence agent, a plan for optimizing the KPI.
US11868093B2
A method that is for manufacturing a timepiece provided with a personalized decoration, visible in particular when the timepiece is worn, includes constructing the timepiece and producing the personalized decoration on all or part of a body of the timepiece. Producing the personalized decoration includes selecting from a human-machine interface of an electronic device a single portion of a reference digital graphical representation, in particular of an ephemeral reference digital graphic representation, and applying a coating of decorative material on all or part of the body of the timepiece as a function of the descriptive characteristics of the selected single portion.
US11868083B2
An example of a container is disclosed. The example disclosed herein comprises an impermeable container wall, a container releasing valve, and a gas vessel. The impermeable container wall defines the boundaries of an inner volume of the container. The container releasing valve is installed in the container wall to release gas from the inner volume of the container to the outside of the container. The gas vessel is installed in the inner volume of the container. The gas vessel comprises a gas vessel wall, a pressurized vessel gas, and a gas vessel releasing system. The gas vessel wall defines the boundaries of an inner volume of the gas vessel, wherein the gas vessel wall is impermeable and allows for a pressure difference between the inner volume of the gas vessel and an outer volume of the gas vessel. A pressurized vessel gas is enclosed within the inner volume of the gas vessel. And a gas releasing system is to release a certain quantity of the vessel gas to the inner volume of the gas container.
US11868074B2
An image forming apparatus includes a first casing including a transfer unit, a second casing including a fixing unit, and a third casing provided between the first casing and the second casing and including an intermediary feeding member. The first casing includes a first discharging port discharging a recording material with a toner image. The second casing includes a first receiving port receiving the recording material with the toner image. A height from an installing surface of the image forming apparatus to the first receiving port in a vertical direction is different from a height from the installing surface to the first discharging port. The intermediary feeding member of the third casing is provided obliquely in the vertical direction from a second receiving port receiving the recording material from the first discharging port to a second discharging port delivering the recording material to the first receiving port.
US11868064B2
A toner conveying device includes a toner conveying section and a toner conveyor. The toner conveying section includes a bent portion and an outlet port. The bent portion bends in a predetermined direction. The outlet port discharges toner. The toner conveyor is bendable and driven by a driving device to rotate to convey toner. The toner conveyor is disposed in the toner conveying section such that a first end of the toner conveyor is coupled to the driving device and a second end of the toner conveyor is a free end. The toner conveyor includes a reverse-flow conveying portion, between the outlet port and the free end, to convey the toner from the second end to the first end.
US11868063B2
A developing device includes a developer carrier to carry a developer, a conveyance path to circulate the developer and supply the developer to the developer carrier, a discharge path extending from the conveyance path and including a discharge port to discharge a portion of the developer, as excess developer, and a valve body provided between the conveyance path and the discharge port. The valve body includes an inlet side oriented toward the conveyance path and an outlet side disposed opposite the inlet side to allow a passage of the excess developer from the conveyance path through the valve body toward the discharge port, when a pressure applied to the inlet side is greater than a pressure threshold value.
US11868061B2
An image forming apparatus includes a photoconductive body, a light source, a deflector to deflect a light beam from the light source, a scanning optical system to image the deflected light beam onto the photoconductive body, a developing unit to supply developer to the photoconductive body, an optical sensor to detect the deflected light beam, a moving mechanism to move the developing unit to a first position and to a second position, and a controller configured to start driving the deflector, when the developing unit is in the second position, the light source to emit the light beam, thereby obtaining a detection signal of the light beam from the optical sensor, and after obtaining the detection signal of the light beam from the optical sensor, control the moving mechanism to move the developing unit to the first position.
US11868052B2
An immersion liquid supply and recovery device (2) with new-type pumping and drainage cavities includes pumping and drainage openings, pumping and drainage cavities, and sealed pumping and drainage channels, wherein the pumping and drainage cavities are in communication with an immersion flow field by means of the multiple pumping and drainage openings, and the pumping and drainage openings in communication with the different pumping and drainage cavities are circumferentially distributed in a crossed manner; at least two pumping and drainage cavities are provided, and each of the pumping and drainage cavities is in communication with an immersion liquid recovery system by one sealed pumping and drainage channel respectively; and the communication points of the pumping and drainage cavities and the sealed pumping and drainage channels are evenly arranged in the circumferential direction of the pumping and drainage cavities.
US11868050B2
The present disclosure relates to systems and methods relating to the fabrication of light guide elements. An example system includes an optical component configured to direct light emitted by a light source to illuminate a photoresist material at one or more desired angles so as to expose an angled structure in the photoresist material. The photoresist material overlays at least a portion of a first surface of a substrate. The optical component includes a container containing a light-coupling material that is selected based in part on the one or more desired angles. The system also includes a reflective surface arranged to reflect at least a first portion of the emitted light to illuminate the photoresist material at the one or more desired angles.
US11868047B2
A method of manufacturing a semiconductor device includes applying a polymer mixture over a substrate, exposing and developing at least a portion of the polymer mixture to form a developed dielectric, and curing the developed dielectric to form a dielectric layer. The polymer mixture includes a polymer precursor, a photosensitizer, and a solvent. The polymer precursor may be a polyamic acid ester.
US11868040B2
A method for forming a target substrate is provided. The method includes providing a mask substrate. The method also includes providing a second base with a material layer. The method further includes arranging the mask substrate and the second base correspondingly. In addition, the method includes performing exposure and development processes on the material layer to form the target substrate and removing the mask substrate.
US11868036B2
The present invention provides a transmissive screen including a light control layer, the screen being reduced in reflection scattering toward an image source, and an image display apparatus using the transmissive screen.
US11868030B2
A method is disclosed. The method includes providing a body assembly including a first recess, a second recess, and a third recess, providing a film apple box, and selectively supporting a first end portion of the film apple box in the first recess in a first orientation. The method also includes selectively supporting a second end portion of the film apple box in the second recess in a second orientation, and selectively supporting a third end portion of the film apple box in the third recess in a third orientation.
US11868019B2
Disclosed herein are systems, apparatuses, methods, and non-transitory computer readable media related to a display construct coupled to a structure (e.g., a vision window). The structure can be a supportive structure such as a fixture. The display construct is configured to facilitate media display and is at least partially transparent. The vision window may be a tintable window, e.g., a window in which its tint is electrically controllable (e.g., an electrochromic window). Various interactive capabilities with the display construct are disclosed (e.g., via a touch screen).
US11868017B1
An electrochromic rearview mirror contains: a first substrate, a first plating layer, a second plating layer, a packaging fringe, an electrochromic layer, a first conductive glue, a second conductive glue, at least one third plating layer, at least one fourth plating layer, a second substrate, a first electricity transmission sheet, and a second electricity transmission sheet. The first substrate includes a first face and a second face. The second substrate includes a third face and a fourth face. A respective one fourth plating layer includes a first turning extension which is rough. A respective one third plating layer includes a second turning extension which is rough. The first electricity transmission sheet includes a first conducting portion and a first contact portion. In addition, the second electricity transmission sheet includes a second conducting portion and a second contact portion.
US11868012B2
The embodiments of the present disclosure provide a transparent display panel, including: a first substrate; a second substrate; and a liquid crystal layer; a light guide plate; a light source assembly; and a plurality of pixel units, wherein the plurality of pixel units includes a first pixel unit and a second pixel unit, a distance from a center of an orthographic projection of the first pixel unit on a light exit surface of the light guide plate to the light incident surface of the light guide plate is less than that of the second pixel unit, and an area of an orthographic projection of an effective modulation area of the liquid crystal layer in the first pixel unit on the light exit surface of the light guide plate is less than that in the second pixel unit.
US11868008B2
A display apparatus includes a backlight component, a light adjusting component, a display panel, and a first polarizing film. The backlight component is configured to generate polarized light. The light adjusting component is disposed on one side of the backlight component, and is configured to deflect or not deflect polarized light generated by the backlight component. The first polarizing film is disposed between the light adjusting component and the display panel. In the display apparatus) provided in this application, when the polarized light obtained after passing through the light adjusting component passes through the first polarizing film, if a vibration direction of the polarized light is consistent with a transmission direction of the first polarizing film, the polarized light can be transmitted. If the vibration direction of the polarized light is perpendicular to the transmission direction of the first polarizing film, the polarized light cannot be transmitted.
US11868005B2
A planar light source includes a substrate, light sources, and a partitioning member. The partitioning member defines partitioned regions arranged in a first direction and in a second direction that intersects the first direction. At least one of the light sources is arranged in a corresponding one of the partitioned regions. The partitioning member includes a plurality of first wall parts defining a plurality of first ridges extending in the first direction, and a plurality of second wall parts defining a plurality of second ridges extending in the second direction. The first wall parts define at least one first cut on at least one of the first ridges. At least one of the partitioned regions is surrounded by the first ridges and the second ridges in a plan view and includes an opposing pair of the first wall parts and an opposing pair of the second wall parts.
US11868001B2
A display device includes a first display unit and a second display unit. The first display unit emits a red light having a first output spectrum corresponding to a highest gray level of the display device. The second display unit emits a blue light having a second output spectrum corresponding to the highest gray level of the display device. An intensity integral of the first output spectrum within a range from 380 nm to 780 nm is defined as a first intensity integral, an intensity integral of the second output spectrum within a range from 511 nm to 597 nm is defined as a second intensity integral, and a ratio of the second intensity integral to the first intensity integral is greater than 0% and less than or equal to 29.0%.
US11867998B2
The present application provides a liquid crystal display panel and a liquid crystal display device. In the liquid crystal display panel, a light-shielding pattern is disposed on a side of a first substrate away from a liquid crystal layer, and the light-shielding pattern is disposed between two adjacent pixels. A difference between a width of the light-shielding pattern and a distance between the two adjacent pixels is less than or equal to a threshold value. A material of the light-shielding pattern includes an inorganic material. Therefore, an aperture ratio of the liquid crystal display panel is increased.
US11867986B2
There is provided an optical insert for transforming conventional eyewear into eyewear having an additional purpose. The optical insert comprises an extender portion which holds a lens on a first end and a mounting assembly on a second end opposite the first end. The mounting assembly comprises a profile which matches the profile of the conventional eyewear lens retainer. The lens of the conventional eyewear is configured to be removed and replaced with the optical insert. In one embodiment, the lens of the optical insert can comprise dark lenses which can be useful, for example, to transform conventional eyeglasses into prescription sunglasses.
US11867985B2
A contact lens includes a central region, an annular region and a peripheral region. The central region includes a central point of the contact lens. The annular region symmetrically surrounds the central region. The peripheral region symmetrically surrounds the annular region. The peripheral region includes at least one color pattern portion. The annular region includes at least one power of critical point.
US11867975B2
An optical imaging system includes a first lens, a second lens, a third lens, a fourth lens, a fifth lens, a sixth lens, and a seventh lens sequentially disposed in ascending numerical order along an optical axis of the optical imaging system from an object side of the optical imaging system toward an imaging surface of an image sensor, wherein a conditional expression f/f2+f/f3<−0.4 is satisfied, where f is a focal length of the optical imaging system, f2 is a focal length of the second lens, and f3 is a focal length of the third lens, and a conditional expression TTL/(2*IMG HT)<0.69 is satisfied, where TTL is a distance along the optical axis from an object-side surface of the first lens to the imaging surface of the image sensor, and IMG HT is one-half of a diagonal length of the imaging surface of the image sensor.
US11867973B2
A varifocal lens includes a substrate having an inclined region, a primary electrode disposed over the inclined region of the substrate, a dielectric layer disposed over the primary electrode, a deformable membrane disposed over and at least partially spaced away from the dielectric layer, a secondary electrode disposed over a surface of the deformable membrane facing toward or away from the dielectric layer and overlying at least a portion of the primary electrode, and a fluid between the membrane and the substrate, wherein a surface of the dielectric layer facing the secondary electrode comprises a textured surface.
US11867971B2
A lens driving apparatus includes a holder, a metal cover, a carrier, a sensing magnet, a printed circuit board, a position sensor, a coil and at least one driving magnet. The metal cover is coupled with the holder and has an opening. The carrier is assembled to a lens assembly having an optical axis, wherein the carrier is disposed in the metal cover and is movable along a direction parallel to the optical axis. The sensing magnet is coupled with the carrier. The printed circuit board is disposed near to one of the four lateral sides of the holder. The position sensor is disposed on the printed circuit board and corresponds to the sensing magnet. The coil is disposed on an outer surface of the carrier. One of the driving magnet is disposed in the metal cover and corresponds to the coil.
US11867970B2
An optical element driving mechanism is provided. The optical element driving mechanism includes a movable portion, a fixed portion, and a driving assembly. The movable portion is used for connecting to an optical element, wherein the optical element has a main axis. The movable portion is movably connected to the fixed portion. The driving assembly is disposed on the movable portion or the fixed portion for driving the movable portion moving relative to the fixed portion.
US11867967B2
An embodiment comprises: a lower surface; a first lens barrel comprising a first protrusion protruding from the lower surface; a first lens array comprising a plurality of first lenses disposed in the first lens barrel; a first holder comprising a first hole into which the first protrusion is inserted; a first adhesive member disposed between a lower surface of the first lens barrel around the first protrusion and an upper surface of the first holder around the first hole; and a first image sensor disposed under the first hole, wherein the first adhesive member comprises one end and the other end, which are disposed to encompass the first hole, and the one end and the other end of the first adhesive member are spaced apart from each other.
US11867964B2
Embodiments of the present invention provide a unique new approach to generating operating condition information used for assessing flow assurance and structural integrity. More specifically, apparatuses, systems and methods configured in accordance with embodiments of the present invention enable multiplexed arrangement of optical fiber for sensing of operating conditions within a structural member and utilize fiber optic sensors for enabling monitoring of operating condition information within one or more elongated tubular members. To this end, fiber optic sensors are strategically placed at a plurality of locations along a length of each elongated tubular member thereby allowing critical operating conditions such as strain, temperature and pressure of the elongated tubular member and/or a fluid therein to be monitored. A multiplexing unit is used for allowing selective configuration of individual lengths of optical fiber for creating one or more contiguous optical fiber structures.
US11867963B2
Embodiments of the present invention provide a unique new approach to generating operating condition information used for assessing flow assurance and structural integrity. More specifically, apparatuses, systems and methods configured in accordance with embodiments of the present invention enable multiplexed arrangement of optical fiber for sensing of operating conditions within a structural member and utilize fiber optic sensors for enabling monitoring of operating condition information within one or more elongated tubular members. To this end, fiber optic sensors are strategically placed at a plurality of locations along a length of each elongated tubular member thereby allowing critical operating conditions such as strain, temperature and pressure of the elongated tubular member and/or a fluid therein to be monitored. A multiplexing unit is used for allowing selective configuration of individual lengths of optical fiber for creating one or more contiguous optical fiber structures.
US11867944B2
An intact semiconductor wafer (wafer) includes a plurality of die. Each die has a top layer including routings of conductive interconnect structures electrically isolated from each other by intervening dielectric material. A top surface of the top layer corresponds to a top surface of the wafer. Below the top layer, each die has a device layer including optical devices and electronic devices. Each die has a cladding layer below the device layer and on a substrate of the wafer. Each die includes a photonic test port within the device layer. For each die, a light transfer region is formed within the intact wafer to extend through the top layer to the photonic test port within the device layer. The light transfer region provides a window for transmission of light into and out of the photonic test port from and to a location on the top surface of the wafer.
US11867941B2
A light guide assembly, comprising: a substrate and a light guide disposed on the substrate, wherein the top surface of the body comprises a first protrusion having a first slanting surface and a second slanting surface opposite to the first slanting surface for reflecting lights entering into the body, wherein a first outer surface of the body extends from a first lateral surface to the first slanting surface, wherein a highest point of the first slanting surface is located between the first lateral surface and a second lateral surface opposite to the first lateral surface, and a highest point of the second slanting surface is located between the first lateral surface and a lowest point of the second slanting surface.
US11867939B2
A composite optical film comprises: a first substrate; a plurality of reversed prisms disposed on a bottom surface of the first substrate; and a first diffusion film disposed over a top surface of the first substrate.
US11867924B2
A system for visualizing catheter irrigation, the system includes a fluid container, a pump, a schlieren imaging assembly and a processor. The fluid container is configured to: (i) contain a first fluid, which is at least partially transparent and has a first temperature, and (ii) receive into the first fluid a catheter having one or more irrigation holes. The pump is configured to inject, through the one or more irrigation holes, a second fluid, which is at least partially transparent and has a second different temperature. The schlieren imaging assembly is configured to acquire schlieren images of turbulence occurring in the first fluid when injecting the second fluid, and the processor is configured to visualize the irrigation using the schlieren images.
US11867909B2
There is provided an optical device, including a light-transmitting substrate, having at least two parallel major surfaces, edges and an output aperture, an optical element for coupling light waves into the substrate to effect total internal reflection, at least one redirecting element positioned outside of the substrate, and at least one reflecting surface having at least one active side located between the two major surfaces of the light-transmitting substrate for coupling light waves out of the substrate, wherein light waves trapped inside the substrate are coupled out from the substrate through the output aperture substantially inclined in relation to the normal to the substrate major surfaces and are reflected from the redirecting element into a viewer's eye, and wherein the redirecting element is a single flat reflecting surface parallel to the major surfaces of the substrate.
US11867905B2
A display module includes a plurality of light-emitting elements and a sealing element sealing the plurality of light-emitting elements. The sealing element includes a base part including a transparent material and a cover layer. The cover layer is in contact with a surface of the base part and includes a plurality of first patterns, each of which is engraved in an intaglio manner to a first depth, and a plurality of second patterns, each of which is engraved in an intaglio manner to a second depth different from the first depth.
US11867898B2
A method for designing an optical system for providing reliable, robust and successful realization of a distortion variation function is presented. In a preferred embodiment, the proposed distortion variation optical system includes at least two non-symmetrical elements, which are moving in the transverse direction. The proposed freeform lens contains two transmissive refractive surfaces. The freeform elements designed with this method have preferably a flat surface and a non-symmetrical freeform surface. The two plano-surfaces are preferably made to face each other, so that a miniature camera can be offered. The value of the non-symmetrical freeform surface is used to produce variable optical power when the two freeform elements undergo a relative movement in the vertical direction. Using this method, an optical system with an active distortion, smaller form factor, and better imaging quality can be obtained.
US11867894B2
A method for performing SIM microscopy on a sample, includes: generating n raw images of the sample, in each case by illuminating the sample using the same SIM illumination pattern albeit with an individual positioning for each raw image, wherein p orders of diffraction are assigned to the SIM illumination pattern, and generating an image of the sample from the n raw images. An image reconstruction is carried out using the orders of diffraction, wherein t highest orders of diffraction are suppressed during the image reconstruction and n=p−t applies.
US11867892B2
An embodiment in accordance with the present invention provides a miniature microscope capable of performing in vivo, real-time imaging of multiple organ sites in awake and behaving animals (e.g. rodents). A microscope according to the present invention includes multiple optical contrast mechanisms (i.e. contrast arising from neural, hemodynamic and other physiological components). Exemplary contrast mechanisms include, but are not limited to fluorescence, hemoglobin level, deoxyhemoglobin level, and blood flow. The microscope is fully adaptable to in vitro and ex vivo imaging, can be customized to concurrently image at variable magnifications, conduct optogenetic/electrical/chemical stimulations, drug delivery, microdialysis, accompanied by electrical signal recording, wireless image transmission and charging.
US11867890B2
An optical element for light concentration for a predefined wavelength range, includes a holding sleeve which is formed in such a way that a light passage volume is framed by at least one reflective partial surface of the holding sleeve, and a light transmission element, with which the light passage volume is at least partly filled and which is transmissive, at least for the predefined wavelength range. The light transmission element is at least partly formed from at least one medium that is diffuse for the predefined wavelength range, and has at least one first subregion having at least a first diffusivity and a second subregion having at least a second diffusivity differing from the first diffusivity. The disclosure further relates to a method for producing an optical element for light concentration.
US11867888B2
An imaging lens system includes a first lens having a positive refractive power, a second lens having a negative refractive power, a third lens having a positive refractive power, a fourth lens having a positive refractive power, a fifth lens having a negative refractive power, and a sixth lens having a positive refractive power. The F number of the system is 2.0 or less. The following Conditional Expression is satisfied: OAL/(Img HT)<1.50. In the expression, OAL represents a distance from an object-side surface of the first lens to an imaging plane, and Img HT represents a half of a diagonal length of the imaging plane.
US11867886B2
A photographing optical lens assembly includes, in order from an object side to an image side, a first lens element, a second lens element, a third lens element, a fourth lens element and a fifth lens element. The first lens element with positive refractive power has a convex object-side surface. The second lens element with negative refractive power has a convex object-side surface and a concave image-side surface. The third lens element has refractive power. The fourth lens element has refractive power, and an object-side surface and an image-side surface thereof are aspheric. The fifth lens element with negative refractive power has a concave image-side surface, wherein an object-side surface and the image-side surface thereof are aspheric, and at least one of the object-side surface and the image-side surface thereof has at least one inflection point.
US11867885B2
An optical imaging system includes a first lens, a second lens, a third lens, a fourth lens, a fifth lens, a sixth lens, and a seventh lens sequentially arranged along an optical axis from an object side toward an image side. The fifth lens has a positive refractive power, a focal length of the fifth lens is smaller than an overall focal length of the optical imaging system, and −0.38≤R10/f≤−0.32, where R10 is a radius of curvature of an image-side surface of the fifth lens and f is the overall focal length of the optical imaging system.
US11867877B2
An annular light trapping component includes an inner surface, an outer surface, an object-side surface and an image-side surface. The inner surface includes multiple L-shaped annular grooves. The annular light trapping component includes multiple stripe-shaped structures in the L-shaped annular grooves. The L-shaped annular grooves include an object-side L-shaped annular groove closest to the object-side surface and an image-side L-shaped annular groove closest to the image-side surface. A bottom diameter of the image-side L-shaped annular groove is larger than a bottom diameter of the object-side L-shaped annular groove. Each L-shaped annular groove includes a first side and a second side located between the object-side surface and the image-side surface. The stripe-shaped structures are disposed on the first side or the second side. A degree of inclination between the first side and the central axis is larger than a degree of inclination between the second side and the central axis.
US11867873B2
A multilayer optical film including: an A layer formed of an alicyclic structure-containing polymer resin; and a B layer disposed on at least one surface of the A layer to be in direct contact therewith, the B layer serving as a masking layer, wherein the B layer is a cured product of a material Y including a dispersion of a crosslinkable polymer (a) and solid particles (b), and the B layer has a thickness tB of 10 μm or more and 25 μm or less. A production method including the steps of applying the material Y onto a surface of the A layer, to form a layer of the material Y; and curing the layer of the material Y.
US11867869B2
A process of constructing a micromodel for a multiple porosity system includes: drilling a well; coring the well for acquiring core plugs from the well; producing thin section images of the core plugs for acquiring a first feature of the core plugs; and transforming the thin section images to binary images.
US11867861B2
Methods and systems for performing log quality control on well data of non-key wells is provided. A method of identifying elastic facies in non-key wells as part of Log Quality Control (LQC) includes selecting one or more key wells, building a reference model of elastic facies using the well log data of the selected one or more key wells, propagating the reference model to well data of one or more non-key wells, benchmarking the well data of the non-key wells with the reference model, and calibrating the well data of the non-key wells with the reference model.
US11867853B2
A neutron detector having high sensitivity of detection for low energy neutrons is provided. The neutron detector 10 includes a detecting element including a Si semiconductor layer 2, a first electrode 1 formed on one main surface of the Si semiconductor layer 2 and a second electrode 4 formed on the other main surface of the Si semiconductor layer 2, in which the Si semiconductor layer 2 includes a P-type impurity region 2a in contact with the second electrode 4 and an N-type impurity region 2b in contact with the first electrode 1; and a radiator 8 arranged to face the first electrode 1. In addition, a personal dosemeter and a neutron fluence monitor including the same are provided.
US11867852B1
Embodiments herein describe an atomic sensor that includes a photonic die that outputs optical signals on a top surface. These optical signals can be directed and shaped as needed to satisfy a particular type of atomic sensor. In one embodiment, an atomic source (e.g., rubidium or cesium) is disposed on the photonic chip to emit atoms when heated. A collimator can then direct the emitted atoms along a path that intersects with the optical signals. This intersection can be used to detect motion (e.g., rotation and acceleration) of the atomic sensor.
US11867836B2
A method of determining a temporal position of a received signal within a sample series is disclosed. The method includes sampling a sensor at a sampling frequency to generate the sample series. A matched filter set of matched filters is applied to the sample series to generate a matched filter correlation set of matched filter correlations, wherein impulse responses of respective matched filters correspond to a template signal at the sampling frequency of the sensor shifted by a sub-interval shift. The matched filter correlations are evaluated to determine a received signal sub-interval shift. The temporal position of the received signal within the sample series is determined based on at least the received signal sub-interval shift.
US11867834B2
A method for building a coherent radar cross-section (RCS) model database for real-time dynamic simulation of range-Doppler radars is disclosed. The database may be used with radar sensors that employ different waveforms. A pre-processing operation before the dynamic simulation performs fast Fourier Transforms (FFTs) to interpolate the target frequency responses from the database to match the frequency samplings of the radar used in the dynamic simulation. The method determines the frequency responses of the targets to a reference chirp in a coherent processing interval (CPI) and the radial velocities of the targets relative to the radar at the time of the reference chirp. The method extrapolates, using FFTs, the frequency responses of the targets to the reference chirp across the velocity dimension based on the relative radial velocities to determine the frequency responses of the targets to the other chirps across the CPI, reducing the computational burden for the simulation.
US11867832B2
A miniature radar target simulator (MRTS) and a system comprising a plurality of MRTS's are described. The MRTS and system are useful for emulating echo signals for a radar DUT with reduced interference. Illustrative radar test systems desirably generate the intended (emulated) radar targets and reduce unwanted (“ghost”) signals, which can result in “ghost targets,” and errant/ambient electromagnetic radiation that reduces the performance and reliability of known re-illuminators and systems including same.
US11867818B2
A method for performing a simultaneous location and mapping of a scanner device includes detecting a set of lines in a point cloud, and identifying a semantic feature based on the set of lines. The method further includes assigning a first scan position of the scanner device in the surrounding environment at the present time t1 as a landmark, and linking the landmark with the portion of the map. The method further includes determining that the scanner device has moved, at time t2, to the scan position that was marked as the landmark based on identifying said semantic feature in another scan-data. In response, a second scan position at time t2 is determined. Also, a displacement vector is determined for the map based on a difference between the first scan position and the second scan position. Subsequently, a revised second scan position is computed based on the displacement vector.
US11867816B2
A laser gas detection system includes a laser gas detector and a near-eye display device. The laser gas detection system provided in the present disclosure incorporates modern display technologies and modern communication facilities to present detection results to a user of the laser gas detection system in various intuitive and highly readable forms. The laser gas detection system is further capable of projecting the detection results to a field of view of the user through the near-eye display device.
US11867814B1
A frequency modulated continuous wave (FMCW) light detection and ranging (LIDAR) system that includes an optical source to generate light at a target frequency. The system also includes a first transistor to transmit a modulation current through a modulation path that includes the optical source and a modulation resistor. The system also includes electro optical circuitry coupled to the first transistor to produce a phase locked loop. The system also includes a second transistor to transmit a bias current through a bias path that includes the optical source and is separate from the modulation path, wherein the bias path is separate from the modulation path.
US11867811B2
Provided are a LiDAR device and a method of operating the LiDAR device. The LiDAR device includes a light-emitting unit configured to emit modulated light onto an object, a light-receiving unit configured to receive the modulated light reflected by the object, a computation unit configured to calculate a distance to the object based on a reception signal of the modulated light provided by the light-receiving unit, a modulation unit configured to provide a modulation signal to the light-emitting unit to generate the modulated light, and a controller configured to control operations of at least one of the light-emitting unit, the light-receiving unit, the computation unit, and the modulation unit.
US11867808B2
One example system comprises a light source configured to emit light. The system also comprises a waveguide configured to guide the emitted light from a first end of the waveguide toward a second end of the waveguide. The waveguide has an output surface between the first end and the second end. The system also comprises a plurality of mirrors including a first mirror and a second mirror. The first mirror reflects a first portion of the light toward the output surface. The second mirror reflects a second portion of the light toward the output surface. The first portion propagates out of the output surface toward a scene as a first transmitted light beam. The second portion propagates out of the output surface toward the scene as a second transmitted light beam.
US11867803B2
The present disclosure relates to a global positioning system for compensating for relative positioning errors between vehicles. A follower vehicle of the global positioning system includes a correction message receiver configured to receive correction message including velocity information about a leader vehicle and GNSS raw measurements of the leader vehicle from the leader vehicle, a relative positioning result calculator configured to calculate a relative positioning result between the leader vehicle and the follower vehicle based on the GNSS measurements of the leader vehicle, and a relative positioning result corrector configured to calculate a corrected relative positioning result through an operation based on the calculated relative positioning result and the velocity information about the leader vehicle.
US11867799B2
A method of using a radar sensor for a security system to determine a range for a sensed moving object or person, the method including: transmitting, from the radar sensor, a plurality of radar pulses and, when the object or person is present to reflect the radar pulses, receiving a corresponding plurality of pulses.
US11867796B2
The secondary radar includes an antenna having a radiation pattern forming a sum channel, designated SUM, a radiation pattern forming a difference channel, designated DIFF, and a pattern forming a control channel, designated CONT, the targets are located by implementing the following steps: detecting ADS-B squitters received via the CONT channel, via the SUM channel and via the DIFF channel; measuring at least the power of the squitters and their azimuth with respect to the radar; the location of a target transmitting ADS-B squitters being computed by exploiting at least the detection of one ADS-B squitter, in light of the latitudinal and longitudinal position of the radar and of the azimuthal measurement with respect to the radar, the position cell, designated the CPR cell, coded in the squitter being selected via the azimuthal measurement.
US11867794B2
An apparatus for detecting and recording insect flying activities, such as outside a bee hive, with a Doppler radar is described. Also described is a system including a plurality of apparatuses for detecting and recording insect flying activities, such as outside a bee hive, with a Doppler radar.
US11867792B2
An object velocity detection method includes: obtaining a first reception signal and a second reception signal that are received in different time intervals through a radar sensor; determining a Doppler effect based on the first reception signal and the second reception signal; determining an angle value of an object based on a signal obtained by compensating for the Doppler effect; obtaining a compensated signal by compensating for the angle value in the second reception signal; and determining a velocity of the object based on the compensated signal.
US11867790B2
A plurality of beams of illumination light are emitted from a LIDAR device over a range of angles and scanned about an axis of rotation. The range of angles includes the axis of rotation. Intermediate electronics boards provide mechanical support and electrical connectivity between a rotating electronics board and various elements of a light emission and collection engine. One or more of the optical elements of the collection optics, the illumination optics, or both, is constructed from one or more materials that absorb light outside of a predetermined wavelength range. An overmolded lens is fixedly coupled to one or more of the light detecting elements to collect incoming light over a larger range of angles. A lens element is disposed in the light path between a light emitting element and the illumination optics to flatten the intensity distribution of light emitted from the light emitting element to reduce peak intensity.
US11867777B2
The invention concerns a device and a method for measuring the relative position and angles between two bodies to be measured (7, 77). The invention is characterized in that it comprises one or more permanent magnets (6) and in that the position to be measured is determined indirectly via a magnetic field. The magnetic field is detected by one or more magnetic field sensors (3) read by a microchip. A mathematical minimization method is used to calculate back to the position and angles of the permanent magnet system (6) in relation to the magnetic field sensors (3). The energy required to read out the sensors can be obtained from the excitation field of a readout device. The sensor can perform without energy supply and can be read out by means of standard readout devices, such as an NFC-capable mobile telephone.
US11867756B2
This disclosure describes a reduced pin bus that can be used on integrated circuits or embedded cores within integrated circuits. The bus may be used for serial access to circuits where the availability of pins on ICs or terminals on cores is limited. The bus may be used for a variety of serial communication operations such as, but not limited to, serial communication related test, emulation, debug, and/or trace operations of an IC or core design. Other aspects of the disclosure include the use of reduced pin buses for emulation, debug, and trace operations and for functional operations.
US11867748B2
This application discloses an electrical control device detection circuit, a detection method, and an electric vehicle. The detection circuit includes a drive circuit configured to detect an electrical control device. The drive circuit includes a drive power module, a high-side switch unit, and a low-side switch unit. The detection circuit includes: a detection power module, a first switch module, a second switch module, a first detection module, a second detection module, and a control module. The control module is configured to obtain an electrical signal at a third end of the first detection module and/or an electrical signal at a second end of the second detection module; and determine, based on the electrical signal at the third end of the first detection module and/or the electrical signal at the second end of the second detection module, whether a fault occurs in the drive circuit of the electrical control device.
US11867740B2
A method and apparatus for identifying a fault in an alternating current electrical grid is provided.
US11867729B2
A system for generation of electrical power including an inverter connected to a photovoltaic source including a theft prevention and detection feature. A first memory is permanently attached to the photovoltaic source. The first memory is configured to store a first code. A second memory is attached to the inverter. The second memory configured to store a second code. During manufacture or installation of the system, the first code is stored in the first memory attached to the photovoltaic source. The second code based on the first code is stored in the second memory. Prior to operation of the inverter, the first code is compared to the second code and based on the comparison; the generation of the electrical power is enabled or disabled.
US11867721B1
Embodiments are directed to probe structures, arrays, methods of using probes and arrays, and/or methods for making probes and/or arrays. In the various embodiments, probes include at least two springs separated by a movable stop while in other embodiments, three or more springs may be included with two or more movable stops. Movable stops interact with fixed stops that are either part of the probes themselves or part of separate elements that engage with the probes (such as array frame structures) that provide for the retention, longitudinal and/or lateral positioning of probes and possibly for orientation of the probes about a longitudinal axis. Fixed stops provide for controlled limits for movement of the movable stops which in turn allow for enhanced compliant or elastic performance of the probes upon increased probe compression in either one direction, in the order of tip compressions, or in both directions or tip compression orders (e.g. to provide one or more decreases in spring constant upon reaching one or more compression levels (or biasing force levels) with a given tip compression direction and/or order).
US11867719B1
A fuse monitoring device for monitoring a fuse supported by a fuse block, the fuse monitoring device including a housing. The housing includes a holder attachment mechanism configured to connect the fuse monitoring device to a fuse block. The housing also includes a mounting attachment mechanism configured to connect the fuse monitoring device to a mounting structure and at least one sensor configured to be operably connected to a fuse and configured to measure fuse data associated with the fuse. The monitoring device further includes at least one processor communicatively coupled to the at least one sensor.
US11867713B2
An optomechanical inertial reference mirror combines an optomechanical resonator with a reflector that serves as an inertial reference for an atom interferometer. The optomechanical resonator is optically monitored to obtain a first inertial measurement of the reflector that features high bandwidth and high dynamic range. The atom interferometer generates a second inertial measurement of the reflector that features high accuracy and stability. The second inertial measurement corrects for drift of the first inertial measurement, thereby resulting in a single inertial measurement of the reflector having high bandwidth, high dynamic range, excellent long-term stability, and high accuracy. The reflector may be bonded to the resonator, or formed directly onto a test mass of the resonator. With a volume of less than one cubic centimeter, the optomechanical inertial reference mirror is particularly advantageous for portable atomic-based sensors and systems.
US11867711B2
A method and apparatus for measurement of density of a photosensitive printing plate (130) having a mask (132) embodying image information corresponding to an image to be printed. A density measurement system includes a first radiation source (112) spaced apart from and adjacent the plate and configured to emit radiation having a first wavelength or range of wavelengths toward the plate. A densitometer (110) spaced apart from and adjacent the plate in a fixed relationship relative to the first radiation source receives and measures an amount of the first radiation transmitted through or reflected by the plate and the mask during relative movement between the plate and the density measurement system. The densitometer readings are processed to provide an output correlating to quality of the mask. The density measurement system may be coupled to an exposure system (120,122,124) for curing the plate.
US11867706B2
The methods and systems may include LC-MS/MS. For example the method may include obtaining MS/MS data for a predetermined MS/MS transition for THC and/or at least one THC metabolite and CBD and/or at least one CBD metabolite, and determining a ratio of the amount of the CBD and/or at least one CBD metabolite to the amount of the THC and/or at least one THC metabolite for the biological sample. In certain embodiments, the methods and/or systems are used to distinguish CBD from THC use in a subject.
US11867704B2
A method for determining a narcotic in a mixture comprising at least one interferant. The method comprises: (a) determining a voltage at which, in absence of the interferant, a voltammetric signal of the narcotic can be detected; (b) contacting an electrode with the mixture comprising the at least one interferant and potentially comprising the narcotic; (c) applying a pretreatment potential to the electrode for a duration of at least 5 seconds, the pretreatment potential measuring between −0.4 V and −2 V versus Ag/AgCl; (d) measuring a voltammetric response of the mixture, the measurement comprising at least the determined voltage; and (e) determining whether the narcotic is present in the mixture by analyzing whether the voltammetric signal of the narcotic, resolved from a voltammetric signal of the interferant, can be detected in the measured voltammetric response.
US11867699B2
This invention provides a method for detecting an analyte in a sample, including a step of contacting said analyte with a nanoparticle to facilitate binding thereto, wherein the nanoparticle comprises: (i) a core; (ii) pores extending radially from said core and being defined by spaces between an array of dendritic spikes radiating outwardly from a surface of the core, wherein the pores have an average pore size of between about 10 nm and about 20 nm; (iii) a binding agent for binding the analyte; and (iv) a detection agent immobilized within said pores; to thereby detect said analyte. This invention also provides kits, compositions and products comprising said nanoparticle.
US11867697B2
A pancreatic cancer detection method is provided, including: (a) bringing extracellular vesicles, which are in a body fluid sample derived from a subject into contact with one or more kinds of lectins; (b) measuring an amount of the extracellular vesicles bound to the one or more kinds of lectins after (a); and (c) evaluating the presence of pancreatic cancer in the subject based on the amount of the extracellular vesicles measured in (b). In addition, a pancreatic cancer detection kit is provided, including: a solid-phase carrier on which one or more kinds of lectins are immobilized; and an antibody specifically binding to a pan-extracellular vesicle membrane protein or an antigen-binding fragment thereof.
US11867695B2
The invention relates generally to compositions and methods for detecting protease activity in a subject or a biological sample using activatable antibodies, and the use of these compositions and methods in a variety of diagnostic indications.
US11867693B2
Devices and methods are provided for the detection of CSF in a biological sample. In certain embodiments the device is a lateral flow device comprising: a porous substrate; a sample addition zone disposed on or in said porous substrate; a detection zone disposed on or in said porous substrate where said detection zone comprises at least a first test line (T1) and a second test line (T2) each test line comprising binding moieties that bind a complex formed between beta-trace protein (βTP) and an indicator attached to a βTP binding molecule; wherein said porous substrate defines a flow path through which a sample applied to the sample addition zone flows under capillary action away from said sample addition zone into said detection zone; and wherein said first test line (T1) and said second test line (T2) are is configured so that either no test line signal or just a signal at the first test line (T1) is detectable when βTP concentration in a sample applied to said device is lower than the βTP level indicative of a CSF leak; and said second test line (T2) is configured so that a signal is detectable at said second test line when βTP concentration in a sample applied to said device is greater than the βTP level indicative of a CSF leak.
US11867689B2
Disclosed are renal tissues and arrays thereof that include a layer of renal interstitial tissue, the renal interstitial tissue comprising renal fibroblasts and endothelial cells; and a layer of renal epithelial tissue, the renal epithelial tissue comprising renal tubular epithelial cells, the renal epithelial tissue in contact with the layer of renal interstitial tissue to form a three-dimensional, engineered, biological renal tissue. Also disclosed are methods of fabricating and using the same.
US11867687B2
The present invention provides methods of determining cell sensitivity to a therapeutic agent.
US11867686B2
A method for optimal selection of cytotoxic agents for organ or region specific therapy that includes extracorporeal filtration of the cytotoxic agent from blood drained from the organ or region being treated and return of the filtered blood to a mammal is disclosed.
US11867684B2
The invention generally relates to a sample dispenser including an internal standard and methods of use thereof.
US11867681B2
A TOC analyzer for determining a carbon content of a sample includes: a processing unit for removing carbon dioxide gas from the carrier gas before the oxidation of the sample, wherein the processing unit has a binder for binding the carbon dioxide gas from the carrier gas, wherein a defined water content is provided within the binder, wherein the processing unit is configured for moistening the binder by means of water vapor contained in the carrier gas; a condensation unit for condensing the water vapor resulting from the vaporization and/or oxidation of the sample to form a condensate, wherein the condensation unit has an outlet for the condensate toward a moistening unit; and the moistening unit for moistening the carrier gas by means of the condensate. A method for moistening a binder using such a TOC analyzer is further disclosed.
US11867672B2
An apparatus includes a flow cell body, a plurality of electrodes, an imaging assembly, and one or more barrier features. The flow cell body defines one or more flow channels and a plurality of wells defined as recesses in the floor of each flow channel. Each well is fluidically coupled with the corresponding flow channel. The flow cell body further defines interstitial surfaces between adjacent wells. Each well defines a corresponding depth. Each electrode is positioned in a corresponding well of the plurality of wells. The electrodes are to effect writing of polynucleotides in the wells. The imaging assembly is to capture images of polynucleotides written in the wells. The one or more barrier features are positioned in the wells, between the wells, or above the wells. The one or more barrier features contain reactions in each well, reduce diffusion between the wells, or reduce optical cross-talk between the wells.
US11867671B2
The present invention provides a highly versatile method for amino acid analysis, the method enabling separation and analysis of amino acids in a sample with high precision in a shorter time. This method is a method for amino acid analysis, the method including a step of allowing a sample containing a plurality of amino acids to flow together with an eluent 2 through a separation column 4 packed with a cation exchange resin, thereby separating the amino acids, and a step of detecting the separated amino acids, wherein the eluent 2 is an eluent containing a divalent or higher inorganic acid, a cation source, and water, and having a pH of 5.0 or lower, and the sample is allowed to flow through the separation column 4 heated by applying a temperature gradient including a temperature region of 100° C. or higher.
US11867669B2
A sampler for liquid chromatography is described. The sampler includes an injection valve and a sample loop. The injection valve includes one waste port, two sample loop ports, and two high-pressure ports. The sample loop port includes a first loop part and a second loop part. The injection valve can be configured to have LOAD position and INJECT position. The injection valve can also be configured to have one or more additional positions such as a FULL PURGE position, a PUMP PURGE position, and a NEGATIVE PRESSURE position.
US11867660B2
Device and methods for controlling pH or ionic gradient comprising a multisite array of feedback electrode sets comprising electrodes and pH sensing elements. The electrodes can include a reference electrode, counter electrode, and a working electrode. The device and methods iteratively select an amount of current and/or voltage to be applied to each working electrode, apply the selected amount of current and/or voltage to each working electrode to change pH of a solution close to the working electrode, and measure the signal output of the sensing element. The multisite array can include feedback and non-feedback electrode sets.
US11867657B2
A gas sensor includes a gate electrode; a dielectric layer covering one surface of the gate electrode; an indium (In) gallium (Ga) zinc (Zn) oxide (O) (IGZO) thin-film formed over the dielectric layer, and first and second metallic electrodes formed on a surface of the IGZO thin-film to act as source and drain, respectively. The IGZO thin-film has an In concentration of 11%+/−3%, Ga concentration of 11%+/−3%, Zn concentration of 7%+/−3%, and O concentration of 71%+/−3%, with a sum of the concentrations being 100%, and the gas interacts with the IGZO thin-film and changes a current through the IGZO thin-film.
US11867653B2
A system and method for controlled fluid handling and processing of singulated biosensors. The system includes a consumable for mounting and protecting biosensors.
US11867650B2
Optical component integrity monitoring circuitry monitors an optical component integrity sensing path in an optical component. If a rise in resistance of the sensing path is detected, the circuitry prevents the optical component from emitting light. The optical component may have a light-emitting device that emits light through an optical element. The sensing path may have a first path that is used to detect damage to the optical element and a second path that is coupled to a package covering the optical element and light-emitting device. The first path may have a segment formed from a metal trace on the optical element and a segment formed from a wire bond, providing mechanical compliance to tolerate strains expected in the use case. The second path ensures that the package is present to constrain movement of the optical element and its wires within a safe envelope defined by the package interior.
US11867644B2
Methods and systems are provided for serial femtosecond crystallography for reducing the vast amount of waste of injected crystals practiced with traditional continuous flow injections. A micrometer-scale 3-D printed water-in-oil droplet generator device includes an oil phase inlet channel, an aqueous phase inlet channel, a droplet flow outlet channel, and two embedded non-contact electrodes. The inlet and outlet channels are connected internally at a junction. The electrodes comprise gallium metal injected within the 3-D printed device. Voltage across the electrodes generates water-in-oil droplets, determines a rate for a series of droplets, or triggers a phase shift in the droplets. An external trigger generates the droplets based on the frequency of an XFEL utilized in droplet detection, thereby synchronizing a series of droplets with x-ray pulses for efficient crystal detection. The generated droplets can be coupled to an SFX with XFEL experiment compatible with common liquid injector such as a GDVN.
US11867622B2
A process analyzer adapter includes: a first part connectable to a process analyzer, the first part being rotatable about a first axis; a second part; and a third part. The first part is rotationally connected to the second part. The second part is rotationally connected to the third part. The second part is rotatable about a second axis, rotation of the second part about the second axis tilting the first axis. The third part is connectable to a flange of an industrial process equipment.
US11867611B2
A system is used to excite an object at a vibration frequency, in order to induce stationary or travelling waves having the vibration frequency on the surface of the object. An optical interferometer is configured to use optical interference to determine vibration amplitude and phase data of the stationary or travelling wave at each of a plurality of points on the surface, relative to a reference phase. A processing system is used to apply a spatial derivative filter to the vibration phase data, and the resulting spatial-derivative-of-phase data is processed to determine a property of the object, and is further processed to generate graphical-representation data for outputting on a display device.
US11867610B2
Any one or both of an optical system with a structured lighting pattern and a structured detecting system having a plurality of regions with different optical characteristics are used. In addition, optical signals from an object to be observed through one or a small number of pixel detectors are detected while changing relative positions between the object to be observed and any one of the optical system and the detecting system, time series signal information of the optical signals are obtained, and an image associated with an object to be observed from the time series signal information is reconstructed.
US11867608B2
Techniques for processing ore include the steps of causing an imaging capture system to record a plurality of images of a stream of ore fragments en route from a first location in an ore processing facility to a second location in the ore processing facility; correlating the plurality of images of the stream of ore fragments with at least one or more characteristics of the ore fragments using a machine learning model that includes a plurality of ore parameter measurements associated with the one or more characteristics of the ore fragments; determining, based on the correlation, at least one of the one or more characteristics of the ore fragments; and generating, for display on a user computing device, data indicating the one or more characteristics of the ore fragments or data indicating an action or decision based on the one or more characteristics of the ore fragments.
US11867605B2
Aspects of the present disclosure include a particle sorter with a droplet deflector configured to apply a known offset deflection force to a droplet stream. Particle sorters according to certain embodiments include a flow cell, a light source, e.g., laser, for irradiating an interrogation point of the flow cell, a detector for detecting light from the interrogation point, a droplet generator for producing a droplet stream from fluid exiting the flow cell and a droplet deflector configured to apply a known offset deflection force to the droplet stream. In some cases, the droplet deflector comprises first and second plates configured to be offset from one another. Methods and particle sorting modules for applying a known offset deflection force are also provided.
US11867604B2
Systems and methods include a method for generating a real-time permeability log. Historical mud gas-permeability data is received from previously-drilled and logged wells. The historical mud gas-permeability data identifies relationships between gas measurements obtained during drilling and permeability determined after drilling. A formation hydrocarbon mobility model is trained using machine learning and the historical mud gas data. Real-time gas measurements are obtained during drilling of a new well. A real-time permeability log is generated for the new well using the formation hydrocarbon mobility model and real-time gas measurements.
US11867602B2
A device, system and method for the detection and screening of plastic microparticles in a sample is disclosed. A nanoporous silicon nitride membrane is used to entrap plastic microparticles contained in the sample. The sample may be a water sample, an air sample, or other liquid or gas sample. The entrapped plastic microparticles are then heated or otherwise processed on the nanoporous silicon nitride membrane. An imaging system observes the nanoporous silicon nitride membrane with the entrapped plastic microparticles to determine the type and quantity of the various plastic microparticles that are entrapped on the membrane.
US11867601B2
A method of liquid characterisation using an optical characterisation system. The optical characterisation system comprises an optical element comprising a light source and light detector, and defining a light path extending between the light source and light detector. The detector resolves light intensities at varying wavelengths. The system also comprises a liquid container and a photonic crystal attached to the first container surface and facing the interior. The method comprises: recording a first transmission spectrum, wherein at least part of the first and second container surfaces, the interior containing liquid and the photonic crystal intercept the light path, and the interior intercepts the light path before the photonic crystal, and recording a second transmission spectrum. At least part of the first and second container surfaces, the interior containing liquid and the photonic crystal intercept the light path. The photonic crystal intercepts the light path before the interior.
US11867588B2
A tire testing device includes a carriage configured to rotatably hold a test wheel provided with a test tire and being capable of travelling on a base along a road surface in a state where the test wheel is made to contact the road surface, and a driving system configured to drive the test wheel and the carriage. The driving system includes a carriage driving part configured to drive the carriage with respect to the road surface in a predetermined speed, a test wheel driving part configured to drive the test wheel in a rotating speed corresponding to the predetermined speed, a driving part configured to generate power to be used to drive the carriage and the test wheel, and a power distributing part configured to distribute power generated by the driving part to the carriage driving part and the test wheel driving part.
US11867583B2
Disclosed are pressure sensors including a die and an application-specific integrated circuit (ASIC) mounted on a top surface of a substrate. The pressure sensor can define an inner volume and a bottom opening configured to abut the substrate. The die and ASIC are mounted on the top surface of the substrate within the inner volume. The substrate defines a first aperture therethrough and the die defines a second aperture therethrough in a direction along an axis perpendicular to the substrate, the first aperture and the second aperture being aligned. Metallic barrier(s) disposed on a bottom surface of the substrate, circumferentially about the first aperture, can be at least partially coated with solder mask to reduce or prevent flow of unwanted materials past the metallic barriers and through the first aperture. The substrate can include electrical connection pads on the bottom surface configured to be in communication with a daughter board.
US11867575B2
A pressure/force sensor comprises a diaphragm structure including a sensing element and a lead structure extending from the diaphragm structure and including first and second traces electrically coupled to the sensing element. The diaphragm structure and the lead structure include a circuit assembly comprising a common insulating layer and a common conductor layer on the insulating layer. The conductor layer includes at least a portion of the sensing element and at least the first trace.
US11867564B2
Various embodiments disclosed herein describe a divided-aperture infrared spectral imaging (DAISI) system that is adapted to acquire multiple IR images of a scene with a single-shot (also referred to as a snapshot). The plurality of acquired images having different wavelength compositions that are obtained generally simultaneously. The system includes at least two optical channels that are spatially and spectrally different from one another. Each of the at least two optical channels are configured to transfer IR radiation incident on the optical system towards an optical FPA unit comprising at least two detector arrays disposed in the focal plane of two corresponding focusing lenses. The system further comprises at least one temperature reference source or surface that is used to dynamically calibrate the two detector arrays and compensate for a temperature difference between the two detector arrays.
US11867560B2
A non-contact temperature measuring device for an accessory comprises a body unit; a fixing unit to which the body unit is coupled; a distance sensor configured to measure a distance to an object; a temperature sensor configured to measure a temperature of the object; a control unit operatively connecting the distance sensor and the temperature sensor to obtain the temperature of the object; a display unit displaying the temperature obtained; and a connector configured to supply power, wherein the fixing unit includes a coupling part including a receiving groove capable of receiving the connector of the body unit, a support part connected to the coupling part and having an adhesive surface for bonding to another device; and an outer part configured to be connected to the coupling part, and when the body unit is fastened to the coupling part, surround an outer surface of the body unit.
US11867558B2
Optical systems have uses, such as in spectrometers, for directing a beam. A spectrometer, for example, utilizes an optical system for directing an incident beam toward a sample and receiving a spectroscopy signal from the sample. In various implementations, for example, an optical system may be further configured to move a beam with respect to a target, such as a sample, and still provide a home position where the beam is directed in a stationary configuration. A self-homing (e.g., self-centering) optical system may provide a “home” position in which the beam is directed in a first stationary mode while still allowing a focused beam to be moved with respect to a target in a second dynamic mode.
US11867541B2
This application relates to methods and apparatus for distributed fibre optic sensing and especially to the processing of signals derived from such sensing techniques to characterise events of interest. The application describes a method of distributed fibre optic sensing, comprising; performing distributed fibre optic sensing so as to generate at least one set of measurement signals from each of a plurality of sensing channels of an optical fibre (101) in response to at least one event of interest. For each set of measurement signals, processing the measurement signals from different sensing channels according to an association metric to determine whether any sensing channels are associated with one another and form at least one association matrix indicative of the sensing channels that are associated with one another. The method further comprising performing distributed fibre optic sensing to acquire a further set of measurement signals from said sensing channels in response to a further event of interest and processing said further set of measurement signals based on said at least one association matrix to characterise said further event of interest.
US11867535B2
Actuators for rotating an optical-path-folding-element with two, first and second, degrees of freedom in an extended rotation range around two respective rotation axes, folded cameras including such actuators and dual-cameras including a folded camera as above together with an upright camera.
US11867526B2
A map generation apparatus generating a map for use in acquiring a position of a subject vehicle. The map generation apparatus includes: an in-vehicle detection unit configured to detect a situation around a subject vehicle in traveling; a microprocessor and a memory connected to the microprocessor. The microprocessor is configured to perform: extracting one or more feature points from a detection data acquired by the in-vehicle detection unit; generating a map with the feature points extracted from the detection data in the extracting; recognizing a landmark on the map generated in the generating; determining an importance of the landmark recognized in the recognizing; and correcting a number of the feature points included in the map generated in the generating, based on the importance determined in the determining.
US11867506B2
A scanning device applied to an optical coherence tomography system integrates a scanning lens group required by the coherence tomography system into a fundus imaging system, so that the coherence tomography system and the fundus imaging system can share the scanning lens group for focusing. The above-mentioned scanning device can shorten a response time of focusing and reduce the volume of the system. An optical coherence tomography system including the above-mentioned scanning device is also disclosed.
US11867505B2
Interferometric speckle visibility spectroscopy methods, systems, and non-transitory computer readable media for recovering sample speckle field data or a speckle field pattern from an off-axis interferogram recorded by one or more sensors over an exposure time and determining sample dynamics of a sample being analyzed from speckle statistics of the speckle field data or the speckle field pattern.
US11867503B2
An anomaly detection system that outputs an anomaly detection signal before a safety valve of a secondary battery is opened is provided. The anomaly detection system includes a strain sensor, a memory, and a comparator. The memory has a function of retaining an analog potential, and the comparator has a function of comparing a potential output by the strain sensor and the analog potential retained by the memory. The strain sensor is attached to the secondary battery before use, and a predetermined potential is retained in the memory. When a housing of the secondary battery expands while the secondary battery is used, and the potential output by the strain sensor becomes higher (or lower) than the predetermined potential, an anomaly detection signal is output.
US11867501B2
A system for calibrating an equipment, the system including a beam splitter; a first reticle configured to be removably attached to the equipment; and an image capture device including an image plane, wherein an image of the first reticle is configured to be received by way of the beam splitter at the image plane along an optical axis of the beam splitter, wherein the orientation as indicated by the first reticle is compared to an orientation of the image plane and if the orientation as indicated by the first reticle differs from the orientation of the image plane, the equipment is rotated about the optical axis of the beam splitter such that the orientation as indicated by the first reticle matches the orientation of the image plane.
US11867495B2
The present disclosure provides an electronic device and a control method for same. The electronic device of the present disclosure includes a sensor, a display, a camera, and a processor. The processor determines a boundary area between a wall surface and an area other than the wall surface area from an image frame acquired by the camera, determines the distance between the electronic device and a wall surface corresponding to the wall surface area on the basis of the position of the electronic device and the determined boundary area, the position of the electronic device being determined by the sensor, and controls the display so that an object is displayed on the walls surface area in a size corresponding to the determined distance.
US11867491B2
Ammunition cartridge comprising a rigid casing including a tubular sleeve and a base closing an end of the casing, a projectile mounted at another end of the casing, a propellant charge contained inside the casing, and an ignition device. The ignition device comprises an ignition charge arranged to ignite the propellant charge at a point of ignition distal from the base and proximal the projectile.
US11867481B2
A conducted electrical weapon may interchangeably receive a plurality of magazines. A magazine may be releasably engaged with a magazine bay of the conducted electrical weapon. Engagement of a magazine with the magazine bay may expose a bottom surface of the magazine. Each magazine may comprise a plurality of firing tubes. A magazine may be configured to launch at least one electrode from at least one firing tube of the plurality of firing tubes. A control circuit may be configured to provide an ignition signal to less than all of the plurality of firing tubes. A first pair of firing tubes may be oriented to achieve a minimum electrode spread at a first range. A second pair of firing tubes may be oriented to achieve a minimum electrode spread at a second range. The plurality of firing tubes may be arranged in an array comprising a column of firing tubes.
US11867480B2
Methods and apparatus for detecting a magnitude of a voltage at a face of a conducted electrical weapon (“CEW”). The magnitude of the voltage may be used to determine whether a pulse of a stimulus signal was delivered to a target. Structures for detecting the magnitude of the voltage may include structures that provide a stimulus voltage.
US11867468B2
A plate heat exchanger arrangement includes a plate pack and an outer casing surrounding the plate pack. At least one partition plate is arranged between the heat exchange plates of the plate pack, which divides the plate pack to the separate plate pack parts. The plate heat exchanger arrangement is provided with inlet and outlet connections for each plate pack part which are arranged to connect the inner parts of the plate pairs of said plate pack part. A connection pipe is arranged inside a flow passage of the plate pack part between the end plate of the outer casing and the partition plate such that a first end of the connection pipe is attached to the partition plate to form a connection to the flow passage of the plate pack part and a second end thereof extends through an end plate of the outer casing.
US11867452B2
A method of making a liner for an appliance is provided that includes: mixing a polymeric capping layer precursor and a pigment additive; forming the capping layer precursor and the pigment additive into a capping layer at a capping layer formation temperature; and rolling the capping layer, a barrier layer and a polymeric base layer together to form a liner, each of the capping layer, the barrier layer and the base layer at about the capping layer formation temperature. Further, the liner comprises a capping region, a barrier region and a base region, the capping region comprising the pigment additive.
US11867445B2
In a method for controlling an ice maker, a motor rotates an ejector finger relative to an ice tray in a first direction and in a second direction opposite the first direction to discharge ice from the ice tray. When an error condition occurs, the ice maker enters a first error mode, during which an ice maker heater is turned on until the temperature of the ice tray reaches a predetermined temperature or until an ice maker heater error correction time elapses. When the ejector finger is at a home position, the motor rotates in the second direction until the ejector finger is not at the home position or for a first predetermined number of steps, whichever occurs first, and then rotates in the first direction until the ejector finger is at the home position.
US11867428B2
The present disclosure discloses a heat exchange pipe, a heat exchanger and a water heating apparatus. The heat exchange pipe comprises: a pipe body and a plurality of fins fixedly disposed to sleeve the pipe body; a flow guiding structure is provided at a partial outer edge of the fin; and a flow guiding flue is formed between the flow guiding structure and an outer wall of the pipe body. The heat exchange pipe, the heat exchanger and the water heating apparatus provided by the present disclosure can improve the flue gas flow path and the heat exchange efficiency.
US11867426B2
The cooling systems and methods of the present disclosure involve modular fluid coolers and chillers configured for optimal power and water use based on environmental conditions and client requirements. The fluid coolers include wet media, a first fluid circuit for distributing fluid across wet media, an air to fluid heat exchanger, and an air to refrigerant heat exchanger. The chillers, which are fluidly coupled to the fluid coolers via pipe cages, include a second fluid circuit in fluid communication with the air to fluid heat exchanger and a refrigerant circuit in thermal communication with the second fluid circuit and in fluid communication with the air to refrigerant heat exchanger. Pipe cages are coupled together to allow for expansion of the cooling system when additional cooling capacity is needed. The fluid coolers and chillers are configured to selectively operate in wet or dry free cooling mode, partial free cooling mode, or mechanical cooling mode.
US11867425B2
Disclosed is an air conditioner including a main body, a panel assembly configured to cover a front surface of the main body and coupled to the main body, and a cam assembly including a cam and disposed below the panel assembly, wherein the cam includes a cam contact surface formed along a rotation direction of the cam, the cam contact surface includes a first contact portion and a second contact portion formed to be in contact with the panel assembly at different heights, and the panel assembly is configured to be detachable from the main body by moving up and down with the rotation of the cam.
US11867422B1
A method for distributing a set of air purification devices in a target space comprising: accessing a void volume representing the target space; accessing a set of observed parameter data streams recorded by a set of air sensors with the target space during an observation period, the set of observed parameter data streams comprising a set of pollutant concentration data streams of a pollutant, a set of air speed data streams, and a set of air direction data streams; simulating a distribution of the pollutant in the void volume reproducing the set of observed parameter data streams based on the set of observed parameter data streams; accessing a set of device characteristics for a set of air purification devices to be deployed within the target space; and calculating a set of device positions in the void volume based on the distribution of the pollutant and the set of device characteristics.
US11867420B2
A method in a heating, ventilation, or air conditioning (HVAC) system includes retrieving a control input from a remote computing system via a cellular network responsive to determining that a connection to a local wireless network cannot be established and generating a control signal for HVAC equipment based on the control input or generating a control signal for HVAC equipment by executing a backup control algorithm responsive to determining that a connection to a local wireless network cannot be established.
US11867416B2
A heating, ventilation, and/or air conditioning (HVAC) system with a vibration sensor coupled to a component of the HVAC system includes a data analyzer with a processor configured to receive an input from the vibration sensor coupled to the component of the HVAC system. The processor is configured to determine a remaining useful life (RUL) indication for the component of the HVAC system based on applying an analytical model using the input from the vibration sensor and to output the RUL indication.
US11867411B2
A method of cooking a food item in a cooking appliance having a cooking chamber and a user interface with a selector that allows a user to set a target degree of browning includes imaging, by an imaging device for capturing a real-time image, the food item inside the cooking chamber. A computing device in communication with the imaging device, and having a software module that receives the captured image, receives the captured real-time image from the imaging device.
US11867410B2
An electric heater includes a substrate; a first plane heating element disposed on a surface of the substrate; and a second plane heating element disposed on the surface of the substrate so as to be located outside the first plane heating element. The first plane heating element includes a first pattern portion having a start point and an end point, and a pair of first electrode portions connected to the first pattern portion. The second plane heating element includes a second pattern portion that surrounds a portion of an outer circumference of the first pattern portion, has a start point and an end point, and has an opening portion at one side thereof; and a pair of second electrode portions connected to the second pattern portion.
US11867400B1
A combustor for a gas turbine engine includes a liner surrounding a fuel and air mixing body. A gaseous fuel supply passage delivers gaseous fuel into the mixing body. A wall of the mixing body has air openings to communicate air into mixing passages. At least one fuel opening in each of the mixing passages allows fuel to flow into the mixing passages and mix with the air. There are passage sections downstream of a location of the fuel openings, such that the mixed air and fuel travel downstream of the location and into a combustion chamber. The passage sections have baffles that create a tortuous path. A gas turbine engine is also disclosed.
US11867385B2
A COB LED lighting lamp cooled by a liquid agent, in particular water, used for year-round illumination of the LED light of this lamp in a greenhouse of plants and includes a load-bearing and lighting component, having a cooling plate with three threaded mounting openings arranged transversely, the inner surface of which with channels for the cooling liquid flowing through it is permanently and tightly connected with a cover equipped with neodymium magnets magnetically connected to contacting neodymium magnets of holders fixing COB LED modules equipped with COB LED diodes and lenses, and a cooling subassembly situated above it, including a cooling fan and a water radiator placed thereon and detachably connected thereto. Both components being connected to each other by two connecting pipe sets, such that the upper connector of the pipe set is screwed into the threaded opening of the water chamber of this water radiator.
US11867379B2
A lighting apparatus includes: a lamp body assembly, including a support base, a lampshade mounted on the support base, and a light-emitting body, a power supply module and a first connector that are connected to the support base, wherein the light-emitting body is electrically connected to the power supply module; a display assembly, including a carrier, a second connector connected to the carrier and facing the support base, and a display screen connected to the carrier, wherein the display screen is electrically connected to the power supply module; and a support assembly, connected to the first connector and the second connector.
US11867376B1
The invention relates to a warning lamp structure, includes a lamp holder, having a receiving slot disposed therein, a circuit board accommodated in the receiving slot, and a lamp cover made of silicone material correspondingly covering an opening of the receiving slot of the lamp holder, wherein the circuit board has a plurality of light-emitting elements arranged thereon. Therefore, the use of silicone materials is to maintain the accuracy of the light projection of the light-emitting elements, and when the vehicle accidentally collides with other vehicles or a wall of a building while driving, and the lamp cover is impacted by the collision, since the lamp cover is made of silicone rubber and other elastomers, and has the characteristics of UV resistance and crack resistance, the lamp cover can therefore be prevented from being broken and damaged.
US11867373B2
Lighting devices, methods of manufacturing a lighting device, automotive lighting systems including the lighting device are described. A lighting device includes at least one light guide with an elongated recess. Multiple light-emitting elements are embedded into the recess of the light guide, arranged on a flexfoil that is bendable in three different connections, and connected to one another to mimic a filament. At least one encapsulating material encapsulates, at least in part, the at least one light guide. The at least one encapsulating material includes at least one opening and at least one reference element for aligning the at least one light guide in relation to the encapsulating material so that the multiple light-emitting elements emit light exiting the opening. The at least one encapsulating aterial is flexible so that the lighting device is bendable in three different directions.
US11867372B2
A vehicle light guide body includes an incident surface that light from the light source enters, a first reflective surface that internally reflects the light that has entered from the incident surface to form nearly parallel light, a second reflective surface that internally reflects the light from the first reflective surface, a third reflective surface provided in a position located in front of the second reflective surface in a front-rear direction and in a portion in at least one of end faces in a left-right direction, a light shielding part that shields a part of the light reflected by the second reflective surface, and a light emitting surface that emits the light that has been internally reflected by the second reflective surface and has passed through the light shielding part to illuminate a headlight pattern in front of a vehicle.
US11867367B2
Disclosed herein is a solar light kit, comprising: a housing comprising a removably attached solar panel and a removably attached battery; a PCB comprising one or more light sources, the PCB configured to connect to the solar panel and the battery; a lens for diffusing light from the one or more light sources of the PCB, wherein the lens is configured to connect to the housing and the PCB; a plurality of removable fasteners for connecting the lens to one or more of the PCB and housing; and a tool for fastening the plurality of removable fasteners, wherein the housing, the PCB, the lens, the plurality of removable fasteners, and the tool are bundled together unassembled in a kit package.
US11867347B2
The present invention discloses a laser module lifting apparatus with a protecting function. The apparatus comprises a slide block for being fixedly connected with a laser module. The slide block is provided with a sliding groove, and the sliding groove is provided with a lifting slide rail in a liftable manner. A locking block is arranged between the lifting slide rail and an inner side wall of the sliding groove, and a side of the locking block away from the lifting slide rail is provided with a locking screw. By arranging the locking block at a locking end of the locking screw, a conventional way of jacking the lifting slide rail directly by using the locking screw is converted into a way of jacking the lifting slide rail by the locking block.
US11867343B2
The invention relates to a pipe having a thermoplastic casing surface and a glass-fibre-reinforced thermo-setting coating surrounding the thermoplastic casing surface. The thermo-setting coating is formed from multiple layers of glass-fibre matting or glass-fibre fabric, or a combination of the two, wherein the layers are applied to the thermoplastic casing surface in a wet-on-wet method using a vinylester, polyester or epoxy resin. According to the invention, an outer layer of the thermo-setting coating is formed from cross-wound glass-fibre fleece or glass-fibre fabric.
US11867341B2
Disclosed is the treatment of the interior walls of a fluidic channel with a self-assembled monolayer of an organophosphorus acid.
US11867335B1
A flexible tap tee fitting for attaching a plastic drain pipe to a corrugated plastic drain pipe main of single-wall or double-wall construction. The tap tee fitting has a plurality of elongated tabs, some long and some short, with a circumferential ridge on the ends. The ridge biases the tabs inwardly as the tap tee fitting is pushed through a hole in the main and locks on the inside of main. The long elongated tabs engage the wall of a single-wall main and the short elongated tabs engage the wall of a double-wall main.
US11867329B2
A fluid connection device comprising a body formed of one single part and comprising a first tubular nozzle comprising a male part, and at least two elastically-deformable tabs provided to retain the male part in a female part, wherein the device further comprises a lock mounted on the body and mobile in translation from a first position wherein the tabs are released, allowing their elastic deformation, to a second position wherein the tabs are blocked, preventing their elastic deformation.
US11867328B2
A plug-in connection system for fluid-conducting components of fire extinguishing systems that has a first component having an outer peripheral surface and a first recess in the peripheral surface, and a second component having an inner peripheral surface and a second recess in the inner peripheral surface, wherein the first and the second component can be plugged into one another such that the recesses lie opposite one another and define a locking element channel. A locking element which can be inserted into the locking element channel until an interlock position is reached and at least part of which engages in both recesses in the interlock position. A locking element safety device is provided for reversibly releasably securing the locking element on the first and/or second component.
US11867321B1
The present configuration relates to the use of a hanging bracket which may be assembled on a construction job site in order to allow such materials to be dispensed along with the use of typical onsite construction vehicles such as backhoes, bucket loaders, etc. This configuration allows for effective attachment to various bucket sizes, and also may be folded into a compact configuration when stored or transported.
US11867320B2
In a polymeric microfluidic valve, an adhesion control surface with discrete micro- or nano-scale structured surfaces are separated by fluid filled voids at an interface between an elastomeric membrane seals against a substrate layer. The structured surfaces reduce adhesion between the membrane layer and the substrate layer and prevent permanent bonding, while at the same time providing a good balance of adhesion at the valve seat to provide a sealing engagement. Microstructured adhesion control surfaces on and around valve bodies permit opening the valve, by reducing contact surface area.
US11867313B2
An adjustment device for a water delivery unit includes a valve body extending along a longitudinal axis with a water inlet and outlet, a shutter arrangement to control water flow from the inlet to the outlet, a first actuating member movable along the longitudinal axis to arrange shutter arrangement into opening and closing positions to respectively enable/disable the passage of water and a second actuating member rotatable about the longitudinal axis to vary the opening position of the shutter arrangement to adjust a flow rate of the water exiting the valve body. The device has a manual control member coupling with the first and second actuating members and configured to receive a manual action by a user for opening, closing and adjusting the flow rate of the water. The second actuating member cooperates with the shutter arrangement through a cam arrangement for varying the opening position of the shutter arrangement.
US11867312B2
In a capacity control valve, a position of a valve element is changed by drawing a movable iron core to a fixed iron core with magnetic force by energization of an electromagnetic coil. The iron core on one side includes a projected portion on the radially outer side, the iron core on the other side includes a projected portion on the radially inner side, and these projected portions are capable of being loosely fitted to each other when the movable iron core is drawn to the fixed iron core. The projected portion is formed to be smaller than an opposing surface of the iron core facing an effective magnetic force surface of a distal end of the projected portion and formed in a tapered shape.
US11867307B1
Disclosed is a slit valve gate. The slit valve gate includes a base portion configured to couple to a slit valve actuator. The slit valve gate further includes a seal portion coupled to the base portion. The seal portion is configured to create an airtight seal between the slit valve gate and a sealing surface of a slit valve opening. The slit valve gate further includes a clamp portion coupled to the base portion. The clamp portion retains the seal portion at least partially between the clamp portion and the base portion.
US11867304B2
Valve seats include a flexible arm portion configured to seal against a portion of a valve body of a valve. A ball valve may include such valve seats. Methods of forming a seal in a ball valve include forcing a first metal valve seat into sealing contact with a first end cap and a ball valve member with a first metal flexible arm member and forcing a second metal valve seat into sealing contact with a second end cap and the ball valve member with a second metal flexible arm member.
US11867300B2
A water conservation faucet seamlessly integrating a tactile feedback mechanism into existing faucets to spur user controlled pre-set water flow rate, energy conservation, and cost savings. During movement of the handle, the user receives tactile feedback through the handle indicating the position of the handle as it moves from one pre-set position to the next. In addition to tactile feedback, the handle provides visual feedback to the user as the handle remains in the fixed position until the user chooses to move handle to another position.
US11867298B2
Saturation of a secondary system pressure circuit (18) of a hydraulic system (4) of a motor vehicle transmission is earlier, in that an excess amount of oil from a primary system pressure circuit (16) of the hydraulic system (4) is not directed to a suction charging (40), but rather into the secondary system pressure circuit (18). This can take place via a system pressure valve (9) for the primary system pressure circuit (16), which is configured for this function.
US11867296B2
A valve assembly (1) comprising: a common housing having a first side (8a), a second side (8b), an inlet port (2) and an outlet port (3); the valve assembly (1) comprising a first pair of valve members or poppets (4a, 4c) and a second pair of valve members or poppets (4b, 4d), a first pair of valve seats (5a, 5c) for cooperation with the first pair of valve members or poppets (4a, 4c), and a second pair of valve seats (5b, 5d) for cooperation with the second pair of valve members or poppets (4b, 4d); a central flow diverter (13c) disposed in between the first pair of valve members or poppets (4a, 4c) and the second pair of valve seats (5b, 5d), the central flow diverter (13c) defining a first side (11a) of the valve assembly (1) and a second side (11b) of the valve assembly (1).
US11867294B2
An object of the present invention is to provide a sliding member coated with a DLC coating in which microfractures on the sliding surface thereof due to the progression of cracks are less likely to occur, and in which an increase in abrasive wear can be reduced. The present invention achieves the above-mentioned object by a sliding member having a DLC coating on the outer peripheral surface thereof, wherein an S band derived from sp3 bonding is observed in the DLC coating in addition to a G band derived from the graphite structure and a D band derived from the defects of the graphite structure, and these bands satisfy specific relationships.
US11867286B1
A vehicle includes a heat exchanger, a transmission, and a controller. The transmission is configured to transfer power within a powertrain. The transmission has a primary fluid circuit, a secondary fluid circuit, and a valve. The secondary fluid circuit is configured to divert the fluid from the primary fluid circuit and deliver the fluid to the heat exchanger. The valve is configured to control diverting fluid from the primary fluid circuit to the secondary fluid circuit. The controller is programmed to, in response to a temperature of the fluid being outside of a desired range, open the valve to direct the fluid toward the heat exchanger via the secondary fluid circuit. The controller is further programmed to, in response to the temperature of the fluid being within the desired range, close the valve to isolate the fluid from the secondary fluid circuit and the heat exchanger.
US11867282B1
The invention relates to a planetary gear box, which has a sun gear, a plurality of planet gears, a ring gear, a plurality of plain bearing pins and an axially front carrier plate and an axially rear carrier plate. The plain bearing pin and the planet gear here configure a lubricated plain bearing which includes a plain bearing gap. Furthermore, the plain bearing pin, on the contact face thereof, configures a feed pocket which is provided and configured to receive oil and during the operation deliver oil in the circumferential direction to the plain bearing by way of a delivery edge. It is provided that the feed pocket is configured in the contact face of the plain bearing pin in such a manner that the delivery edge has a profile that deviates from a straight profile parallel to the longitudinal axis of the plain bearing pin.
US11867278B1
A planetary gear device includes: a housing cover disposed at one end portion of a housing in an axis direction, the housing being configured to house a sun gear and a planetary gear inside the housing; and a carrier cover disposed next to the housing cover in the axial direction in the inside, and configured to support a shaft of the planetary gear from one end portion side in the axial direction. Of a pair of opposing parts opposite to each other in the housing cover and the carrier cover, one opposing part includes an opening that opens in the axis direction, and the other opposing part includes a slide cylindrical part protruding toward inside of the opening in a coaxial manner with an axis of the opening, the slide cylindrical part including an outer peripheral surface that slides on an inner peripheral surface of the opening.
US11867273B2
A helical sector gear having a body and a gear segment having a plurality of helical teeth. The gear segment has a toothed sector, on which all of the helical teeth are formed, and spacing segments on the opposite circumferential ends of the toothed sector. Each of the spacing segments has a circumferential surface, which is longer than a pitch of the helical teeth, and a radial surface that is formed in a helical manner that conforms to the helix angle of helical teeth. A die set for forming the helical sector gear and a related method are also provided.
US11867261B2
The invention provides a transmission mechanism for an electric drill and the electric drill including the transmission mechanism. The transmission mechanism includes a primary planet carrier, a gear assembly, a secondary planet carrier, and a secondary gear assembly. The gear assembly comprises a primary gear ring and a primary gear set located in the primary gear ring. The primary gear set has two primary planetary gear sets mounted on the primary planetary gear shaft. The secondary planet carrier is provided with secondary planetary gear shafts and an output shaft. The secondary gear assembly includes a secondary gear ring and a secondary planetary gear set. The secondary planetary gear set is pivotably mounted on the secondary planetary gear shafts, an outer side of the secondary planetary gear set engages with the secondary gear ring, and an inner side of thereof engages with the sun gear.
US11867247B2
Wave springs having multiple variable turns, methods of pre-loading components with said wave springs, and methods of manufacturing said wave springs are provided. The wave spring has a total height defined by a first end portion and a second opposite end portion and an intermediate portion disposed between the first and second end portions. The intermediate portion has active turns with waved or non-planar turns and non-active turns with planar or non-waved turns. The wave spring also has a first alignment disposed between the first and second end portions, wherein first alignment comprises at least two waved or non-planar turns being aligned with each other.
US11867245B2
Provided is an electric parking brake device in which an actuator case of an electric actuator is mounted to a backplate of a drum brake which includes a parking brake lever, with which electric actuator it is possible to obtain a parking brake state by pulling a brake cable linked with the parking brake lever. The backplate is formed with a through-hole for passing the brake cable and has a connecting tube portion integrally protruding therefrom and enclosing the through-hole. A mounting tube includes, on one end in an axial direction, a joint portion which is formed separately from the backplate and joined to the connecting tube portion. The actuator case is mounted to the mounting tube at certain axial and circumferential positions with respect to the mounting tube. This allows increased freedom of the mounting attitude of the electric actuator with respect to the backplate without increased cost.
US11867233B2
Support assembly for movable, rotating or sliding shafts, having a bearing unit adapted to receive the movable shaft, a casing and a cover for fluid sealing an opening of an internal seat of the casing; the bearing unit having a radially outer ring, a radially inner ring and a row of rolling elements between the radially outer ring and the radially inner ring; the support assembly also being provided with: a rear sealing device, placed on the opposite side with respect to the cover, and comprising a metal shield and a vulcanized rubber liner equipped with a first, axially outer, sealing lip and with a second, axially inner, sealing lip the support assembly being characterized in that the rear sealing device comprises a further third sealing lip slidingly contacting the radially inner ring.
US11867224B2
A power tool is provided with a telescopic pole including a first pole configured to telescopingly move in an out of a second pole. A locking mechanism is provided including a first section configured to connect to the second pole and a second section configured to connect to the first pole. The first section includes a sheath mountable on and surrounding at least part of the second pole, a resilient tab connected to the sheath, and a catch formed on the tab. The catch is configured to locate within the recess of the second pole when the sheath is mounted on the second pole.
US11867217B2
A thermally stabilized fastener system and method is disclosed. The disclosed system/method integrates a fastener (FAS) incorporating a faster retention head (FRH), fastener retention body (FRB), and fastener retention tip (FRT) to couple a mechanical member stack (MMS) in a thermally stabilized fashion using a fastener retention receiver (FRR). The MMS includes a temperature compensating member (TCM), a first retention member (FRM), and an optional second retention member (SRM). The TCM is constructed using a tailored thermal expansion coefficient (TTC) that permits the TCM to compensate for the thermal expansion characteristics of the FAS, FRM, and SRM such that the force applied by the FRH and FRR portions of the FAS to the MMS is tailored to a specific temperature force profile (TFP) over changes in MMS/FAS temperature. The TCM may be selected with a TTC to achieve a uniform TFP over changes in MMS/FAS temperature.
US11867216B2
The present invention provides compliant screws compatible with standard threaded holes that are self-anchoring via auxetic properties. Once a screw has been twisted in place using a mating screw driver, the screw won't be able to be removed unless it is broken, its surrounding material is torn out with the screw, or unless the screw driver itself is again used to twist the screw in the opposite direction. Thus, although reusable, the screw will never come out of its hole in the presence of vibrations or other cyclic or random loading scenarios. The screws are thereby suitable for critical joint applications where screws must never come loose. Non-limiting examples include satellite fasteners, high-speed vehicle bolts, pedicle screws, and other screws used to secure medical implants within a human body.
US11867210B2
Provided is an expansion-type anchor with excellent pull-out strength. The anchor comprises an anchor body 1 that has an expansion section 3 split by an inner slit 2, and a sleeve 9 to enclose and hold the expansion section 3 of the anchor body 1. The sleeve 9 is split into a plurality of follower expansion sections by an outer main slit 10 and an outer auxiliary slit 11. A group of balls 4 is disposed inside the anchor body 1, and the expansion section 3 expands into a tapered shape when the group of balls 4 is pressed by an expansion bolt 6. When a pull-out force is applied to the anchor body 1, the sleeve 9 does not retract and deforms by expanding after the retraction of the anchor body 1. As a result, the anchor body 1 is prevented from retracting by way of the sleeve 9 being sandwiched between a prepared hole 13 and the expansion section 3.
US11867206B2
A method of removing hydraulic fluid from an aircraft hydraulic system is disclosed including a hydraulically actuated mechanism that is actuated by an electrohydraulic servo valve, a hydraulic fluid port through which hydraulic fluid can escape, and a hydraulic fuse with a closed state and an open state between the electrohydraulic servo valve and the hydraulic fluid port. The hydraulic fluid port is opened, and then the activation of the electrohydraulic servo valve is controlled to force hydraulic fluid to escape from the hydraulic system via the hydraulic fluid port, the control being so that the hydraulic fuse does not enter and remain in the closed state.
US11867204B2
A piezoelectric ring bender servo valve assembly reduces mechanical wear by removing mechanical components used in prior art servo valves. The assembly does not use torque motor, flapper, and feedback spring. In this manner, no moving parts are required, which reduces maintenance and costs. A pair of piezoelectric ring benders mount adjacently to a pair of nozzles. The piezoelectric ring benders independently regulate the flow of fluid through the nozzles by moving between an open position to enable flowage, and a closed position to restrict flowage. A linear position sensing device measures and provides feedback about the spool position to a valve controller. The valve controller allows the spool valve to move until valve position achieves command position and the force on the spool valve is in equilibrium with pressure difference across spool valve. An H-bridge operable to switch the polarity of a differential pressure applied across to a load.
US11867199B2
A compressor system includes a compressor, and an electric motor driving a shaft to drive the compressor. An inlet is connected to a source of air to be compressed. The inlet is connected to the compressor. A fan impeller is mounted in the inlet upstream of the compressor. A cooling air exit communicates with the inlet, and upstream of the compressor. The cooling air exit is connected to the motor to provide cooling air to the motor. A dual compressor system is also disclosed.
US11867197B2
A fan motor includes: a motor including a stator and a rotor, a motor housing accommodating the motor, a bearing case disposed at a lower portion of the motor housing, an impeller coupled to a rotary shaft of the motor, a vane structure disposed at a lower side of the impeller and configured to guide air, and a lead cable connector provided in the bearing case. The stator of the motor includes a core and a coil that is wound on the core, and the lead cable connector is connected to a lead cable of the coil of the stator.
US11867188B2
A fan includes a fan frame and a driving device. The fan frame includes a base, a frame shell and static blades arranged on the periphery of the base. The driving device includes a stator structure and a rotor structure. The stator structure includes a stator magnetic pole group and a bushing. The rotor structure includes a bearing, a shaft, a rotor shell, a magnetic structure and blades. The shaft is connected with the rotor shell and disposed through the bearing. The stator magnetic pole group magnetically drives the magnetic structure to rotate the rotor shell. The blades are arranged on the periphery of the rotor shell. Two ends of the frame shell are configured with two turning portions, respectively. The two turning portions are disposed between parts of the frame shell with different curvatures.
US11867182B2
A scroll compressor includes: a rotary shaft; a compression mechanism including an orbiting scroll and a non-orbiting scroll, an extension portion of the orbiting scroll engaging with an eccentric structure of the rotary shaft via a bushing and a driving bearing having an axial height L1; and a counterweight located on the bushing, a mass center of the counterweight being located above an axial lower end of the driving bearing and having an axial distance L2 to the axial center of the driving bearing, and the ratio R of the axial distance L2 to the axial height L1 satisfying: 0.1≤R≤0.4. The scroll compressor can reduce the contact and wear between the bushing and the driving bearing and reduce the requirements for the manufacturing precision and the mounting precision of components such as the counterweight and the bushing, achieving optimized system design.
US11867179B2
The fluid transfer apparatus includes a rotor housing for forming a fluid compression space having the shape of an epitrochoid surface; a rotor eccentrically rotates inside the fluid compression space by being eccentrically coupled to a rotation shaft; and a rotor housing cover covering the fluid compression space of the rotor housing and including a rotation shaft penetration hole formed at the center of the cover, and a first cover fluid channel and second cover fluid channel are symmetrically formed on the opposite sides of each other with the rotation shaft penetration hole in the middle, wherein a plurality of rotor housing covers are arranged to be spaced apart from each other, one rotor housing is arranged between every two rotor housing covers, one rotor is arranged in the fluid compression space of each rotor housing, and each rotor is arranged to face a different direction from a neighboring rotor.
US11867176B1
An apparatus for a submersible screw pump includes a cylindrical rotor located inside of a cylindrical stator. The rotor has a screw thread formed in an opposite direction in relation to screw threads of the stator. The external surface of the rotor has a curvilinear shape and the internal surface of the stator has semicircular shapes without rectangular edges. These surface features of the rotor and stator obtain high speed performance for the apparatus with reduced vortices. A gap between the internal surface of the stator and the external surface of the rotor is 0.1-0.2 millimeters. A unloading thrust bearing is attached to a rotor shaft positioned between an intake thrust bearing and the intake end of the rotor. A cavity in the unloading thrust bearing is configured to receive production fluid from the discharge end of the rotor.
US11867167B2
A piezoelectric pump includes a first top plate, a second top plate, a diaphragm, a first side wall, and a second side wall. The diaphragm has a vibrating part to which a piezoelectric element is attached, a frame part, and a connecting part. The connecting part has formed therein a third opening which lets a first pump chamber and a second pump chamber communicate. The frame part has formed therein a fourth opening which communicates with the third opening and also communicates with outside. The piezoelectric pump further includes: in the first pump chamber, an annular first valve provided as spaced from a first opening in a planar view so as to surround the first opening; and in the second pump chamber, an annular second valve provided as spaced from a second opening in the planar view so as to surround the second opening.
US11867161B2
The oil quality in an oil reservoir of a pump is monitored using the disclosed oil-monitoring sensor. The oil-monitoring sensor includes a first capacitive portion for measuring oil level and a second capacitive portion for measuring dielectric constant of the oil. Changes in dielectric constant of the oil are indicative of degradation of the quality of the oil (e.g., due to contaminants, oxidation, etc.) So oil-monitoring sensor is used to indicate various parameters about the oil quality to an operator. Using the disclosed sensors, the quality of the lubricant and/or cooling oil used by the pump may be monitored without needing to be present at the pump, or without needing to access the interior of the pump (or oil reservoir).
US11867150B2
A method for operating a wind turbine determines reliability of an azimuth measurement system by measuring loads with load sensors during operation of the wind turbine. Based on the measured loads, in-plane moments generated on the blades at a rotational speed frequency of the rotor are determined. The azimuth measurement system has reduced reliability if the angular phase of the in-plane moments at the rotor rotational speed frequency of the rotor deviates from an angular phase measured by the azimuth measurement system by more than a first threshold value. The method generates a warning signal or changes operation of the wind turbine when it is determined that the azimuth measurement system has reduced reliability.
US11867133B2
A HST system for use in traveling of a vehicle includes a controller that controls a pump regulator that changes a displacement of a pump and a motor regulator that changes a displacement of a motor. The controller determines whether or not a particular downhill travel condition is satisfied based on a result of detection by a vehicle speed detector that detects a vehicle speed of the vehicle and a result of detection by a rotation number detector that detects a number of rotations of an engine per unit time. In a case where a depression amount of an accelerator pedal, which is detected by a depression amount detector, is zero and the particular downhill travel condition is satisfied, the controller controls the motor regulator to increase the displacement of the motor.
US11867130B2
An airflow arrangement for a gas turbine engine in which air can be selectively directed to and from a bypass channel of the engine and into a duct communicating air into a compressor of a gas turbine engine.
US11867129B2
In an asymmetric operating regime, a first engine is operating in an active mode to provide motive power to an aircraft while a second engine is operating in a standby mode and de-clutched from a gearbox of the aircraft. In response to an emergency exit request, the second engine's speed is increased, at a maximum permissible rate, to a re-clutching speed while increasing the first engine's power output at a maximum permissible rate. When the re-clutching speed is reached, the second engine's power output is increased at a maximum permissible rate. In response to a normal exit request, the second engine's speed is increased to the re-clutching speed at a rate lower than the maximum permissible rate. When the re-clutching speed is reached, the second engine's power output is increased at a rate lower than the maximum permissible rate.
US11867127B2
The invention concerns a planetary gear box with a flow guidance device for a planet gear lubricant stream in the planetary gear box, which is directed at least partially along a planet gear after an engagement with a sun gear, characterized by a collecting region of the flow guidance device in which the planet gear lubricant stream between the planet gear and the flow guidance device can be at least partially captured, and wherein the collecting region has an outlet region between the flow guidance device and the tooth face of the planet gear for at least a part of the planet gear lubricant stream, and an edge is arranged at the outlet region for defined constriction of the passage for the planet gear lubricant stream.
US11867121B2
A gas turbine engine includes a fan located at a forward portion of the gas turbine engine, a compressor section and a turbine section arranged in serial flow order. The compressor section and the turbine section together define a core airflow path. A rotary member is rotatable with at least a portion of the compressor section and with at least a portion of the turbine section. An outlet guide vane assembly includes multiple outlet guide vanes located in an exhaust airflow path downstream of the turbine section. The multiple outlet guide vanes being spaced-apart circumferentially from each other over an angular range of about 360 degrees, and each multiple outlet guide vane defining a radial extent. At least one of the multiple outlet guide vanes includes a cold fluid passageway extending at least partially radially therethrough through which a fluid coolant flows and another of the multiple guide vanes includes a heated fluid passageway extending at least partially radially therethrough through which the fluid coolant flows and receives heat from exhaust airflow from the core airflow path.
US11867117B2
Use of an additive selected from nitrate compounds, peroxide compounds, nitrite compounds and polyether compounds, and mixtures thereof in a diesel fuel composition for reducing the build-up of deposits in an Exhaust Gas Recirculation (EGR) system of a compression ignition internal combustion engine.
US11867115B2
A turbocharger actuator arrangement for a turbocharger includes a movable actuator operating lever, a control rod, and a wave spring. More specifically, the control rod is couplable to a setting element of the turbocharger and is connected to the actuator operating lever by means of a bolt such that the control rod is arranged to be rotatable relative to the actuator operating lever. The bolt extends from the actuator operating lever through an opening in an end region of the control rod and through the wave spring. As such, the control rod and the wave spring are arranged between the actuator operating lever and a bolt securing means, which is arranged at an end region of the bolt that is averted from the actuator operating lever.
US11867114B2
The stud-oriented valve (50) includes a valve main body (8) which is housed in a lamination duct (7) and which exhibits a closure axial face (10) which can rest on a duct closure seat (11) for isolating a lamination cavity (4) from a combustion chamber (5), said body (8) also having a centering peripheral surface (12), an opening axial face (13) which may rest on a chamber-side valve stop (14), and at least one orientation stud (15) which protrudes from the opening axial face (13), said stud (15) being capable to slide through a guide axial orifice (17) that is fixed to the lamination duct (7).
US11867113B2
A generator set configured to provide an electrical output to an external electrical load. The generator set includes an engine configured to drive an electric generator, the engine including an engine block, where the electric generator is configured to couple to the external electrical load. The generator set includes a heating system in fluid communication with the engine block, the heating system including an electric fluid heater, where the electric jacket fluid includes a resistive load configured to supplement the external electrical load. The generator set includes a control system for: monitoring a first parameter of the engine; generating a first control signal in response to the first parameter being less than a first threshold; and increasing the external electrical load by turning on the electric fluid heater in response to the first control signal.
US11867106B2
An aftertreatment system for reducing constituents of an exhaust gas having a sulfur content includes: an oxidation catalyst; a filter disposed downstream of the oxidation catalyst; and a controller configured to, in response to determining that the filter is to be regenerated and a desulfation condition being satisfied: cause a temperature of the oxidation catalyst to increase to a first regeneration temperature that is greater than or equal to 400 degrees Celsius and less than 550 degrees Celsius, cause the temperature of the oxidation catalyst to be maintained at the first regeneration temperature for a first time period, and after the first time period, cause the temperature of the oxidation catalyst to increase to a second regeneration temperature equal to or greater than 550 degrees Celsius.
US11867100B2
A system for removing fluids, such as engine oil, from internal combustion powered vehicles is disclosed. The system includes a pump, an extraction line that connected between the pump and the oil pan drain (or other similar fluid receptacle drain) of the vehicle, a controller, a fluid storage container and a discharge line that is connected between the pump and the storage container. The fluid extracted is automatically transferred to a pressurized intermediate storage container and subsequently transferred to a non-pressurized final storage container.
US11867095B2
An energy storage system converts variable renewable electricity (VRE) to continuous heat at over 1000° C. Intermittent electrical energy heats a solid medium. Heat from the solid medium is delivered continuously on demand. An array of bricks incorporating internal radiation cavities is directly heated by thermal radiation. The cavities facilitate rapid, uniform heating via reradiation. Heat delivery via flowing gas establishes a thermocline which maintains high outlet temperature throughout discharge. Gas flows through structured pathways within the array, delivering heat which may be used for processes including calcination, hydrogen electrolysis, steam generation, and thermal power generation and cogeneration. Groups of thermal storage arrays may be controlled and operated at high temperatures without thermal runaway via deep-discharge sequencing. Forecast-based control enables continuous, year-round heat supply using current and advance information of weather and VRE availability. High-voltage DC power conversion and distribution circuitry improves the efficiency of VRE power transfer into the system.
US11867094B2
An energy storage system converts variable renewable electricity (VRE) to continuous heat at over 1000° C. Intermittent electrical energy heats a solid medium. Heat from the solid medium is delivered continuously on demand. An array of bricks incorporating internal radiation cavities is directly heated by thermal radiation. The cavities facilitate rapid, uniform heating via reradiation. Heat delivery via flowing gas establishes a thermocline which maintains high outlet temperature throughout discharge. Gas flows through structured pathways within the array, delivering heat which may be used for processes including calcination, hydrogen electrolysis, steam generation, and thermal power generation and cogeneration. Groups of thermal storage arrays may be controlled and operated at high temperatures without thermal runaway via deep-discharge sequencing. Forecast-based control enables continuous, year-round heat supply using current and advance information of weather and VRE availability. High-voltage DC power conversion and distribution circuitry improves the efficiency of VRE power transfer into the system.
US11867092B2
A system includes a combustion power plant for generating power and an electrolysis unit for producing hydrogen. The combustion power plant has a combustion chamber for combustion of a fuel and an offgas conduit for leading off hot offgases formed in the combustion of the fuel. The offgas conduit is thermally coupled to the electrolysis unit. A method for operating the system includes burning the fuel in the combustion power plant, forming the hot offgases in the combustion of the fuel, removing the hot offgases through the offgas conduit, feeding the thermal energy of the hot offgases from the offgas conduit to the electrolysis unit, and producing hydrogen in the electrolysis unit by using the thermal energy from the hot offgases.
US11867088B2
A turbine blade includes: a platform; an airfoil portion extending from the platform in a blade height direction and having a pressure surface and a suction surface extending between a leading edge and a trailing edge; a blade root portion disposed on opposite side of the airfoil portion across the platform in the blade height direction and having a bearing surface; and a shank disposed between the platform and the blade root portion. The shank has: a first lateral surface having a first recess portion and disposed on a pressure surface side and along an extension direction of the blade root portion; and a second lateral surface having a second recess portion and disposed on a suction surface side and along the extension direction of the blade root portion.
US11867086B2
A coating composition for coating of components of a flow machine, especially a turbomachine such as a gas turbine with compressor, or of a compressor, which are exposed to the fluid stream of the flow machine or of the compressor, wherein the coating composition includes anticorrosion pigments, wherein the coating composition includes hard material particles, and wherein the coating composition is an RT-curing, UV-curing and/or thermally curing coating composition. A component of a flow machine or of a compressor has the coating composition. A method of maintaining a flow machine or a compressor uses the coating composition.
US11867080B2
An integrally bladed rotor for a turbomachine, in particular a compressor or turbine stage of a gas turbine, to which at least one separately formed impulse element housing (40; 40′) is fastened by at least one fastening element (30; 30′) which engages for this purpose into an opening (41) of the impulse element housing and into an opening (11) of the rotor, the impulse element housing having at least one cavity (44) in which at least one impulse element (5) is accommodated with play.
US11867079B2
In a flange cooling structure of a gas turbine engine, one of a first flange and a second flange is a high pressure flange that faces a first region, and the other of the first flange and the second flange is a low pressure flange that faces a second region. A contact surface of the high pressure flange or a contact surface of the low pressure flange includes a cooling groove that communicates with the first region and the second region.
US11867070B1
A system is provided for an aircraft. This aircraft system includes a gas turbine engine and a sensor system. The gas turbine engine includes an inlet and a compressor section. A flowpath projects radially inward into the gas turbine engine from the inlet and extends through the compressor section. The sensor system includes a plurality of static pressure sensors at least partially within the flowpath. The sensor system is configured to determine a total pressure characteristic within the flowpath using the plurality of static pressure sensors.
US11867068B2
Certain examples disclose and describe apparatus and methods to provide fast response active clearance system with piezoelectric actuator in axial, axial/radial combined, and circumferential directions. In some examples, an apparatus includes an actuator to control clearance between a blade and at least one of a shroud or a hanger, the actuator including a multilayer stack of material, and wherein the actuator is outside a case. The apparatus further includes a rod coupled to the actuator and the at least one of the shroud or the hanger through an opening in the case, the rod to move the at least one of the shroud or the hanger in a radial direction based on axial movement of the multilayer stack of material.
US11867065B2
To increase the inertia of a sealing lip of a blade for an aircraft turbine engine, and thus improve the service life of such a sealing lip, the sealing lip is conformed so as to have a trough in the outer surface thereof and a corresponding boss in the inner surface thereof, the trough and the boss being defined based on a connection cross section of the sealing lip to a blade body, and being formed at a distance from a free axial end of the sealing lip.
US11867062B2
The present disclosure relates to a construction method for a deformable anchor cable capable of being prestressed. The anchor cable includes an outer sleeve, a shrinkage pipe, an inner sleeve, a steel strand, an anchor and a tray. When the anchor cable is in use, a hole is drilled first, then the anchor cable is mounted in the drilled hole, and finally a prestress is applied to the steel strand of the anchor cable. According to the construction method, the construction is convenient; the anchor cable has the characteristics of high strength and large deformation, and can be easily prestressed; and the large deformation is realized by squeezing the inner sleeve by means of the anchor, which completely overcomes the problem of breaking a cold-drawn rod during the large deformation process.
US11867052B1
Methods and systems for controlling a drilling operation in a subterranean formation are disclosed. The method includes generating a simulated well log based, at least in part, on a subset of an MWD log from a horizontal well, wherein the subset of the MWD log is for measured depths between a starting measured depth and an ending measured depth. The method further includes monitoring and/or controlling a drilling operation based, at least in part, on the simulated well log.
US11867049B1
An untethered downhole tool includes a first body, a second body, a logging sensor, a motor, and a controller. Each of the first and second bodies includes a housing that defines an inner volume and a magnetic anchor configured, in an active state, to attach the body to a wellbore tubular. The motor is attached to one of the first or second bodies and coupled to a spooler. The controller is communicably coupled to the motor and the first and second magnetic anchors. The controller is configured to adjust one of the first or second magnetic anchors from the active state to an inactive state; and activate the motor to operate the spooler to spool the cable from the spooler to increase a length of a portion of the cable between the spooler and the detached first or second body.
US11867044B2
A proppant container facilitates the transportation of wet sand for use in a hydraulic fracturing operation. The container is mounted in a cradle that tips downward in arcuate motion for discharge or proppant through a top opening The tipping mechanism may be driven by a system of gears or a hydraulic ram.
US11867036B2
A method for recovering hydrocarbons from a hydrocarbon bearing formation includes introducing a first solution having a first salt into the hydrocarbon bearing formation. A second solution is also introduced into the hydrocarbon bearing formation, wherein the second solution has a second salt and a foaming agent. The first salt and the second salt produces a nitrogen gas, and the nitrogen gas and the foaming agent produces a foam formed in-situ within the formation. The foam forms a foam barrier, and carbon dioxide is introduced into the formation to form a gas cap, wherein the carbon dioxide gas cap has a gas front that is separated from the hydrocarbons by the foam barrier.
US11867030B2
Provided is a downhole tool. The downhole tool, in one aspect, includes an isolation system for placement at a junction between a first wellbore and a secondary wellbore. In at least one aspect, the isolation system includes an elongated tubular, the elongated tubular having an opening connecting an interior of the elongated tubular and an exterior of the elongated tubular; and a slot located in the elongated tubular, the slot spanning the opening. In at least one aspect, the isolation system further includes an isolation sleeve located within the isolation system, the isolation sleeve configured to slide within the slot to either isolate the interior of the elongated tubular from the exterior of the elongated tubular or provide access between the interior of the elongated tubular and the exterior of the elongated tubular, and an I-shaped seal located in an annulus between the elongated tubular and the isolation sleeve.
US11867021B2
A cementing pod is disclosed. The cementing pod includes a cylindrical housing with a first end and a second end, and a throughbore disposed through the cylindrical housing in a first axial direction from the first end to the second end. The cementing pod further includes a plurality of openings disposed through the cylindrical housing into the throughbore in a second axial direction, and a solid fill disposed at the second end of the cylindrical housing.
US11867017B2
An embodiment includes a greaseless multi-level pressure control assembly.
US11867015B2
A friction reduction system includes a housing including a central axis and a central passage, a valve disposed in the housing and including a first valve body and a second valve body wherein the first valve body is permitted to rotate relative to the second valve body, and a mandrel coupled to the second valve body and permitted to travel axially relative to the housing, wherein a first net pressure force is applied against the mandrel that corresponds to a drilling fluid pressure of a drilling fluid in response to flowing the drilling fluid through the valve and transitioning the valve from a closed configuration to an open configuration, and wherein a second net pressure force is applied against the mandrel that corresponds to a wellbore fluid pressure in response to flowing the drilling fluid through the valve and transitioning the valve from the open configuration to the closed configuration.
US11867013B2
A casing removal system includes a flow diversion valve. The flow diversion valve includes a flow switch that engages an upper end of an inner casing. When the flow switch engages the upper end of the inner casing, the flow diversion valve opens and at least a portion of the fluid flow through the casing removal system exhausts to the annulus. The remaining fluid flow below the flow diversion valve is insufficient to operate a mud motor that drives a casing cutter. In other embodiments, when the flow switch is not engaged with the inner wall of casing, the flow diversion valve prevents fluid flow to components that are downhole of the valve and when the flow switch is engaged with the inner wall of casing, the flow diversion valve allows for fluid flow to components that are downhole of the valve.
US11867011B2
A downhole apparatus for collecting solids fallback in the tubing of an oil producing borehole comprises two or more baskets to collect the solids fall back, each basket partially occupying a portion of the inner cross section of the tubing, leaving a portion of the inner cross section of the tubing having an unrestricted flow path. The baskets when considered in plan view along longitudinal axis of the tubing are distributed such that together they cover substantially the whole area of the tubing while leaving an unobstructed non-straight flowpath around the baskets.
US11866998B2
In some embodiments, a system including a tool drill string having a downhole device is disclosed. The downhole device includes a memory storing instructions and a downhole processor configured to execute the instructions to operate in a first transmission mode by default. The downhole processor is communicatively coupled to an uphole processor via the first transmission mode. The downhole processor is further to transmit, via a second transmission mode, a message to the uphole processor, determine whether a response is received, via the second transmission mode, from the uphole processor, and responsive to determining the response is received from the uphole processor, switch from the first transmission mode to the second transmission mode.
US11866989B2
A novel and useful frame less supplemental window for fenestration suitable for use with existing windows. The supplemental window, in one embodiment, comprises plastic sheet material with bullnose edging around it. Corner braces add rigidity and strength to corners in several embodiments. An attachment mechanism secured either to the sheet material or the bullnose edge functions to fasten and/or seal the supplemental window to an existing window. The bullnose edging functions to substantially enclose (i.e. trap) a volume of air between the window pane and the plastic sheet material. The supplemental window is configured such that the layer of trapped air is of an optimum thickness within a preferred range of 0.15 to 0.75 inches to maximize thermal insulation properties of the supplemental window.
US11866986B2
A damper, in particular for fittings for furniture or household appliances, has a housing in which a piston connected to a piston rod is guided in a linearly displaceable manner in an interior space. At least one flow channel is formed on or in the piston, through which the flow passes when the piston is displaced. A volume-compensation element is provided in the housing, which compensates for a volume which is displaced or released when a part of the piston rod is pushed into or pulled out of the housing, being displaceably mounted in the housing.
US11866976B2
A gate hinge pin and strap assembly for attachment to a wooden post for supporting a gate including a J-bolt or threaded L-bolt with a metal strap affixed to the bolt between the threads and cylindrical neck portion. A bendable metal strap extends on each side of the J-bolt or threaded L-bolt. The L-shaped rod is threaded into the post until the metal strap contacts the post. Then each bolt of the metal bracket is bent around the post and screws or lag bolts are threaded through the holes and into the post to help secure the hinge to the post and to provide added support for the gate.
US11866970B2
A fabric treatment machine has a cabinet housing. A lid enables access inside the cabinet. Fabric treatment components such as a drum are positioned inside the cabinet housing. A panel on the cabinet housing includes an opening to receive the lid. At least one hinge spacer couples with the panel to receive a shaft of a slow close hinge on the lid. The at least one hinge spacer includes a socket portion and a flange portion. The socket portion inserts into an aperture in the panel. The socket portion includes a bore with at least one flat side to receive a mating shaft from the slow closing hinge. The hinge shaft has at least one flat surface. The flange portion covers the panel around the socket.
US11866969B2
An integrated hinge for connecting an article of a furniture assembly to one or more articles or a main body of the furniture assembly comprising a multi-rod rigid structure and a flexible membrane. The multi-rod rigid structure comprises two or more rods arranged in a default shape, wherein each of the rods functions as a hinge arm, and wherein the rods are lateral-rotatable or pivot-able about an intersecting or meeting point of the rods. The flexible membrane has a three-dimensional contour configured to wrap around the multi-rod rigid structure tightly, fixing the multi-rod rigid structure in its default shape. The flexible membrane can be configured to wrap around the integrated hinge and articles of furniture assembly forming a single integrated furniture piece. The elasticity in the flexible membrane turns the integrated hinge into a spring hinge.
US11866966B2
Described is a device for constraining the opening of doors or windows comprising a guide body associated with a perimeter profile of a movable leaf and equipped with a slot; an operating arm articulated, at a first end, to a fixed frame, and a second end slidably connectable, by a pin, inside the slot of the guide body so as to allow a sliding stroke of the pin along the guide slot to define an open configuration with a limited angle of the leaf; the guide body is provided with two lateral openings facing each other made on the walls defining the slot to allow a free passage, through one of the openings, of the pin of the arm housed in the slot when the leaf is in a free open configuration; a locking lever or latch articulated to a base of the guide body and configured for locking the pin of the arm when it is positioned at an end of the slot of the guide body in the open configuration with a limited angle of the leaf; an operating rod slidably inserted along the body and having a pair of protruding walls configured to temporarily close, in use, the openings of the slot at least at the passage from the closed configuration to the open configuration at a limited angle of the leaf.
US11866965B2
An electronic handle for a vehicle door including an electronic device, an activation lever, and a bracket. The electronic device electronically activates a latch of the vehicle door. The activation lever is configured to rotate around an activation lever axis between a rest position in which the activation lever is released, and a mechanical activation position in which the activation lever is actuated for mechanically activating the latch of the vehicle door in case of default of the electronic device. The bracket receives the activation lever. The activation lever comprises a driving element pivotally connected to the activation lever, and the bracket comprises a flexible blade with a stop element.
US11866958B2
The invention relates to a locking device for doors, compartments, and flaps. The stator is equipped with a battery-operated motor and an electronic control unit which acts on the motor. A handle (20) is connected to the rotor (30) so as to transmit a torque and is held on the rotor (30) by a clamping spring (50). The clamping spring (50) has a receiving area for a magnet (60). The process of replacing the battery for the motor is easily facilitated in that the clamping connection between the handle (20) and the rotor (30) is triggered by an external influence on the magnet (60) (FIG. 1).
US11866957B2
An apparatus includes an enclosure, a central processing unit, a power source, a first distance measuring device, a first compressible member, and a first housing pin, where the central processing unit is electrically coupled to the power source and the first distance measuring device. A first end of the first compressible member is mechanically coupled to a first end of the first housing pin and a second end of the first compressible member is mechanically coupled to an inner surface of the enclosure. The first distance measuring device positioned at the second end of the first compressible member, where the first distance measuring device is configured to measure a first distance to the first end of the first housing pin. A first key pin of a key structure disposed in the enclosure, where the first key pin is configured to compress the first compressible member the first distance.
US11866953B2
An adjustable post support includes a post receptacle with a first longitudinal axis; a mount with a second longitudinal axis; and upper and lower adjustment plates disposed therebetween. The upper adjustment plate resides closer to the receptacle, rotates about the first longitudinal axis, and has a first surface above an opposing second surface. The first surface remains normal to the first longitudinal axis when rotated. The second surface resides at an angle to the first surface. The lower adjustment plate rotates about the second longitudinal axis and has a third surface above an opposing fourth surface. The fourth surface remains normal to the second longitudinal axis when rotated. The third surface resides at an angle to the fourth surface. The second surface is disposed against the third surface.
US11866947B1
A hand trowel and hand trowel handle for use with the same are disclosed. In one embodiment of the hand trowel handle, a handle has an ergonomic shape and the handle is provided with a discrete, selectively adjustable, rotational angle. A locking member may be tightened into a locked, abutted relationship with the handle to reversibly lock the discrete, selectively adjustable, rotational angle. The locking member may be loosened from the locked, abutted relationship with the handle to provide selective adjustment of the discrete, selectively adjustable, rotational angle.
US11866941B2
The invention relates to a construction foil (16), especially roof film, roofing foil, flat roof sheeting, fa-cade sheeting and/or vapor barrier and/or sub-roofing sheeting, especially underlayment and/or sarking sheeting, with a single- or multilayer layer structure (17). It is provided according to the invention that at least one moisture sensor (1) for detecting moisture is associated to the construction foil (16), that the moisture sensor (1) is designed as an active pick-up, and that the moisture sensor (1) comprises at least one electrode (18) and/or a humidity sensing element, and the electrode (18) and/or the humidity sensing element is in direct contact with a nonwoven layer (19).
US11866934B1
A method for insulating a pier and beam foundation on a structure, wherein the pier and beam foundation includes at least one floor joist, at least one pier, at least one beam, a side skirt, flooring, and plumbing including at least one pipe, may include applying a synthetic underlayment to the at least one floor joist and to a bottom surface of the flooring; laying a radiant insulation board end-to-end across the at least one floor joist, over the synthetic underlayment, and along the side skirt; and applying a tape to adjacent radiant insulation boards to seal joints there between. The method may also include wrapping the at least one pipe with spray foam, a foam pipe insulator, and duct tape.
US11866932B2
A fire-rated component for a fire-rated joint, such as a head-of-wall assembly, includes an elongate body having at least a first layer, which can be in the form of a polymer profile. A second layer can be or include a foil lining and a third layer can be or include an intumescent material. The elongate body, such as the first layer, defines an air gap. The foil lining and/or the intumescent material can be positioned within the air gap. A planar lower portion of the first layer of the elongate body is positioned between a header track and a wallboard in the fire-rated joint. A non-planar upper portion of the first layer of the elongate body is positioned at least partially within a deflection gap of the wall assembly and sealingly engages the ceiling.
US11866928B2
The present invention relates to a supporting, holding and clamping tool system and a method associated with the system. With respect to the system, it is a pair of devices and attachments designed to attach to a wall to support construction sheathing while securing it to the wall, which may also be used for a versatile clamping device. This system can be used by one person to facilitate installing heavy sheets of sheet rock, Siding, plywood or other materials to be installed on the vertical wall or surface.
US11866923B2
A toilet management system includes a toilet bowl device installed in a toilet room, a management device configured to manage a use situation of the toilet bowl device, and a communication device configured to transmit use situation information related to the use situation of the toilet bowl device to the management device. The management device includes an acquirer configured to acquire the use situation information from the communication device, and an abnormality detector configured to detect an abnormality of the toilet bowl device or a facility or equipment installed inside or around the toilet room when the use situation information acquired by the acquirer matches a predetermined condition.
US11866922B2
The present invention relates to a toilet flushing initiating, monitoring and management system initiated by the unlocking of a locking member on a door mounted in a stall typically found in a bathroom such as a public bathroom. Signal patterns from flushing controller and a door housing controller are recorded and analyzed to identify associated fault conditions. Notifications of the associated fault conditions are output and communicated to an authorized user, such as a facilities manager.
US11866916B2
A fluid supply monitoring system includes a fluid sensor configured to identify a flow rate of a fluid through a supply line. The system comprises a valve configured to control the flow rate through the supply line and a pressure sensor configured to detect a fluid pressure. A controller is configured to receive the flow rate data and identify fluid consumption from the supply line based on the flow rate. The controller is further configured to compare the fluid consumption of a usage event to one of a time limit and a volume limit. In response to the fluid consumption exceeding the time limit or the volume limit, the controller controls the valve to a closed position and identifies a potential fluid leak. With the valve in the closed position, the controller processes a verification procedure that identifies whether the potential fluid leak is an actual fluid leak.
US11866914B2
A retainer sleeve includes an at least partially annular body defining an axis of rotation, a radial direction, and a circumferential direction. The body may also have a radially inner annular surface defining a radially inner aperture, and a first anti-rotation feature extending radially inwardly from the radially inner annular surface including a sloping ledge having a locking surface, and an outer peripheral surface defining a notch that is at least partially aligned with the first anti-rotation feature or an array of a plurality of external ribs extending outwardly radially from the outer peripheral surface.
US11866908B2
A working machine includes a load transmitting member including: an upper pillar part; an intermediate part extending to circumvent a window from a position above a lower corner of a window edge of the window and outer than the lower corner in a wall width direction to a position below the lower corner and inner than the lower corner in the wall width direction; and a beam part extending so as to be farther away from a wall side edge under the window. The upper pillar part, the intermediate part, and the beam part are continuous in this order so that a load applied to an upper portion of a cabin is transmitted to an upper frame. At least the intermediate part of the load transmitting member is made of a single member.
US11866907B2
A superstructure for mounting upon a ground engaging structure of a working machine includes a cab structure for housing a human operator of the working machine; a chassis structure providing a base for the cab structure; and a frame including a tubular body, the tubular body comprising two legs and a cross member interposed between the legs, wherein the cross member is at a non-zero angle to both legs. The frame is connected to the cab structure proximate an upper extent of the frame and the chassis structure proximate a lower extent the frame so as to support a portion of the cab structure.
US11866905B2
A work machine includes a frame, a traction system supporting the frame, an arm assembly having a first end and a second end, the first end connected to the frame, an implement connected to the second end, and a linkage connecting the implement to the second end of the arm assembly. The linkage includes a pin-supporting section configured to accept a pin and a linking section attached to the pin-supporting section by a weld. The linking section includes a recess proximate to the weld.
US11866903B2
An electrically-driven vibratory hammer is provided, which has a power supply, is wirelessly controlled, can increase the vibration amplitude and can detect the data of the vibratory hammer in real time. Through the arrangement of storage batteries, workers can also directly work through the built-in storage batteries during construction in some remote areas, without laying additional lines, and the cost is reduced. Furthermore, a movable toothed plate previously driven by a hydraulic cylinder is changed into a clamping electric cylinder capable of directly working through the storage batteries, so that a pile body can be directly clamped without an external hydraulic pump station during working. Through the improvement, the workers can directly work without additionally laying basic equipment during construction in construction sites with incomplete facilities, the construction period is shortened, the construction cost is saved, intelligent control is achieved.
US11866899B2
A triadic recurve implosion flood navigation for in-situ tailoring yearn system—[TRINITY-D20] has a tailoring mechanism comprising a first unit having an arc-shaped first arcuate portion, and a second unit having an arc-shaped second arcuate portion, the first and second units stagger each other with concave arcuate surfaces facing opposite directions by center axes of curvature of the first and second arcuate portions parallelling each other to cause an arcuate end of the first arcuate portion locate between two arcuate ends of the second arcuate portion and separated from the concave arcuate surface of the second arcuate portion by a first distance, and to cause an arcuate end of the second arcuate portion locate between two arcuate ends of the first arcuate portion and separated from the first arcuate portion by a second distance, thereby the first and second arcuate portions jointly define a curved channel.
US11866890B2
A mobile earth working machine includes a machine frame; a working apparatus; a functional apparatus connected to the machine frame pivotably; and a pivot joint between the machine frame and the functional apparatus, having a frame-associated joint element and an apparatus-associated joint element. A mechanical coupling includes a frame-side coupling configuration and an apparatus-side counterpart coupling configuration.
US11866876B2
A method of dispensing laundry treating products using centrifugal force. The method comprises retaining by gravity laundry products in a first reservoir. Temporarily moving the laundry treating products by centrifugal force from the first reservoir to a first centrifugal chamber. Moving the products through an orifice in the first centrifugal chamber to a second centrifugal chamber by centrifugal force acting on the products to move the products through the orifice. Allowing the products to move from the second centrifugal chamber to a second reservoir with gravity.
US11866873B2
A clothing treatment apparatus includes a cabinet, and a water-containing assembly, a sprinkling mechanism and an atomization generator that are arranged in the cabinet. The water-containing assembly includes a water tank and a water diverting and blocking member arranged in the water tank, the water tank is connected to the sprinkling mechanism through a first delivery pipeline, the water tank is connected to the atomization generator through a second delivery pipeline, and the water diverting and blocking member is configured to change a sequence of the water injected into the water tank flowing to the atomization generator and flowing to the sprinkling mechanism.
US11866862B2
A knitted fabric, including: a front face and a rear face, wherein the front face includes a first plurality of fibres of at least one of a first colour, a first colour combination, a first material and a first material combination, and the rear face includes a second plurality of fibres of at least one of a second colour, a second colour combination, a second material and a second material combination, the fabric having a knit pattern wherein the first plurality of fibres are at least partially separated from the second plurality of fibres, such that the front face is visually different when compared to the rear face.
US11866855B2
In a spinning position device (10) for a ring spinning machine (1) comprising a spindle (20) for a package body (13), which spindle (20) is rotatably mounted on a spindle rail (2), and an encapsulation (50) extending in the longitudinal direction of the spindle (20) and enclosing the package body (13), the encapsulation (50) being connected to the spindle rail (2), there is provision for the encapsulation (50) to be longitudinally divided and to have a rear encapsulation wall (51) and a front encapsulation wall (52), the front encapsulation wall (51) being movable into an open position, so that in the open position the package body (13) of the spinning position device (10) is accessible for operation.
US11866848B1
A method of growing a cadmium zinc telluride (CdZnTe) crystal includes providing a crucible including a solid CdZnTe source and forming a Te-rich Cd—Zn—Te melt on the solid CdZnTe source. The method also includes positioning a CdZnTe seed crystal in physical contact with the Te-rich Cd—Zn—Te melt and growing the CdZnTe crystal from the Te-rich Cd—Zn—Te melt.
US11866847B2
Systems and methods for generating one or more single crystal monolayers from two-dimensional van der Waals crystals are disclosed herein. Example methods include providing a bulk material including a plurality of van der Waals crystal layers, and exfoliating one or more single crystal monolayers of van der Waals crystal from the bulk material by applying a flexible and flat metal tape to a surface of the bulk material. In certain embodiments, the one or more single crystal monolayers can be assembled into an artificial lattice. The present disclosure also provides techniques for manufacturing flexible and flat metal tape for generating one or more single crystal monolayers from two-dimensional van der Waals crystals. The present disclosure also provides compositions for creating a macroscopic artificial lattice. In certain embodiments, the composition can include two or more macroscopic single crystal monolayers adapted from a bulk van der Waals crystal, where the single crystal monolayers are configured for assembly into an artificial lattice based on one or more properties.
US11866843B2
The present invention relates to an electrolytic copper foil for a secondary battery, having excellent physical properties at a low temperature, and a method for producing the electrolytic copper foil. The electrolytic copper foil for a secondary battery shows little change in the physical properties, such as tensile strength and elongation, of a copper foil even at a low temperature and thereby exhibits excellent cycle properties at the low temperature. The electrolytic copper foil for a secondary battery is produced from a plating solution, containing total organic carbon (TOC), cobalt, iron and zinc, by using a drum and coated with a cathode active material, wherein the ratio between the TOC, cobalt, iron and zinc contained in the electrolytic copper foil follows the following formula 1: TOC/(cobalt+iron+zinc)=1.0-1.2. [Formula 1]
US11866838B2
A method for creating colorful patterns on a metal surface by using colorless ink is revealed. First carry out a first anodizing process on a metal substrate to form a first anodic oxide layer on a surface of the metal substrate. Then coat a layer of colorless ink on the first anodic oxide layer on the surface of the metal substrate to form a colorless ink pattern mask. Later perform a second anodizing process to form a second anodic oxide layer on a part of the metal substrate without being covered with the colorless ink pattern mask. Next remove the colorless ink pattern mask and coat a metal film over the first anodic oxide layer and the second anodic oxide layer to get a colorful pattern on the metal substrate.
US11866831B2
The present disclosure provides a new wet atomic layer etch (ALE) process for etching copper. More specifically, the present disclosure provides various embodiments of methods that utilize new etch chemistries for etching copper in a wet ALE process. By utilizing the new etch chemistries disclosed herein within a wet ALE process, the present disclosure provides a highly selective etch of copper with monolayer precision.
US11866824B2
Described are lanthanide-containing metal coordination complexes which may be used as precursors in thin film depositions, e.g., atomic layer deposition processes. More specifically, described are homoleptic lanthanide-aminoalkoxide metal coordination complexes, lanthanide-carbohydrazide metal coordination complexes, and lanthanide-diazadiene metal coordination complexes. Additionally, methods for depositing lanthanide-containing films through an atomic layer deposition process are described.
US11866822B2
There is provided a technique that includes a precursor vessel in which a liquid precursor is stored; a first heater immersed in the liquid precursor stored in the precursor vessel and configured to heat the liquid precursor; a second heater configured to heat the precursor vessel; a first temperature sensor immersed in the liquid precursor stored in the precursor vessel and configured to measure a temperature of the liquid precursor; a second temperature sensor immersed in the liquid precursor stored in the precursor vessel and configured to measure a temperature of the liquid precursor; and a controller configured to be capable of: controlling the first heater based on the temperature measured by the first temperature sensor; and controlling the second heater based on the temperature measured by the second temperature sensor.
US11866819B2
The inventive concept provides a method for treating a surface of an object to be treated, in which a part provided and contaminated in an apparatus for treatment of a substrate such as a wafer serves as the object to be treated. In an embodiment, the surface treatment method includes forming a vacuum in an atmosphere in which the object is provided and cleaning the surface of the object by collision of first particles with contaminants on the surface of the object at supersonic speed.
US11866818B2
A coating of spectacle lenses is applied by physical vapor deposition (PVD). A method for physical vapor deposition includes: providing a crucible containing a first evaporation material and a second evaporation material, wherein the first evaporation material has a first vapor pressure and the second evaporation material has a second vapor pressure different from the first vapor pressure. A ratio of an exposed surface of the first evaporation material and an exposed surface of the second evaporation material in the crucible is adapted to counterbalance the difference in vapor pressure between the first and the second evaporation material. Concurrent evaporation of the first evaporation material and the second evaporation material from the same crucible take place. The disclosure further relates to a crucible for physical vapor deposition and a physical vapor deposition system in particular for coating an optical surface such as a spectacle lens.
US11866805B2
A superalloy target wherein the superalloy target has a polycrystalline structure of random grain orientation, the average grain size in the structure is smaller than 20 μm, and the porosity in the structure is smaller than 10%. Furthermore, the invention includes a method of producing a superalloy target by powder metallurgical production, wherein the powder-metallurgical production starts from alloyed powder(s) of a superalloy and includes the step of spark plasma sintering (SPS) of the alloyed powder(s).
US11866800B2
A steel sheet includes a predetermined composition satisfying Expression (1), in which the microstructure at the ¼ thickness position from the surface in the sheet thickness direction includes, by vol %, ferrite: 95% or more and a remainder of the microstructure: 5% or less, has a proportion of unrecrystallized ferrite in the ferrite of 5% or less, and a half width w and an X-ray wavelength λ at a peak of (200) plane of the ferrite satisfy Expression (2). 0.80≤{(Ti/48−N/14)+Nb/93}/(C/12)≤5.00 (1) w×λ≥0.20 (2)
US11866796B2
Provided is a grain-oriented electrical steel sheet that combines low iron loss and low magnetostriction, together with an advantageous production method therefor. A grain-oriented electrical steel sheet comprises a linear strain portion extending in a direction intersecting a rolling direction of the grain-oriented electrical steel sheet, wherein the linear strain portion has a stress distribution in which a compressive stress region and a tensile stress region alternate in a longitudinal direction of the linear strain portion. The linear strain portion is formed by vibrating the grain-oriented electrical steel sheet in a sheet thickness direction, while irradiating a surface of the grain-oriented electrical steel sheet with an electron beam by repeatedly moving and detaining the electron beam in the direction intersecting the rolling direction of the grain-oriented electrical steel sheet.
US11866789B2
Various embodiments provide compositions and methods for detecting cancers containing an NRG1 fusion event and treating a patient with a therapeutic agent that is targeted to the NRG1 fusion. Exemplary compositions for treating cancers containing the NRG1 fusion may comprise therapeutic agents inhibiting Epidermal Growth Factor Receptor and/or ERBB2 such as cetuximab, panitumumab, Sym004, MM-151, mAb 806, mAb 528, MEHD794A, gefitinib, erlotinib, lapatinib, afatinib, PD153035, AG1478, trastuzumab, and pertuzumab. In some embodiments, the therapeutic agent may be a combination of trastuzumab, and pertuzumab.
US11866785B2
Methods are provided for identifying tumor-specific antibodies and/or T-cell receptors by paired mRNA sequencing from individual immune cells in sentinel lymph nodes and comparison of these sequences with corresponding mass spectroscopy data from a subject having a cancer. Novel tumor-specific antibodies (e.g., NY-ESO-1-binding antibodies) are also provided.
US11866781B2
Methods and compositions for digital profiling of nucleic acid sequences present in a sample are provided.
US11866780B2
The present invention relates to the field of molecular biology, and more specifically to methods for reducing the complexity of a nucleic acid sample.
US11866778B2
Methods for evaluating microsatellite instability (MSI) analyze nucleic acid sequence reads corresponding to a plurality of marker regions for MSI. The marker regions may include long homopolymers and/or short tandem repeats (STRs). For a target homopolymer, a histogram of homopolymer signal values is calculated based on flow space signal measurements for the homopolymer region in the sequence reads. A score per marker based on features of the histogram of homopolymer signal values is determined for each marker region corresponding to the target homopolymers. For a target STR, the method includes calculating a histogram of repeat lengths for sequence reads corresponding to the marker region of the target STR. A score per STR marker is calculated based on features of the histogram of repeat lengths. A plurality of per marker scores may be combined to form a total MSI score for the sample.
US11866777B2
The disclosed embodiments concern methods, apparatus, systems and computer program products for determining sequences of interest using unique molecular index (UMI) sequences that are uniquely associable with individual polynucleotide fragments, including sequences with low allele frequencies and long sequence length. In some implementations, the UMIs include both physical UMIs and virtual UMIs. In some implementations, the unique molecular index sequences include non-random sequences. System, apparatus, and computer program products are also provided for determining a sequence of interest implementing the methods disclosed.
US11866775B2
The present method of detection involves increasing an amount of analyte molecules by an isothermal molecular amplification approach. In the present approach a starting molecule of interest may be amplified through a reaction it induces with specifically engineered and functionalized particles, namely protected particles A and storage particles B. This reaction may result in a set of output DNA molecules that is larger in number than the input DNA molecules. Thus the reaction between nanoparticles for amplification of a certain DNA sequence (input DNA molecules) may occur when there is a match with a targeted molecule (stored molecules on storage particles B) and if the DNA sequence of the input DNA molecules does not match (partially or completely) the targeted molecule the reaction may not occur. Without a certain molecular input of the input DNA molecule the reaction may not occur.
US11866761B2
The present invention relates to a process for producing esters comprising reaction of methyl biodiesel or free fatty acids with a polyhydroxylated alcohol, in the presence of a biocatalyst, which is a fermented solid containing lipases of Rhizomucor miehei produced by culturing the microorganism on agricultural waste by solid state fermentation.
US11866758B2
Disclosed herein are compositions and methods for preparing tagatose from fructose, more particularly, compositions comprising thermophilic fructose C4-epimerases derived from thermophilic microorganisms and methods for preparing tagatose from fructose using the compositions.
US11866753B2
The invention relates, in general, to methods of processing Lignocellulosic biomass to fermentable sugars and to methods that rely on hydrothermal pretreatment. Xylose monomer yields comparable to those achieved using two-stage pretreatments can be achieved from soft Lignocellulosic biomass feedstocks by pretreasting to very low severity in a single-stage pressurized hydrothermal pretreatment, followed by enzymatic hydrolysis to release xylose retained in the solid state. In some embodiments, pretreated biomass is separated into a solid fraction and a liquid fraction, the solid fraction subjected to enzymatic hydrolysis, and the separated liquid fraction subsequently mixed with the hydrolysed solid fraction.
US11866747B2
Disclosed herein are recombinant meganucleases engineered to recognize and cleave a recognition sequence present in the human mitochondrial DNA (mtDNA). The disclosure further relates to the use of such recombinant meganucleases in methods for producing genetically-modified eukaryotic cells, and to a population of genetically-modified eukaryotic cells wherein the mtDNA has been having modified or edited.
US11866746B2
The present invention relates to variant Cas12i4 polypeptides, methods of producing the variant Cas12i4 polypeptides, processes for characterizing the variant Cas12i4 polypeptides, cells comprising the variant Cas12i4 polypeptides, and methods of using the variant Cas12i4 polypeptides. The invention further relates to complexes comprising a variant Cas12i4 polypeptide and an RNA guide, methods of producing the complexes, processes for characterizing the complexes, cells comprising the complexes, and methods of using the complexes.
US11866743B1
Pharmaceutical formulations that can include at least one genetically modified OPH enzyme are provided. Methods for treating chemical warfare agent exposure are also provided. Modified biomolecules are also provided.
US11866742B2
Provided herein are fusion proteins that comprise an enzyme replacement therapy enzyme and an Fc region, as well as methods of using such proteins to treat a lysosomal storage disorder. Methods for transporting agents across the blood-brain barrier are also provided herein.
US11866738B2
Provided herein are compositions and methods for improved production of steviol glycosides in a host cell. In some embodiments, the host cell is genetically modified to comprise a heterologous nucleotide sequence encoding a Setaria italica UDP-glycosyltransferase 40087 or its variant UDP-glycosyltransferase. In some embodiments, the host cell is genetically modified to comprise a heterologous nucleotide sequence encoding a UDP-glycosyltransferase sr.UGT_9252778, Bd_UGT10850, and/or Ob_UGT91B1 like. In some embodiments, the host cell further comprises one or more heterologous nucleotide sequence encoding further enzymes of a pathway capable of producing steviol glycosides in the host cell. The compositions and methods described herein provide an efficient route for the heterologous production of steviol glycosides, including but not limited to, rebaudioside D and rebaudioside M.
US11866733B2
Methods are disclosed herein for efficiently generating human induced pluripotent stem cells (iPSC) containing a nucleic acid including a doxycycline promoter operably linked to a nucleic acid encoding Cas9. These methods include transfecting a human somatic cell with a nucleic acid molecule comprising a doxycycline promoter operably linked to a nucleic acid encoding a Cas9, and constitutive promoter operably linked to a tetracycline responsive element and inducing the somatic cell to form an iPSC, thereby producing an iPSC that can undergo CRISPR/Cas9-mediated recombination at a high efficiency. The human iPSC, or a cell differentiated therefrom, is cultured in the presence of doxycycline to induce expression of the Cas9. These cells can then be used to target in any gene of interest by introducing nucleic acids encoding sgRNAs. Induced pluripotent stem cells produced by these methods are also disclosed.
US11866732B2
Methods provided by the present disclosure utilize extracorporeal shockwaves, mechanical impacts and/or principles of lithotripsy to break up a tissue sample into smaller fragments—clusters of cells and/or single cells—after which a desired cellular fraction can be isolated from the sample. Devices provided by the present disclosure deploy focused and/or directed shockwaves, and/or focused and directed mechanical impacts, to break apart a tissue sample. The devices maintain the sample in a sterile, closed environment during exposure to the shockwaves or mechanical impacts. Therefore, the shockwaves and/or mechanical impacts are generated outside of a closed device and are transmitted through one or more walls of the device into its interior, where the sample is located.
US11866731B2
Provided are modified immune cells including tumor infiltrating lymphocyte (TIL) or B cells, a composition comprising the immune cells, and a method of treating neoplastic or cancer conditions comprising administering to a subject the immune cells.
US11866728B2
Disclosed are engineered retrons and methods of use such as to modify the genome of a host (e.g., mammalian) cell by delivering the engineered retron or the encoded ncRNA in vitro or in vivo to the host (e.g., mammalian) cell.
US11866720B2
The present invention refers to a method for controlling undesired vegetation at a plant cultivation site, the method comprising the steps of providing, at said site, a plant that comprises at least one nucleic acid comprising a nucleotide sequence encoding a wild-type or a mutated protoporphyrinogen oxidase (PPO) which is resistant or tolerant to a PPO-inhibiting herbicide by applying to said site an effective amount of said herbicide. The invention further refers to plants comprising wild-type or mutated PPO enzymes, and methods of obtaining such plants.
US11866717B2
Genetically modified plants and methods of detecting diseases by a relevant color change in the genetically modified plant compared to a non-genetically modified plant are provided. Also disclosed is a system for remote detection of pathogens on crops and a methods for treating crops under a pathogenic attack.
US11866710B2
The present invention relates to RNAi agents, e.g., double stranded RNA (dsRNA) agents, targeting the Transmembrane protease, serine 6 (TMPRSS6) gene. The invention also relates to methods of using such RNAi agents to inhibit expression of a TMPRSS6 gene and to methods of preventing and treating a TMPRSS6-associated disorder, e.g., a disorder associated with iron overload and/or a disorder of ineffective erythropoiesis, e.g., hereditary hemochromatosis, β-thalassemia (e.g., β-thalassemia major and β-thalassemia intermedia), polycythemia vera, myelodysplastic syndrome, congenital dyserythropoietic anemias, pyruvate kinase deficiency, erythropoietic porphyria, Parkinson's Disease, Alzheimer's Disease or Friedreich's Ataxia.
US11866709B2
The invention relates to double-stranded ribonucleic acid (dsRNA) compositions targeting the ANGPTL3 gene, as well as methods of inhibiting expression of ANGPTL3 and methods of treating subjects having a disorder of lipid metabolism, such as hyperlipidemia or hypertriglyceridemia, using such dsRNA compositions.
US11866680B2
System for maturation of wine comprises a tank and one or more wooden barrels and flow connectors to allow circulation of maturing wine between the tank and the one or more barrels. The barrels may comprise a wooden exterior and an internal volume and a plurality of internal wooden surfaces extending inwardly of the wooden exterior into the internal volume to increase wood surface area. The barrel may be a traditional oak barrel.
US11866676B2
A cleaning agent composition for use in removal of a polysiloxane adhesive remaining on a substrate, the composition containing a tetrahydrocarbylammonium fluoride and an organic solvent, wherein the organic solvent contains an alkylene glycol dialkyl ether and a lactam compound represented by formula (1). (in formula (1), R101 represents a C1 to C6 alkyl group, and R102 represents a C1 to C6 alkylene group.)
US11866672B1
Provided is a lubricating oil composition including a lubricating oil additive and a lubricating oil, the lubricating oil additive having nanodiamonds, of which a surface is hydrophobically modified by a surface treatment, dispersed in a base oil. The lubricating oil composition retains dispersibility over a long period of time and thus can ensure storage stability. Machines to which the lubricating oil composition is applied may have improved abrasion resistance as well as improved fuel consumption and reduced noise, and high thermal conductivity of the lubricating oil composition may also increase cooling efficiency and the service life of machines.
US11866668B2
A method, system, and apparatus for managing variable, multi-phase fluid conversion to output fuel and energy for providing customizable management for processing a volume of natural gas including a volume of methane and a volume of other alkanes that may be cleaned of the other alkanes using a conversion system to create synthesis gas and other fuel products to be used in onsite or combined heat and power or cogeneration applications. In particular, the method, system, and apparatus provide for automated feedback and control directing various gas constituents to different application units with allocations according to settings system parameters to quickly and efficiently meet the demand for various products while making adjustments in real-time.
US11866667B2
An energy efficient process for NGL recovery and production of compressed natural gas (CNG) in which natural gas is fed to a first gas separation membrane-based separation stage where it is separated into a permeate and a retentate. The high C3+ concentration first stage permeate is chilled and separated to provide liquid phase NGL and a gaseous phase. The first stage retentate is separated at a second gas membrane-based separation stage to produce a retentate meeting pipeline specifications for CNG (including hydrocarbon dewpoint) and a permeate that is recycled to the first stage. The gaseous phase, constituting a low BTU fuel, may be used in on-site power generation equipment and/or in internal combustion engines. The second stage permeate (and optionally the third stage retentate) is (are) recycled back to the first stage to enhance the production of NGL and CNG. The gaseous phase may instead be fed to a third stage to produce a third permeate and a third residue, in which case the third permeate is recycled to the first stage and the third retentate is a low BTU fuel which may be used in on-site power generation equipment and/or in internal combustion engines.
US11866663B1
Embodiments of the present disclosure are directed to a method of processing a hydrocarbon feed includes fractionating the hydrocarbon feed into a light stream and a heavy stream, hydrotreating the heavy stream to form a hydrotreated heavy stream, combining the light stream and the hydrotreated heavy stream to form a upgraded feed stream, and feeding the upgraded feed stream to a single Fluid Catalytic Cracking (FCC) reaction zone, thereby producing a product stream comprising light olefins. The light stream may comprise hydrocarbons boiling at less than 540° C. and the heavy stream may comprise hydrocarbons boiling at greater than 540° C. The FCC reaction zone may be operated in a down-flow configuration and the FCC may be operated under high severity conditions.
US11866657B1
A method of processing a hydrocarbon feedstock may comprise hydrotreating the hydrocarbon feedstock in a low-severity hydrotreater to produce a first effluent and hydrotreating the first effluent, or a portion thereof, in a high-severity hydrotreater to produce a low contaminant product. The low-severity hydrotreater may operate at a catalyst volume of less than 60% of a catalyst volume of the high-severity hydrotreater. The low-severity hydrotreater may operate at a hydrogen partial pressure of at least 5 bar lower than the hydrogen partial pressure in the high-severity hydrotreater. The low-severity hydrotreater may operate at a weighted average bed temperature (WABT) of at least 5° C. less than the WABT of the high-severity hydrotreater.
US11866653B1
A process for upgrading crude oil may include combining crude oil and feed water in a supercritical water unit to produce a first upgraded output, separating the first upgraded output in a first gas-water-oil separator to produce a first gas effluent, a first water effluent, and a first oil effluent, separating the first water effluent in a first water treatment unit to produce a rejected water stream and a recycle water stream, combining the first oil effluent and the rejected water stream in a nearcritical water unit to produce a second upgraded output, and recycling at least a portion of the recycle water stream for introduction into the supercritical water unit. A system for upgrading crude oil may include a supercritical water unit, a first gas-water-oil separator disposed downstream of the supercritical water unit, a first water treatment unit disposed downstream of the first gas-water-oil separator, and a nearcritical water unit.
US11866651B1
A process for converting crude oil may comprise contacting a crude oil with one or more hydroprocessing catalysts to produce a hydroprocessed effluent and contacting the hydroprocessed effluent with a fluidized catalytic cracking (FCC) catalyst composition in an FCC system to produce cracked effluent comprising at least olefins. The crude oil may have an API gravity from 30 to 35. The FCC system may operate at a temperature of greater than or equal to 580° C., a weight ratio of the FCC catalyst composition to the crude oil of from 2:1 to 10:1, and a residence time of from 0.1 seconds to 60 seconds. The FCC catalyst composition may comprise ultrastable Y-type zeolite (USY zeolite) impregnated with lanthanum; ZSM-5 zeolite impregnated with phosphorous; an alumina binder; colloidal silica; and a matrix material comprising Kaolin clay.
US11866645B1
This disclosure relates to methods of hydraulic fracturing that may include passing a fracturing fluid through a wellbore into a subterranean formation, wherein the fracturing fluid comprises a flowback enhancer composition in an amount of from 0.10 gallon per 1000 gallons of fluid (gpt) to 10 gpt based on the total volume of fracturing fluid, hydraulically fracturing the subterranean formation with the fracturing fluid, at least partially separating the fracturing fluid from the hydrocarbons to yield a recovered fracturing fluid. The flowback enhancer composition can include a solvent mixture comprising an aqueous solution, at least one unsaturated ester, and at least one alcohol; a surfactant mixture comprising at least one secondary alcohol ethoxylate and at least one castor oil ethoxylate; and one or more particles having a widest length of from 1 nanometer to 200 nanometers.
US11866638B2
A drilling fluid composition comprising a continuous phase and a disperse phase, the continuous phase comprising fatty acid methyl esters derived from soy oil, and sunflower lecithin as an emulsifier. A method for increasing the electrical stability of a drilling fluid composition.
US11866634B2
A fluoropropene composition comprising E-1,3,3,3-tetrafluoropropene, 1,1,3,3,3-pentafluoropropene, and 2,3,3,3-tetrafluoropropene, wherein the total amount of 1,1,3,3,3-pentafluoropropene and 2,3,3,3-tetrafluoropropene is 1.0 wt. % or less, based on the total weight of the fluoropropene composition. A method of producing the fluoropropene, composition and methods for using the fluoropropene composition are also disclosed.
US11866631B2
Described are compounds, compositions, and methods that include a nitrogen- and oxygen-containing aromatic compound, such as an aminophenol-based compound, which can be used for inhibiting polymerization of a monomer (e.g., styrene) composition. The compound includes a tertiary amine group wherein the nitrogen is attached to carbon-containing groups, and at least one of oxygen atom separated from the nitrogen by one or more carbon atoms. The antipolymerant can provide excellent antipolymerant activity in a monomer-containing composition.
US11866625B2
A curable composition, a cured layer manufactured utilizing the same, and a display device including the cured layer are provided. The curable composition includes (A) a quantum dot; and (B) a polymerizable compound, wherein the polymerizable compound is a compound represented by Chemical Formula 1. In Chemical Formula 1, each substituent is the same as defined in the specification.
US11866624B2
A non-solvent curable composition including a quantum dot and a polymerizable monomer having a carbon-carbon double bond at the terminal end and having a vapor pressure of about 1×10−5 mmHg to about 1×10−4 mmHg, a cured layer manufactured utilizing the non-solvent curable composition, a color filter including the cured layer, a display device including the color filter, and a method of manufacturing the cured layer are disclosed.
US11866622B2
The present invention provides a flame-retardant pressure-sensitive adhesive, comprising reaction products of the following reaction compositions based a total weight of the reaction compositions as 100 wt. %: 35-99 wt. % of a (meth)acrylate copolymer containing a functional reactive functional group, the functional reactive functional group comprising one or a plurality of the following groups: carboxyl group, hydroxyl group and epoxy group; the (meth)acrylate copolymer containing the functional reactive functional group being formed by free radical polymerization of one or a plurality of monomers; and 1-65 wt. % of a reactive organophosphorus flame retardant capable of reacting with the functional reactive functional group, the reactive organophosphorus flame retardant being formed by reaction of reaction components comprising the following substances: a compound or oligomer containing n epoxy groups, wherein n>=2, and 9,10-dihydro-9-oxa-10-phosphaphenanthrene-10-oxide. The flame-retardant pressure-sensitive adhesive meets the halogen-free flame retardant requirements of the UL94V0 standard, and possesses high peel strength and high-temperature static shear strength.
US11866620B2
A hotmelt composition comprises at least three co-polymers defined by their chemistry and molecular weight. The hotmelt composition may be without tackifiers. The hotmelt can be used in absorbent articles such as diapers comprising two substrates at least partially attached by the hotmelt composition. The hotmelt provides especially good nonwoven-nonwoven bond and nonwoven-film bond.
US11866616B2
Provided a wave-absorbing impregnation glue liquid, including: two-component epoxy resin, a solvent, a polyether siloxane, and a carbon powder; wherein a mass ratio of the two-component epoxy resin to the solvent is 1:3˜1:5, a mass ratio of the two-component epoxy resin to the carbon powder is 3:1˜6:1, and a mass fraction of the polyether siloxane in the wave-absorbing impregnation glue liquid is 0.05%˜0.2%. A wave-absorbing impregnation glue liquid, a wave-absorbing honeycomb and their preparation methods are further provided.
US11866614B2
A structural adhesive bond formed with a pressure-sensitive adhesive that comprises at least two components forming one phase each, from which an interpenetrating network with at least two phases is produced by a cross-linking build-up reaction, the first phase and second phase having at least a softening point temperature of less than 23° C. and greater than 23° C., respectively, the two phases having a morphology of a cross-linked nanoparticle network after the build-up reaction.
US11866611B2
The purpose of the present invention is to provide a plasma spray material which is capable of forming a hydroxyapatite film that exhibits high adhesion strength with respect to substrates such as metal substrates. When used as a plasma spray material, hydroxyapatite powder having a modal diameter of 550-1000 nm in a pore diameter of at most 5000 nm as measured by a mercury intrusion method is capable of forming a hydroxyapatite film that exhibits high adhesion strength with respect to substrates such as metal substrates.
US11866591B2
The present disclosure relates to support structures for three dimensional (3D) printing, methods of preparing the support structures, and methods of using the support structures. In particular, the support structures comprise a hydrogel comprised of a cellulose derivative. Preferably, the support structures are biodegradable and easily removed without generating toxic waste.
US11866588B2
The present invention is directed, in certain embodiments, to polymerizable near-IR dyes and polymers comprising said dyes as monomeric residues. In other embodiments, the present invention also relates to methods for the preparation of polymerizable near-IR dyes, and to the use of polymerizable near-IR dyes in the preparation of fluorescent polymers.
US11866580B2
One aspect of the present application relates to a polyphenylene ether resin composition including a modified polyphenylene ether compound (A) that is terminally modified with a substituent having a carbon-carbon unsaturated double bond, and a crosslinking-type curing agent (B) having two or more carbon-carbon unsaturated double bonds in each molecule, the modified polyphenylene ether compound (A) including a modified polyphenylene ether compound (A-1) having a specific structure, and a modified polyphenylene ether compound (A-2) having a specific structure.
US11866577B2
A thermosetting composition comprising a crosslinkable component such as a vinyl ester and/or an unsaturated polyester, and an initiator component, such as cumene hydroperoxide or BPO or blends of cumene hydroperoxide and methyl ethyl ketone peroxide. The composition is suitable to be used in additive manufacturing to form objects such as molds or prototypes.
US11866560B2
The present invention relates to a microfluidic flow process for making monomers, monomers made by such processes, and methods of using such monomers. In such process, microfluidic reaction technology is used to synthesize cyanation reaction products orders of magnitude faster than is possible in batch and continuous syntheses. The aforementioned process does require strictly regulated, highly toxic cyanogen chloride. Thus the aforementioned process is more economically efficient and reduces the environmental impact of thermosetting resin monomer production, and produces thermosetting resin monomers in greater purity than obtained through typical processes.
US11866553B2
[Problem] To provide a polysiloxanecapable of forming a cured film of a thick film with high heat resistance, a composition comprising the polysiloxane, and a method of manufacturing a cured film using the composition. [Means for Solution] To provide a polysiloxane comprising a repeating unit represented by the following formula (Ib), wherein R2 is each independently hydrogen, alkyl, aryl, alkenyl, and the like, a composition comprising the polysiloxane, and a method of manufacturing a cured film using the composition.
US11866552B2
A method for producing polyamide particles may include: mixing a mixture comprising a polyamide, a carrier fluid that is immiscible with the polyamide, and nanoparticles at a temperature greater than a melting point or softening temperature of the polyamide and at a shear rate sufficiently high to disperse the polyamide in the carrier fluid; cooling the mixture to below the melting point or softening temperature of the polyamide to form solidified particles comprising polyamide particles having a circularity of 0.90 or greater and that comprise the polyamide and the nanoparticles associated with an outer surface of the polyamide particles; and separating the solidified particles from the carrier fluid.
US11866545B1
Antimicrobial bi-metallic polymeric composites are provided. The bi-metallic polymeric composites include a first metal, a second metal, and a polymeric material and demonstrate especially rapid clearance of a wide variety of bacterial species. Thus, the bi-metallic polymeric composites may be useful in forming or surface treating materials where anti-bacterial properties are desired, including but not limited to surfaces requiring regular sanitization, such as high-contact surfaces in public facilities, medical facilities, or for use in the home. The first metal and the second metal may be any metals affording an electromotive force and may be selected to provide a particular electromotive force.
US11866531B2
Lens materials and ophthalmic devices including lens materials that are oxygen permeable and resistant to oil absorption are described. In an embodiment, the lens material includes a copolymer composed of repeating units including: a fluorinated acrylate repeating unit; and a silicon-containing repeating unit, wherein a mass:mass ratio of the fluorinated acrylate repeating unit to the silicon-containing repeating unit is greater than or equal to 2:1.
US11866525B2
The present invention relates to a method of preparing an aqueous composition by emulsion polymerization of at least one ethylenically unsaturated monomer in the presence of at least one water-soluble diaminostilbene disulphonic optical brightener, as well as to the aqueous composition obtainable by said method, the use of said aqueous composition for optically brightening of a cellulosic substrate and the cellulosic substrate treated with the aqueous composition.
US11866519B2
Disclosed is a process for solubilising cellulose and coagulating the resulting solution to form a cellulose-containing material. The process comprises contacting a cellulose source with a solvent comprising zinc ions and formic acid to provide a solution, coagulating the solution to provide a solid material, treating the solid material, and isolating the solid material after treatment, to provide the cellulose-containing material. The process can further comprise solubilising protein and coagulating the resulting solution to form a cellulose/protein-containing material. The cellulose-containing materials and cellulose/protein-containing materials can be produced, for example, as reconstituted fibres and films.
US11866513B2
Antibodies and antigen-binding fragments thereof that bind type II transmembrane serine protease 6 (TMPRSS6) on the surface of a cell and increase hepcidin expression, and methods for treating disorders of iron metabolism using anti TMPRSS6 antibodies and fragments, are provided.
US11866511B2
The invention relates to anti-ganglioside GD2 antibodies that comprise an antibody variable domain and antibody constant domains, wherein the variable domain comprises a heavy and light chain variable region comprising respectively at least the CDR3 of the heavy chain variable region of antibody ch14.18 and at least the CDR3 of the light chain variable region of antibody ch14.18; and an IgA hinge and CH2 domain and to methods of treatment of subjects with a GD2 positive tumor, preferably neuroblastoma with these antibodies.
US11866500B2
Disclosed is the use of a combination of an anti-PD-1 antibody and a VEGFR inhibitor in the preparation of a drug for treating cancers.
US11866498B2
The present invention provides bispecific antigen-binding molecules having a monovalent arm specific to a first target antigen (e.g., a T cell antigen, such as CD3) and a bivalent arm specific for a second target antigen (e.g., a tumor antigen, such as HER2). Bispecific antigen-binding molecules are useful in the treatment of disorders, such as cancer (e.g., HER2-positive cancer). The invention also features methods of producing bispecific antigen-binding molecules, methods of treating disorders using bispecific antigen-binding molecules, and compositions including bispecific antigen-binding molecules.
US11866493B2
A single-chain variable fragment (ScFv) derived from anti-c-Met monoclonal antibody MetMAb that specifically binds to c-Met receptor is provided. Also provided are chimeric antigen receptor (CAR) vectors including the ScFv, human T cells transduced with the disclosed CAR vectors, pharmaceutical compositions including the CAR T cells, ScFv fusion proteins, and methods of treating a c-Met-positive cancer or a cancer characterized by overexpression of c-Met in a subject in need thereof by administering an effective amount of the disclosed CAR T cells.
US11866491B2
Disclosed is an antibody capable of binding to the interleukin 4 (IL-4) receptor (IL-4). Also disclosed are a nucleic acid sequence encoding the antibody, a vector including the nucleic acid sequence, and a host cell transformed or transfected with the vector. Provided are a method for producing the antibody, a medical use of the antibody, and a kit including the antibody.
US11866487B2
The present invention encompasses filamin A (FLNA) binding proteins. Specifically, the invention relates to antibodies to FLNA. An antibody of the invention can be a full-length antibody or an antigen-binding portion thereof. Methods of making and methods of using the antibodies of the invention in methods of diagnosis, monitoring and prognosis of prostate cancer are also provided.
US11866483B2
[Problem] To provide a composition and a cell sheet which are highly effective for inhibiting fibrosis, or cells having fibrosis-inhibiting activity, which are useful in regenerative medicine. [Solution] A medium containing IC-2 or a related compound is inoculated with mesenchymal stem cells or bone marrow mononuclear cells, and the cells are cultured for a prescribed period of time while the IC-2 or related compound is maintained at a constant concentration, thereby allowing a composition and a cell sheet which are highly effective for inhibiting fibrosis, or cultured cells having fibrosis-inhibiting activity, to be obtained.
US11866480B2
This invention relates to vectors for delivery of human leukocyte antigen G to the eye and/or to cornea explants and methods of using the same for treatment and/or prevention of corneal transplant rejection and other disorders associated with an immune response and/or vascularization.
US11866475B2
The disclosure relates to modified RNA molecules encoding VEGF-A polypeptides and formulations comprising the modified RNA. Aspects of the disclosure further relate to preparations and uses of formulations comprising the modified RNA in treating subjects suffering from diseases responsive to VEGF-A therapy.
US11866471B2
The present invention relates to the provision of a recombinant AIM that maintains functions, does not multimerize, and is not inactivated by IgM (e.g., a protein containing an amino acid sequence wherein cysteine at amino acid number 168 of the amino acid sequence shown in SEQ ID NO: 1 is substituted with another amino acid, and the like).
US11866461B1
Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.
US11866459B2
The present invention relates to a cocrystal of progesterone, which is formed by the active ingredient progesterone and a cocrystal former which is selected from isophthalic acid, 4-formylbenzeneboronic acid and 3-nitrophthalic acid. The present invention also relates to the method for preparing the cocrystal of progesterone and use thereof for increasing the thickness of endometrium, improving progesterone's solubility or increasing progesterone's permeation rate.
US11866453B2
Described are precursor compounds and methods for atomic layer deposition of films containing scandium(III) oxide or scandium(III) sulfide. Such films may be utilized as dielectric layers in semiconductor manufacturing processes, particular for depositing dielectric films and the use of such films in various electronic devices.
US11866451B2
This application relates to solid forms and salt forms of the PD-1/PD-L1 inhibitor 4,4′-(((((2,2′-dichloro-[1,1′-biphenyl]-3,3′-diyl)bis(azanediyl))bis(carbonyl))bis(1-methyl-1,4,6,7-tetrahydro-5H-imidazo[4,5-c]pyridine-2,5-diyl))bis(ethane-2,1-diyl))bis(bicyclo[2.2.1]heptane-1-carboxylic acid), including processes of preparation thereof, where the solid forms and salt forms are useful in the treatment of various diseases including infectious diseases and cancer.
US11866430B2
Disclosed are compounds of Formula (I): or a salt thereof, wherein: R1, R2, R3, and R4 are defined herein. Also disclosed are methods of using such compounds to inhibit the activity of one or both of diacylglycerol kinase alpha (DGK α) and diacylglycerol kinase zeta (DGKζ), and pharmaceutical compositions comprising such compounds. These compounds are useful in the treatment of viral infections and proliferative disorders, such as cancer.
US11866420B2
The present invention relates to novel hydrochloride salt forms of N-(2′,4′-difluoro-5-(5-(1-methyl-1H-pyrazol-4-yl)-1H-benzo[d]imidazol-1-yl)-[1,1′-biphenyl]-3-yl)cyclopropanesulfonamide (I). Compound (I) is a selective inhibitor of FGFR/VEGFR kinase families and is useful in the treatment of cancer.
US11866414B2
There are disclosed compounds of the following formula I: or a stereoisomer or pharmaceutically acceptable salt thereof, wherein all substituents are as defined herein, which are useful in the modulation of IL-12, IL-23 and/or IFNα, by acting on Tyk-2 to cause signal transduction inhibition. The compounds of the invention may be useful for treating neurodegenerative diseases or disorders.
US11866407B2
This invention is in the field of medicinal chemistry and relates to a new class of small-molecules having a pyrrolidinone-acetamide (or similar) structure (e.g., Formula I) which function as inhibitors of the SARS-CoV-2 papain-like protease (PLpro), which function as inhibitors of the SARS-CoV-2 related viral 3CL protease (MPpro), which function as therapeutics for the treatment of viral infection characterized with PLPpro and/or Mpro protease activity and/or expression (e.g., COVID-19), and which function as therapeutics for the treatment of other conditions characterized with PLPpro and/or Mpro protease activity and/or expression.
US11866399B2
Process for hydroformylation of olefins using Pt and bromine.
US11866388B1
Catalyst systems suitable for tetramerizing ethylene to form 1-octene may include a catalyst having a structure according to Formula (VI) or Formula (VII). In Formulas (VI) and (VII), X is a halogen, a (C2-C30) carboxylate, acetylacetonate, or a (C1-C30) hydrocarbyl; L1 is a neutral coordinating ligand; n is an integer from 0 to 6; Y is a (C6-C20)fluorine-substituted aryl, a (C6-C20)fluorine-substituted aryloxy, or a (C1-C20)fluorine-substituted alkoxy; and L∩L is a bidentate chelating ligand. The catalyst system may also include an aluminum containing agent which includes a reaction product of an organoaluminum compound and an antifouling compound. The antifouling compound may include one or more organic acids, organic acid salts, esters, anhydrides, or combinations of these.
US11866386B2
A method of reducing an aromatic ring or a cyclic, allylic ether in a compound includes preparing a reaction mixture including a compound including an aromatic moiety or a cyclic, allylic ether moiety, an alkali metal, and either ethylenediamine, diethylenetriamine, triethylenetetramine, or a combination thereof, in an ether solvent; and reacting the reaction mixture at from −20° C. to 30° C. for a time sufficient to reduce a double bond in the aromatic moiety to a single bond or to reduce the cyclic, allylic ether moiety.
US11866383B1
A nitrification inhibiting composition for use in agricultural applications includes from about 5% to about 15% propylene glycol methyl ether and from about 20% to about 35% dicyandiamide. The nitrification inhibiting composition may be combined with a fertilizer and applied to plants or soil to increases the effectiveness of the fertilizer, thereby positively impacting crop yield and quality.
US11866364B2
A salt bath for glass reinforcement, including a nitrate and a metal compound. The mass fraction of the nitrate is not less than 50%, and the nitrate is in a molten state. The metal compound is fused into the nitrate, and the metal compound contains the same metal element as the nitrate. The mass fraction of the metal element in the molecular formula corresponding to the metal compound is greater than the mass fraction in the molecular formula corresponding to the nitrate. Thus, compared with the existing salt bath, under the condition of the same mass, the salt bath can provide more effective amount of metal ions, thereby increasing the strength of glass after reinforcement, and at the same time, the lifetime of the salt bath is increased, reducing the waste of resources and environmental pollution.
US11866362B2
A glass container includes legible indicia having an indicia outer surface coextensive with an outer surface of an adjacent portion of the container and with no V-shaped depressions, and having an indicia inner surface that protrudes radially inwardly with respect to an inner surface of the container adjacent to the indicia inner surface.
US11866353B2
The present disclosure provides for methods and systems for separating ultrafine particulate pollutants from aqueous suspensions. The present disclosure provide for methods and systems that can reduce the amount of ultrafine particulate pollutants from aqueous solutions, for example storm water runoff, which are not readily or easily removed using current state of the art techniques. In general, methods of the present disclosure provide for removing a portion of target ultrafine particulate pollutants using magnetic nanoparticles, which form aggregates with the ultrafine particulate pollutants. After a time period a magnetic field is applied and the aggregate can be separated from the aqueous suspension. Subsequently, the aggregates can be broken down and the magnetic nanoparticles recycled or reused while the ultrafine particulate contaminants are further processed, recycled, or disposed of.
US11866351B2
The present disclosure relates to a biocide generating system for inhibiting bio-fouling within a water system of a watercraft. The water system is configured to draw water from a body of water on which the watercraft is supported. The biocide generating system includes an electrode arrangement adapted to be incorporated as part of an electrolytic cell through which the water of the water system flows. The water system is configured such that biocide treated water also flows to one or more components of the water system that are positioned upstream of the electrode arrangement.
US11866348B2
Introduced here are systems for treating a wastewater stream to produce an effluent stream. A treatment system can include a sensor for measuring a characteristic of the wastewater stream and/or the effluent stream, a pump for supplying a chemical additive to the wastewater stream, and a controller for varying the flow rate of the chemical additive based on real-time analysis of measurements generated by the sensor. The characteristic could be, for example, turbidity, pH, total suspended solids (TSS), etc. Some embodiments of the treatment system further include a flow meter for measuring flow of the wastewater stream. In such embodiments, the controller may vary the flow rate of the chemical additive based on the measurements generated by the sensor and the flow meter.
US11866347B2
A separator for separating one or more components selected from particulate material, hydrophobic material, non-polar material, microorganisms, or viruses from a mixture of water and the one or more components or from a mixture of a polar liquid and the one or more components, the separator comprising a layer of a metal hydroxide hydrate.
US11866344B2
Cesium-niobium-chalcogenide compounds and a semiconductor device are provided. The cesium-niobium-chalcogenide compound is selected from the group consisting of CsNbS3, CsNbSe3, and CsNbOx-3Qx, where Q is S or Se, and x is 1 or 2, and includes an edge-shared orthorhombic crystal structure. In one embodiment, the semiconductor device includes a cathode layer, an anode layer, and an active layer disposed between the cathode layer and the anode layer, and the active layer includes the cesium-niobium-chalcogenide compound.
US11866341B2
A closed-loop large-scale preparation method of fluoride nanomaterial is disclosed, comprising the following steps: dissolving initial raw material into water-soluble salt by using volatile acid; evaporating the remaining acid under reduced pressure and recovering; then, adding oily organic matter with high boiling point to continue to evaporate the combined volatile acid under reduced pressure; adding an oil-soluble fluorine source to the generated oil-soluble salt; increasing the reaction temperature to increase the crystallinity of the fluoride; after cooling, separating and recovering the product and the oily organic matter; and repeating the process to realize large-scale preparation. The method uses the closed-loop process flow, does not discharge waste, and has high device yield per unit volume, low production cost and low specified asset investment. The product has the characteristics of uniform particle size and good dispersibility. The method is a user-friendly and environment-friendly large-scale preparation method of the fluoride nanoparticles.
US11866338B2
An anode active material for secondary batteries which has improved cycle swelling characteristics and rapid charge performance, an anode comprising same, and a method for manufacturing same, in which the anode active material is manufactured by modifying the surface of natural graphite particles. The natural graphite particles have a Dmax/Dmin value of 1.6 to 2.1 in the particle size distribution thereof and have, formed in the surface thereof, pores having a diameter of 0.5 μm to 2.0 μm.
US11866335B2
A method for preparing a graphene based composite wave-absorbing material includes: dissolving a water soluble barium salt and a water soluble iron salt into deionized water, respectively; mixing barium salt solution and iron salt solution according to a molar ratio of Ba:Fe of 1:12 to obtain a precursor solution; dispersing a graphene material in deionized water to form a graphene dispersion; adding citric acid, nitric acid and the graphene dispersion into the precursor solution in sequence to form a mixture solution; stirring the mixture solution at a temperature of 50 to 75° C. to obtain a sol; coating and drying aged sol on a substrate to obtain a coating layer; and sintering the coating layer by a laser irradiation.
US11866329B2
A method for capturing material extracted from biochar is provided comprising the steps of: (i) providing a biochar; (ii) contacting the biochar with an extraction media, where the extraction media causes the removal of residual compounds from the pores and surface of the biochar, creating a resulting extract comprised of the extraction media and removed compounds; and (iii) collecting the resulting extract. The method also can include other steps of extraction and purification. The method further comprises the step of applying the resulting extract to seeds, plants, soil, other agricultural products, or for use in other applications. A biochar having high levels of soluble signaling compounds is also provided, where the biochar is derived from a biomass source that together with predefined pyrolysis parameters produces resulting biochar having increased levels of soluble signaling compounds that are known to increase seed germination rates and early plant growth.
US11866323B2
A method for manufacturing at least one membrane system for a micromechanical sensor for the calorimetric detection of gases. A wafer-shaped substrate is provided. At least one reference volume is introduced from a front side into the wafer-shaped substrate with the aid of a surface or volume micromechanical process while forming a reference membrane covering the reference volume at least in some areas. At least one measuring volume, which is adjacent to the at least one reference volume, is introduced into the substrate from a back side or the front side of the wafer-shaped substrate while forming a measuring membrane. A wafer-shaped cap substrate is applied onto the front side of the wafer-shaped substrate. A membrane system and a component are described.
US11866312B1
Apparatus for automatically filling fluid into containers includes an actuator for raising and lowering a fluid dispensing needle. The needle is supported for vertical sliding movement. A first end of a pivot arm is engaged with a cam rotated by a motor for rocking the pivot arm. The dispensing needle is also engaged with the pivot arm for being raised or lowered thereby as the pivot arm rocks. The cam, which may be circular and eccentric, may be surrounded by a circular bearing and slidingly received within a yoke at the first end of the pivot arm. The needle is coupled to a pump. A first sensor senses that the needle has been moved to its lowered position. A control circuit responsive to the first sensor prevents the pump from pumping fluid to the needle unless the needle is in its lowered position.
US11866311B2
A cap removal device and a thrombelastography device having same are disclosed. The cap removal device comprises a drive part (1), a connection shaft (2), and a cap removal member (3). The connection shaft (2) can move upward when driven by the drive part (1). The cap removal member (3) has an end (31) and the other end (32); the end (31) is pivotally connected to the connection shaft (2), so that when the connection shaft (2) moves upward when driven by the drive part (1), the cap removal member (3) rotates, due to the upward movement, around a pivot point (4) located between the end (31) and the other end (32) of the cap removal member (3), so that the other end (32) of the cap removal member (3) moves downward to contact a cap (5) to be removed, thereby removing the cap (5). The thrombelastography device has the cap removal device, and thus can achieve the automatic removal of the cap (5) and the automated control on the drive part (1), thereby improving the cap removal efficiency and the test efficiency, and saving time of manually removing the cap.
US11866310B2
A work assist system is provided for an industrial vehicle. The work assist system includes a support structure having a portion including a predefined cross-sectional shape. The work assist system further includes a clamp member having coupling structure for removably coupling the clamp member to the support structure portion, and mounting structure that removably supports a work assist item that is usable by an operator located in an operator compartment of the vehicle.
US11866308B2
A self-erecting crane includes a mast supporting a foldable jib having jib elements articulated together, configurable between a transport configuration and a work configuration. The crane also includes a motor-driven folding/unfolding system for performing configuration change operations implementing kinematics of folding and unfolding the jib, and a control/command system connected to the motor-driven folding/unfolding system to drive it. One or several inclinometer(s) are mounted on one or several jib element(s) to measure actual inclinations of the jib element(s) with respect to a reference axis. The control/command system is configured to drive the motor-driven folding/unfolding system according to the actual inclinations of the jib element(s) during the kinematics of folding and unfolding the jib.
US11866307B2
A boom, of a machine, may include a first member; a second member opposite the first member; and a support structure. The support structure may comprise a first support member; a second support member; and a third support member. The first member, the first support member, and the second support member may define a first opening. The second member, the second support member, and the third support member may define a second opening. A first area of the first opening may exceed a second area of the second opening.
US11866303B2
Described is a safety system for a self-propelled operating machine (1) comprises a processing unit (3) which includes: a memory module (31) in which a plurality of load diagrams is stored; a limiting module (32) configured for limiting the operational possibilities of actuators of the machine (1), on the basis of a load diagram; a measuring device (41, 42) for acquiring operating parameters relative to various operating conditions of the operating machine (1); and a selection module (33) configured for selecting from the memory module (31) a load diagram on the basis of an operating parameter acquired by the measuring device (41, 42).
US11866301B2
A foldable stairlift includes a rail, a carrier that drives along the rail and a chair supported by the carrier. The chair and carrier define a stairlift unit. The chair includes a base body coupled to the carrier, a foldable seat body coupled to the base body, a foldable leg body coupled to the seat body, a foldable footrest body coupled to the leg body, a back rest body coupled to the base body, and a foldable armrest body coupled to the backrest body. Each of the seat body, leg body, and footrest body have their own respective folding system that controls the folding and unfolding of their respective seat body, leg body, and footrest body. And each folding system is controlled by an assigned motor that operates according to a variable speed profile. A method of controlling the folding and unfolding action of the foldable stairlift includes operating the motors according to one or more speed profiles.
US11866300B2
A tension member for a lifting and/or hoisting system includes a core including a plurality of load carrying fibers arranged in a matrix material, and an outer layer secured to the core including a plurality of outer fibers arranged around a perimeter of the core. The outer layer includes one or more outer fibers arranged off-axis relative to the load carrying fibers of the core. A method of forming a tension member for an elevator system includes arranging a plurality of load carrying fibers along a length of the tension member, retaining the plurality of load carrying fibers in a matrix material to define a core, and enclosing the core in an outer layer including a plurality of outer fibers arranged around a perimeter of the core. The outer layer includes one or more outer fibers arranged off-axis relative to the load carrying fibers of the core.
US11866296B2
An elevator monitoring system and method includes cabin-based radars monitor doors and passengers within a cabin; waiting zone radars monitor passengers in a waiting zone; a central processor analyzes data from the various monitors and executes an elevator control function to control the elevator system. The door state is determined by detecting reflections from internal angles within the cabin and a door management system manages door operation safely by monitoring a proximal zone around the automatic door, detecting moving objects and obstructions.
US11866294B2
In accordance with at least one aspect of this disclosure, a retractable hose reel system includes a reel configured to rotate about a shaft, a fluid driven motor configured to drive the reel, a fluid connector configured to connect to a fluid source to power the fluid motor, and a fluid line connecting between the fluid connector and the fluid motor to supply fluid from the fluid source to the fluid motor to power the fluid motor. A valve is disposed in the fluid line, configured to move between an open position and a closed position, where in the open position the valve allows fluid flow to the fluid motor and in the closed position the valve prevents fluid flow to the fluid motor.
US11866293B2
The present invention relates to a handheld (i.e. single-handedly held) tool for automatically winding string, line, cordage, yarn, thread, and twine onto a spool. The tool includes a handheld and portable threaded mechanism upon which a spool is mounted. Spools of various lengths can be mounted onto the threaded mechanism using a height-adjustable cap. An internal motor is configured to rotate the threaded mechanism and mounted spool for automatically winding string, et. al. A handle of the tool houses rechargeable batteries that are coupled with the internal motor and a push button disposed on the handle activates the motor for rotating the threaded mechanism. The tool includes a USB charging port for receiving a USB cable for recharging the rechargeable batteries.
US11866285B2
Provided is a coating film transfer tool having a pivotable transfer head and a tape guide for transfer tape, and capable of satisfactorily transferring a coating film. In some examples, such a coating film transfer tool includes tape guides respectively having lower sides disposed on a first side of a main body where the transfer tape passes before coating film transfer, and upper sides disposed on a second side of the main body where the transfer tape passes after coating film transfer passes. An interval between the upper sides is wider than an interval at a position where an interval between the lower sides is narrowest.
US11866284B2
An automatic tape dispensing system comprising a feed system having a plurality of rollers, the rollers driven by a motor for peeling tape from a tape roll and dispensing the tape from the dispensing system. The system further includes a reel for supporting the tape thereon and a track supporting the reel. The track extends from a first upper end to a second lower end, the reel movable from the upper end to the lower end in response to tape being dispensed from the system in order to maintain a desired tension on the tape roll.
US11866281B2
Provided is an electrostatic adsorption body capable of exhibiting a high adsorption force, especially with respect to a highly insulative sheet-like object to be adsorbed, such as a cloth, while using an electrical adsorption force. This electrostatic adsorption body, which uses electrostatic force to adsorb an object to be adsorbed, is provided with: a laminate sheet in which a 20-200 μm-thick insulator, a 1-20 μm-thick electrode layer, and a 20-200 μm-thick resin film are sequentially laminated; and a power supply device that applies a voltage to the electrode layer, wherein the resin film at least has a tensile modulus of 1 MPa or more and less than 100 MPa and a volume resistivity of 1×1010-1013 Ω cm, the electrode layer is composed of a bipolar electrode including a positive electrode and a negative electrode, and an object to be adsorbed is adsorbed using the resin film as an adsorption surface due to an electrostatic adsorption force that is generated by applying a voltage to the electrode layer.
US11866277B2
According to an exemplary embodiment, a dispenser for rolled paper product includes a first arm and a second arm, with the first arm having an elongate member configured to receive a roll of paper product. A first mounting bracket is configured to rotatingly couple the first arm to a mounting surface. The first arm is configured to cover the first mounting bracket from view. A second mounting bracket is configured to rigidly couple the second arm to the mounting surface.
US11866275B2
A method unloads bulk goods from a laterally open large container using an unloading device with a tilting unit and a platform. The tilting unit and the platform have a common rotational axis. Both the bulk goods and the unloading device are prevented from being damaged. The laterally open large container which is filled with a bulk good is positioned on the tilting unit. The platform is flipped up such that the platform closes the opening side of the large container. The tilting unit is tilted together with the large container located thereon and the platform closing the opening side of the large container about the common rotational axis such that the large container is positioned on the container opening side, and the bulk good is deposited on the platform. The tilting unit is then tilted back together with the large container, the bulk good remaining on the platform.
US11866269B2
A system is disclosed for receiving a plurality of objects from an elevated trailer of a tractor trailer. The system includes a collection conveyor extending between a base end and a coupled end, the coupled end being rotatably coupled to an evacuation conveyor, said collection conveyor including an object facing surface between the base end and the coupled end for receiving the plurality of objects, said collection conveyor being rotatably adjustable with respect to the evacuation conveyor at the coupled end, and both the evacuation conveyor and the coupled end of the collection conveyor being elevationally adjustable.
US11866261B2
A processing system for processing objects using a programmable motion device is disclosed. The processing system a perception unit for perceiving identifying indicia representative of an identity of an object associated with an input conveyance system, and an acquisition system for acquiring the object from a plurality of objects at an input area using an end effector of the programmable motion device, wherein the programmable motion device is adapted for assisting in the delivery of the object to an identified processing location. The identified processing location being associated with the identifying indicia and said identified processing location being provided as one of a plurality of processing locations. The processing system also includes a delivery system for receiving the object in a carrier and for delivering the object toward the identified processing location.
US11866256B2
An automated order fulfillment system and mobile robot are disclosed, where the mobile robot includes a compliant drive for moving between levels of a multilevel storage structure.
US11866253B2
A high-density storage system for goods is described in which totes carrying the goods are stored in a storage structure and stored and retrieved via stationary or mobile conveyers running along opposite ends of each layer of the storage structure. The totes may be moved to or from the conveyers as the rows move at a constant velocity toward or away from the conveyers. Totes at the ends of rows are quickly moved and stored in another row until the desired tote appears at the end of the row, at which point the desired tote is carried to an exit point of the storage structure by one of the conveyers.
US11866251B2
A sealing system for a covered tank, particularly a fixed gas-sealing tank in a wastewater treatment system, includes a thrust ring positioned just inside the tank rim, secured to a series of radial beams for the cover. Preferably supported on corbels anchored to the interior tank wall, the thrust ring has an outwardly extending generally horizontal flange that overlies the edge of the tank rim. To this flange and to the top of the tank rim is secured a flexible membrane seal, around the periphery of the tank. The membrane seal is easily installed, reliable as a seal, and can be efficiently replaced when needed.
US11866250B2
Described herein are units for transportation of cargo, and methods of using them. In some embodiments, the units are collapsible, stackable cargo units. In some embodiments, the cargo units include a generally rectangular base having a front, a rear and two sides, with forklift slots on its front, rear and each side. The cargo units may further include front and rear walls extending upward from the base. The cargo units may further include first and second side walls extending upward from the base between the front and rear walls. The first side wall may have a length greater than the second side wall. The cargo units may further include an integrated lid hingedly attached to one or more of the front, rear, and side walls.
US11866245B2
A dispensable substance container may include an elongate body encompassing a lumen, wherein the lumen is to contain the dispensable substance; a dispensable; substance dispensing nozzle attached to a first end on the elongate body; a sealing material within the lumen, wherein the sealing material is moveable, by a pushrod, within the lumen to push the dispensable substance out the dispensing tip; and a structurally compromised portion of the elongate body extending along a length of the elongate body, wherein the elongate body is to be severed along the structurally compromised portion by the pushrod.
US11866239B2
A child safety lid is provided and used to close the opening of content containers including rigid and flexible containers/bags. The cover requires a multiple step process in order to be removed and helps to prevent inadvertent or accidental openings of the container. The lid/cover can comprise a top member, a locking member, a bottom member and a seal member. The top member can be secured to the bottom member with the locking member captured therebetween and the seal member can extend downward from the bottom member and contact an internal shelf/ledge disposed within the container near the container opening. In one embodiment, the seal member and bottom member can be bonded to each other through an overmolding process. In one embodiment, the seal can be constructed from an elastomer material.
US11866235B2
A blank for producing a three-dimensional structure, from paper, cardboard, or plastic, includes at least three lateral surfaces and at least one bottom and/or top tab for forming the three-dimensional structure in a folded state of the blank. At least two of the lateral surfaces and/or at least one of the lateral surfaces having the bottom and/or cover tab being connected to one another by means of at least one mechanically produced creasing line. The creasing line is produced without ablation or other removal of material from the blank, at least one groove being produced by means of a laser within at least one of the lateral surfaces connected by means of the creasing line. The groove being configured to run at an angle to the creasing line and impinging on or intersecting the creasing line. A three-dimensional structure and a folding box produced from the blank are also disclosed.
US11866233B2
A package includes a container and a closure coupled to the container to control release of product therefrom. The closure includes a closure cap coupled to the container and a flip-top cap coupled to the closure cap and configured to pivot relative to the closure cap between a closed position and an opened position.
US11866229B2
A cap for a fluid container includes a main body, an actuator ring slidable along the main body and having an annular groove, and a plurality of latches having secure and release states and that may be placed in the release state by contact with the actuator ring. A closure system for a fluid container includes the cap, and a lip attached to a fluid container that is engaged by the latches of the cap. The lip may be integral with a fluid container or part of an adapter that is connected to the fluid container. A method of automated handling of a container includes engaging an annular groove of an actuator ring of a cap using a robotic arm, driving the actuator ring, and removing the cap from the container. The method may further include transporting the container via engagement of the robotic arm with the cap.
US11866226B2
A foldably constructed pallet includes a top member forming a top surface of the foldably constructed pallet and a bottom member forming a bottom surface of the foldably constructed pallet. The bottom member includes, extending from the bottom surface, a plurality of outer sidewalls, and a plurality of internal sidewalls. An outer sidewall of the plurality of outer sidewalls and an internal sidewall of the plurality of internal sidewalls cooperate to define a cradle configured to hold a structural insert such that folded panels of the structural insert may be engaged with each of the outer sidewall and the internal sidewall. The top member may be connected to the bottom member and covering the cradle.
US11866221B2
A label printing device includes: a conveying unit configured to convey a mountless label; a shaft portion configured to change a conveying direction of the mountless label; a cutting unit configured to cut the mountless label of which the conveying direction is changed by the shaft portion and issue a label; and a controller configured to control the conveying unit and the cutting unit. The controller executes a preparatory operation mode in which the mountless label is conveyed a predetermined distance longer than a length of a portion extending from the shaft portion to the cutting unit in the mountless label by the conveying unit and is cut by the cutting unit when a label is not issued for more than a predetermined time.
US11866216B2
An apparatus for dispensing lids has at least one magazine lane including an entrance end, an exit end, and a longitudinal length defined therebetween. The at least one magazine lane further includes a plurality of side guides along the longitudinal length for guiding the lids therebetween and a pair of rollers for carrying the lids thereon. The apparatus further has a throat plate at or near the exit end, the throat plate including an opening. At least one of the throat plate, the side guides, or the rollers is adaptable so as to accommodate different sizes and/or shapes of lids.
US11866214B2
Time required for initial operation and operation immediately after wound body replacement is shortened. A packaging device packages an object to be packaged using a wound body. An elongated sheet-shaped packaging material is wound into the wound body. The wound body includes a recording medium that stores information. The information recorded in the recording medium includes remaining amount information indicating a remaining amount of the packaging material in the wound body. The packaging device includes a drive unit that generates driving force in order to rotate the wound body, an information reader that reads the remaining amount information stored in the recording medium, and a controller that controls the packaging device. The controller sets a rotation speed of the wound body based on the remaining amount information read by the information reader.
US11866212B2
A product bagging assembly and method of manipulating a web material bag that is operable to create a bag opening that is greater than six inches and which is operable without substantially detracting from product throughput associated with use and operation of the product bagging assembly. In a preferred embodiment, the bag opening/dosing assembly includes a first actuator and a second actuator that are connected to one another such that a position of one of the actuators can be manipulated by operation of the other actuator. The product bagging assembly can be provided as a kit configured for plug and play operation with previously provided bag and product delivery systems.
US11866211B2
A handling device having a holder for gripping web-shaped packaging material, which holder has a curvature in the longitudinal direction of the holder. When the packaging material is gripped by the handling device, a free end section of the packaging material is arched in the transverse direction of the packaging material and projects out from the handling device to be inserted into a processing station of a packaging machine.
US11866203B2
Systems and methods to remove dust from an extravehicular mobility unit (EMU) worn by an astronaut in a deep space environment involve one or more ionic shower units installed external to an interior volume of a facility. Each ionic shower unit releases positively charged ions and negatively charged ions in a specified direction to neutralize the dust and generate neutralized dust. The interior volume of the facility is defined by an interior hatch that is separated from an exterior hatch by an airlock. One or more collection units is installed external to the interior volume. Each collection unit traps the neutralized dust to prevent the dust from entering the interior volume.
US11866198B2
A method and system provide the ability to autonomously operate an unmanned aerial system (UAS) over long durations of time. The UAS vehicle autonomously takes off from a take-off landing-charging station and autonomously executes a mission. The mission includes data acquisition instructions in a defined observation area. Upon mission completion, the UAS autonomously travels to a target landing-charging station and performs an autonomous precision landing on the target landing-charging station. The UAS autonomously re-charges via the target landing-charging station. Once re-charged, the UAS is ready to execute a next sortie. When landed, the UAS autonomously transmits mission data to the landing-charging station for in situ or cloud-based data processing.
US11866197B2
Provided is a target member for accurately guiding a moving body to a target site. A target member 10 is used when performing control for guiding a moving body 20 to a target site, and the target member 10 is formed by using two or more different feature members 11, 12 that are set such that a shape of a target member image 44 that corresponds to the target member 10 captured by an image capturing unit 21 (an image capturing apparatus) that is mounted in the moving body 20 changes according to a measurement distance that indicates a distance between the target member 10 and the moving body 20.
US11866190B2
A floor system designed for use with an aircraft is provided. The aircraft comprises a cabin characterized by a first capacity defined by the number of personnel in a predetermined position which may be accommodated therein, and comprises an auxiliary fuel port. The floor system is configured to be detachably installed within the cabin and comprises one or more top panels constituting, when the floor system is installed in the aircraft, a floor of the cabin, and one or more fuel tanks disposed below the top panels and defining an internal space for containing liquid fuel there within. At least one of the fuel tanks is configured for connection to the auxiliary fuel port for supplying the fuel to the aircraft. The cabin with the floor system installed therein is characterized by a second capacity being equal to the first capacity.
US11866187B1
An assembly of an electric propulsion system with power harvesting system and a method of manufacturing the electric propulsion system are disclosed. The electric propulsion system may include a propulsor configured to generate thrust. The electric propulsion system may include an electric motor configured to power the propulsor. The electric motor may include a stator configured to produce a magnetic field, wherein the stator may include a winding comprising an electrically conductive material. The electric motor may further include a rotor configured to be rotated by the magnetic field from the stator, wherein the rotor may include a coil attached to the rotor configured to induce an electric potential and an airgap between the stator and the coil.
US11866180B2
An example hybrid aircraft propulsion system includes one or more power units configured to output electrical energy onto one or more electrical busses; a plurality of propulsors; and a plurality of electrical machines, each respective electrical machine configured to drive a respective propulsor of the plurality of propulsors using electrical energy received from at least one of the one or more electrical busses.
US11866178B2
Disclosed is an air intake of an aircraft turbine engine nacelle having a lip, a downstream portion and an internal partition separating the lip and the downstream portion, the lip delimiting an annular recess, the downstream portion having a downstream inner wall and a downstream outer wall, the air intake having an injection channel for injecting a hot air stream into the annular recess, a passage opening formed in the internal partition, an outlet opening formed in the downstream outer wall and a discharge channel for discharging the hot air stream mounted in the downstream portion and having a first end connected to the internal partition, a second end connected to the downstream outer wall and a main body having at least one flexible portion.
US11866176B2
A seat assembly includes a backrest that is configured to recline over a reclination range, and a variable reclination range limiter that is configured to selectively adjust a limit of the reclination range limit. A variable reclination range limiting method for a seat assembly includes allowing a backrest of the seat assembly to recline over a reclination range, and selectively adjusting a limit of the reclination range by a variable reclination range limiter.
US11866173B2
Provided is a G tolerance improvement device provided with: an estimation unit that estimates either or both of a body fluid volume in the head of a user and a change amount of the body fluid volume; and a pressurization unit that applies pressure to the user on the basis of either or both of the body fluid volume and the change amount estimated by the estimation unit.
US11866172B2
A flow body for an aircraft includes a recess in a surface of the flow body, a first structural component with a porous material and may also include a second structural component with a porous material. The recess includes a front recess region and a rear recess region. The first structural component is arranged in, or on, the front recess region and the second structural component may be arranged in, or on, the rear recess region. An aircraft having the flow body, a weapons system having the flow body and a method for manufacturing a flow body for a vehicle are also described.
US11866166B2
A two degrees of freedom actuator for example for multi-bladed rotor of an aircraft with at least two blades that are driven in rotation about a main rotation axis by primary actuator, and a secondary actuator that is arranged to rotate each of said blades about the respective blades' longitudinal axis, with a synchronization means that is operatively arranged for driving the secondary actuator based on an azimuth of the rotor about the main axis for obtaining a determined cyclic pitch of a given amplitude for each blade depending on the azimuth of the rotor.
US11866163B1
A parking tail rotor for a rotary wing aircraft stops rotating at a high forward aircraft speed when aircraft control surfaces have adequate control authority to balance main rotor torque without the rotating tail rotor. When stopped, the blades of the parking tail rotor move due to the force of the relative wind to a parked position in which the span of the blades extend in the aft direction, reducing air resistance to the forward motion of the aircraft.
US11866160B2
The present invention provides a power device generating greater propelling force and finds that traditional power devices do not include all propelling forces based on the fundamental core propelling force source problem. External pressure is guided to the traditional power devices since the inner speed is higher the outer speed, power consumption for overcoming fluid resistance is high, and mutual contradiction results are obtained. The unique difference between the present invention and general common sense lies in opposite fluid pressure directions; inner fluid channels and outer fluid channels with higher flow speeds are formed to generate pressure differences which guides the fluid pressure to the outside and serve as propelling force, thus the present invention creatively finds three propelling force sources, two lifting force or propelling force sources of helicopters or airplanes driven by propellers and two propelling force sources for sufficient burning of fuel in combustion chambers of engines.
US11866153B2
The invention relates to a force application device for a control stick of an aircraft, said control stick comprising a control lever that is connected to at least one motor comprising a drive shaft that can be rotated about an axis, the force application device comprising: a first pin connected to the shaft, a housing, an electromagnet, a movable actuator comprising a magnetic material, a coupling device comprising an input gear connected to the housing and an output gear comprising a second pin, and means for clamping the first pin and the second pin which comprise a first tooth and a second tooth, said device having an operating configuration in which the electromagnet is active and the output gear is positioned at a distance from the input gear, and a blocking configuration in which the electromagnet is inactive and the gears are meshed.
US11866152B1
A system of an electric aircraft with pitch control using an elevator is presented. In some embodiments, the electric aircraft may include an elevator configured to deflect. In some embodiments, the electric aircraft may further include a lift lever configured to generate a lift command upon activation by a pilot. In some embodiments, the electric aircraft may further include a flight controller communicatively connected with the lift lever and the elevator, wherein the flight controller is configured to receive the lift command from the lift lever and adjust the elevator as a function of the lift command.
US11866151B2
A system and method for detecting fixed pitch operation of a variable pitch propeller of an engine are provided. A command signal for maintaining a rotational speed of the propeller at a reference speed is output. An actual value of at least one of the rotational speed and a blade angle of the propeller is obtained. From the actual value, it is assessed whether an expected change in the at least one of the rotational speed and the blade angle of the propeller has occurred in response to the command signal. Responsive to determining that the expected change in the at least one of the rotational speed and the blade angle of the propeller has not occurred in response to the command signal, operation of the propeller at fixed pitch is detected and an alert output accordingly.
US11866150B2
A propeller safety device is provided. The propeller safety device is configured to insert a moving part of a propeller into a fixed part during a crash of an air mobility to allow a reduction in the total length of the propeller, thereby preventing the propeller from hitting the ground. Accordingly, a secondary accident due to fragments formed when the rotating propeller hits the ground is prevented.
US11866148B2
A floor panel for installation in an aircraft includes a plurality of thermoplastic C-shaped stringers, a consolidated thermoplastic deltoid filler, a thermoplastic upper facing sheet, and a thermoplastic lower facing sheet. The stringers are disposed in a parallel arrangement with one another. The deltoid filler is disposed within a longitudinally-extending notch defined by a pair of adjacent stringers. The upper facing sheet covers an upper surface of the stringers and the deltoid filler. The lower facing sheet covers a lower surface of the stringers and the deltoid filler. The stringers, the deltoid filler, and the upper and lower facing sheets are integrally consolidated forming a unitary construction.
US11866143B2
A drive system for a ship, including at least two propulsion units, each propulsion unit having a propeller and a drive engine with an above-water transmission connected downstream for driving the propeller. Each drive engine can be connected to and disconnected from the associated above-water transmission with a clutch and between the above-water transmissions, a switchable drive train is provided by which in one switching state, the above-water transmissions can be coupled and driven jointly and in another switching state, they can be decoupled from each other.
US11866128B2
A barrier accessory device for a watercraft includes: an accessory connection base configured for having at least one accessory removably connected thereto; a first rail connector connected to the accessory connection base at a first end portion thereof, the first rail connector having a slot-engaging member configured to be inserted into a slot defined in one of an upper rail and a lower rail of a barrier structure of the watercraft; and a second rail connector connected to the accessory connection base at a second end portion thereof opposite the first end portion, the second rail connector having a locking assembly configured to be selectively locked onto an other one of the upper rail and the lower rail.
US11866126B2
A multi-sprocket arrangement for a rear wheel hub of a bicycle may have improved gearshift characteristics, reduced vibrations during skewed running, and improved wear characteristics. The multi-sprocket arrangement includes a multiplicity of sprockets of different diameters, wherein at least one of the sprockets has a multiplicity of teeth. Also on the circumference of said sprocket, as viewed in a circumferential direction, at least one sequence of teeth is provided in which, with regard to their material thickness, a thin tooth is followed by a thick tooth which is followed in turn by another thin tooth.
US11866118B2
A clamping mechanism is provided, the clamping mechanism have two clamps, a tensioning conduit corresponding to each of the clamps, and an actuator for simultaneously tensioning the two clamps by way of the tensioning conduits. Each clamp has a bracing element and a gripping segment, and when the clamps are tensioned along the tensioning conduit, the gripping segment of each clamp is drawn towards the corresponding bracing element. Also provided is a bicycle drive assembly, the assembly has two clamps for fixing to a bicycle, a drive mechanism for driving a bicycle wheel, and two elongate supports extending from the drive mechanism to corresponding clamps. When applied to a bicycle, a wheel of the bicycle passes partially between the elongate supports.
US11866117B2
Systems and methods for operating an electric motor of a two-wheeled vehicle. One method includes detecting a position of a drive torque control included in the vehicle, detecting a position of a regenerative brake control included in the vehicle, mapping the detected position of the drive torque control to a requested driving torque, mapping the position of the regenerative brake control to a requested braking torque, determining, with an electronic control unit, a torque command based on the requested driving torque and the requested torque, and transmitting the torque command to an electric motor included in the vehicle.
US11866113B2
In a straddle-type vehicle including an airbag device in a seat for an occupant, the airbag can be efficiently disposed in the seat, and an occupant on a front side of the airbag device can be protected by the airbag device. In the straddle-type vehicle including an airbag device in a seat for an occupant, the seat includes a front seat and a rear seat disposed on a rear side and an upper side of the front seat, a step portion is formed between the front seat and the rear seat, the airbag device is disposed on a rear side of the step portion in the seat, and an airbag of the airbag device is to be deployed forward of the vehicle.
US11866110B2
A method and apparatus for a seat post assembly that is adjustable to an upper, intermediate, and lower seat post position using a locking member and a sleeve member coupled to an actuator for securing and releasing an inner tube with respect to an outer tube. The actuator may move the sleeve member to release the locking member from engagement with the outer tube to adjust the inner tube and thus the seat post assembly to the upper, intermediate, or lower seat post positions. The actuator and the sleeve may be biased into an initial position that urges the locking member into engagement with outer tube to lock the inner tube to the outer tube.
US11866106B2
Methods and apparatus to determine rack force are disclosed. An example apparatus includes a rack to couple to a steering knuckle of a vehicle, a ball nut engaged with the rack, a first ring gear coupled to the ball nut, a first pinion fixed to a motor, the first pinion engaged with the first ring gear, the motor to rotate the ball nut to move the rack, a motor encoder to detect a rotation of the first pinion, a second ring gear coupled to the ball nut, and a sensor fixed to a second pinion, the second pinion engaged with the second ring gear, the second pinion to rotate as the second ring gear rotates, the sensor to detect a rotation of the second pinion, the rotation of the second pinion and the rotation of the first pinion corresponding to a force on the rack.
US11866095B2
Methods, apparatus, systems and articles of manufacture are disclosed for multi-position wheel assembly mounts. An example vehicle frame disclosed herein includes apertures adjacent to each of a plurality of wheel assembly locations on the vehicle frame, and a wheel assembly mount at each of the wheel assembly locations, the wheel assembly mount having protrusions extending toward the vehicle frame and positionable in the apertures in a first position to provide a first ride height of the vehicle frame and a second position to provide a second ride height of the vehicle frame, the first ride height less than the second ride height.
US11866087B2
A steering column assembly is disclosed that comprises: a housing having outer, intermediate and inner elongate, telescopically mounted housing portions movable relative to one another along an adjustment axis; a steering column rotatably mounted in the inner elongate housing portion and being configured at one end for attachment of a steering member (e.g. a steering wheel); a leadscrew rotatably mounted on the intermediate housing portion and having first and second threaded portions of opposite handedness; a motor for rotating the leadscrew; a first displacement member screw-threadedly mounted to the first threaded portion of the leadscrew and connected to one of the outer and inner elongate housing portions; and a second displacement member screw-threadedly mounted to the second threaded portion of the leadscrew and connected to the other of the outer and inner elongate housing portions; whereby rotation of the leadscrew causes displacement of the first and second displacement members in opposite directions along the adjustment axis.
US11866086B2
A foldable steering wheel is configured to be folded or unfolded due to linear movement and rotating movement of the steering wheel to secure an available space in a driver's seat, and the foldable steering wheel includes an armature body connected to a column, the steering wheel coupled to the armature body, configured to be linearly moved in a radial direction with respect to a steering shaft of the column, and configured to be rotatably moved on a rotation shaft which is unparallel to the steering shaft, and a moving device engaged to the steering wheel and configured to generate a linear movement path and a rotating movement path of the steering wheel to move the steering wheel with respect to the armature body.
US11866084B2
Embodiments herein are directed to a mobility device. The mobility device includes a frame, a pair of foot plates, and a base. The frame has a pair of side rails. The pair of foot plates are pivotally attached to the pair of side rails. Each of the pair of foot plates have a transport surface. The base has an upper surface and an opposite lower surface. The lower surface of the base includes at least one receiving cavity that corresponds to a shape of the pair of foot plates. The base is positioned on the transport surface to receive the pair of foot plates within the at least one receiving cavity and is configured to receive a plurality of cargo containers on the upper surface.
US11866082B2
A magazine for bundles of blanks includes a vertical channel configured for inserting and extracting bundles of blanks and a succession of groups of supporting parts distributed along the channel. The supporting parts are configured to support the underside of a respective bundle of blanks. More specifically, each supporting part is movable between an extracted position, where it projects from the channel, towards the inside of the channel, to intercept a bundle that is moving down along the channel and to provide a steady support for the bundle, and a retracted position, where the supporting part is aligned or recessed with respect to the channel to allow the bundle to move along the channel towards a portion under the supporting part. The magazine also includes, for each supporting part, an actuating device configured to promote the passage of the supporting part from the retracted position to the extracted position and controllable by an operator, preferably manually.
US11866079B2
An exemplary embodiment of the present disclosure provides a robot comprising a body, a processor, and a memory. The memory further comprising instructions that, when executed by the processor cause the body to engage a first wire to support the robot from the first wire, traverse the first wire, engage a second wire simultaneously while engaging the first wire, the second wire branching from the first wire, then after engaging the second wire, disengage the first wire and traverse the second wire.
US11866078B2
A rail warning system using wireless portable transmitters/receivers. The rail warning system uses chirp spread spectrum modulation scheme, and alerts personnel in work zones on or near train tracks as well as optionally, on track equipment and train operators , of approaching trains or on track equipment. Portable wayside devices may also be positioned on the rail web, optionally magnetically, to alert work personnel, allowing for secure placement but also portability to other locations on the same track or adjacent tracks.
US11866069B2
A method for selecting parking location for an autonomous driving vehicle is provided. The method comprises steps of: obtaining a request of a user; constructing a first map according to a current location of the user, a first parking location, and a high-precision map; obtaining a second parking location selected by the user on the first map; controlling the autonomous driving vehicle to drive to the second parking location, and calculating distance between a current location of the autonomous driving vehicle and the second parking location; when the distance is less than a preset distance, constructing a second map according to the current location of the autonomous driving vehicle, the second parking location, and the high-precision map; controlling the autonomous driving vehicle to drive to the second parking location selected by the user on the second map. Furthermore, an intelligent control device and an autonomous driving vehicle are also provided.
US11866063B2
A method, computer program product, and computing system for monitoring the interior of an autonomous vehicle for information being provided by a rider of the autonomous vehicle to the autonomous vehicle; and processing the information provided by the rider of the autonomous vehicle to the autonomous vehicle to generate a response based, at least in part, upon the information provided by the rider of the autonomous vehicle.
US11866062B2
A vehicle display device includes: an acquisition unit that acquires a travel environment; a prediction unit that predicts a behavior of another vehicle traveling ahead of a vehicle of a driver, based on the travel environment; and a display unit that, when the behavior of the other vehicle is predicted to become unstable, displays the predicted behavior of the other vehicle to the driver of the vehicle. The vehicle display device may include: a prediction unit that predicts a behavior of a vehicle, based on the travel environment; and a display unit that, when the behavior of the vehicle is predicted to become unstable, displays the predicted behavior of the vehicle to a driver of the vehicle.
US11866061B2
A method for providing a visual driving speed recommendation to an operator of a vehicle includes determining a current speed; determining a corresponding energy efficient speed; determining a higher corresponding less energy efficient speed; determining a first transition range between the corresponding energy efficient speed and the higher corresponding less energy efficient speed; and displaying, on a display, a display zone, the display zone comprising: a first indicator corresponding to the current speed; a first pattern corresponding to the corresponding energy efficient speed; a second pattern different from the first pattern and corresponding to the higher corresponding less energy efficient speed; and a first pattern range therebetween corresponding to the first transition range.
US11866059B2
A route information storage function having decreased data storage requirements is provided in a vehicle controller that includes a processor, a first storage unit, and a second storage unit and that stores route information indicating a route to a target point. The vehicle controller includes a traveling state acquiring unit that acquires route information on a vehicle, a short-term storage information processing unit that stores the route information in the first storage unit, as short-term storage information, the route information being acquired by the traveling state acquiring unit while the vehicle is traveling, and a long-term storage information processing unit that after the vehicle has reached the target point, determines long-term storage information from short-term storage information stored in the first storage unit, the long-term storage information processing unit storing the determined long-term storage information in the second storage unit.
US11866048B2
The disclosure relates to a safety system for a battery electric vehicle (BEV) that comprises one or more electromotors powered by a battery system, wherein the safety system allows a “limp home mode” to be activated. The disclosure further relates to a battery electric vehicle provided with such a safety system. The battery system of the electric vehicle preferably is the sole power supply of the vehicle for powering the one or more electromotors for a prolonged period of time, e.g. a period of time greater than 10 minutes.
US11866042B2
Disclosed is a vehicle that may include a frame to support a power system, such as an engine, and one or more surface supports, such as one or more wheels, to support the frame. The engine may include an internal combustion engine and a fuel supply system therefore. The engine may provide power to drive the wheels.
US11866026B2
An apparatus configured to perform electrical braking with a fail-safe function includes a main brake pedal sensor configured to generate a first output signal, a main brake controller configured to brake a vehicle by controlling a brake according to a first braking signal based on the first output signal, a redundancy brake pedal sensor configured to generate a second output signal proportional to the stroke of the brake pedal, the second output signal having a magnitude within a preset error range from the first output signal, and a redundancy brake controller configured to brake the vehicle by controlling the brake according to the second braking signal based on the second output signal, in which the redundancy brake controller may be configured to brake the vehicle when the main brake controller fails, and the main brake controller may be configured to brake the vehicle when the redundancy brake controller fails.
US11866016B2
Described herein is a gas-liquid separating gas exchange device comprising a vent mechanism that services gas exchange between the interior and exterior of a housing, a shelter of the vent mechanism distal from the housing that provides shelter of a distal area around the vent mechanism, an area-encompassing abutment rising distally from the housing and encompassing both the vent mechanism and the shelter and creating a fluid-catchment junction between the shelter and the abutment, and at least one fluid-exchange passageway in the at least one shelter allowing fluid exchange between the distal sheltered area and the abutment into the fluid-catchment junction. The gas-liquid separating gas exchange device may separate gas and liquid by gravity, energy of vibration, air-pressure forces, or a combination thereof and facilitates expulsion of contaminating liquid and debris from the housing.
US11866015B2
An electro-pneumatic central pressure control module having at least a single channel, and which is implemented as a component for an electro-pneumatic service brake of a vehicle, having at least one pressure control channel which is electrically controllable with regard to a brake pressure. Also described is an electronic control device of the pressure control module having a board carrying electrical and electronic components, at least one inertial sensor being arranged on or at the at least one board and being electrically conductively connected to at least several of the electrical and electronic components on the board, in which an arrangement/apparatus ensures a lower vibration load of the inertial sensor on the board.
US11866010B2
A vehicle interior panel assembly includes an in-vehicle support substrate and a stowage tray for a mobile device. The stowage tray includes a reception surface for the mobile device, and one or more sliders configured to attach the stowage tray to the support substrate. The one or more sliders are further configured to tilt the reception surface with respect to a sowed position for the stowage tray in the support substrate. This structure for a stowage tray helps improve within vehicle integration and support more flexible usability.
US11866008B2
A vehicle having at least one vehicle access secured by a first lock and at least one secure area secured by a second lock. The vehicle may also have a receiver configured to receive a command from a remote computing system to unlock the vehicle access or the secure area.
US11866000B2
A seat-belt retractor comprising a seat-belt spindle which is rotatably mounted in a housing, an electric motor for driving the seat-belt spindle, and a gear mechanism that transmits the rotational motion from the electric motor to the seat-belt spindle, where the gear mechanism, when deactivated, can be driven as an assembly for driving the seat-belt spindle with a first torque; the seat-belt retractor has a first part, which, when a tensile force exerted by the seat-belt is exceeded, is driven in a rotational motion opposite to the rotational direction of the electric motor; and a braking device, which brakes the rotational motion of the first part, thereby actuating a blocking device blocking a second part of the gear mechanism, the blocking device activating the gear mechanism to transmit the rotational motion of the electric motor in a reduction ratio to the seat-belt spindle.
US11865996B2
A restraint system for helping to protect an occupant of a vehicle having a roof and a cabin with a seat for the occupant includes an airbag. The airbag has a stored condition within the vehicle seat and is inflatable to deploy laterally in the cabin to a deployed condition in front of the occupant. The airbag is configured to utilize the vehicle seat as a reaction surface for restraining the movement of the airbag in response to occupant penetration into the airbag.
US11865995B2
A passenger airbag (12) of a vehicle occupant restraint system (10) is assembled from a first cut piece and a second cut piece, the first cut piece being U-shaped and including a transverse leg, with two longitudinal legs projecting from the opposite ends of the transverse leg. At an inner face (56) of the transverse leg located between the longitudinal legs, a U-shaped inner fabric portion is disposed which is provided to line a module housing and which forms an inflation orifice. The second cut piece has an elongate shape and is connected, at a short lateral edge, to the inner fabric portion to circumferentially close the latter and the inflation orifice. The dimensions of the inner fabric portion are adjusted to a depth (t) of the module housing (18) such that, in the filled state of the passenger airbag (12), the inner face (56) of the first cut piece is positioned at an upper edge (80) of the module housing (18).
US11865994B2
A driver seat airbag device restrains an occupant seated in a driver seat of a vehicle, and includes, a chest protecting cushion that expands and deploys behind a yoke steering wheel; and a head protecting cushion that expands and deploys adjacent to and above the chest protecting cushion. The head protecting cushion extends from an upper portion of the chest protecting cushion to an upper surface of an instrument panel when expanded and deployed, and contacts and restrains the head of the occupant from the front.
US11865991B1
Overhead airbag cushions are disclosed suitable for installation to a vehicle having an alternative seating arrangement, e.g., “campfire” or “living room” style seating wherein vehicle seating positions face each other. The overhead airbag cushion deploys from above a vehicle seating position to be disposed to receive at least a head of an occupant of the vehicle seating position. A reaction surface of the overhead airbag cushion may engage a roof, a windshield, or other structure of the vehicle to limit deflection of the overhead airbag cushion during loading as the occupant impacts the overhead airbag cushion. Internal and/or external tethers may assist in positioning and supporting the overhead airbag cushion.
US11865987B2
An occupant protecting device provided inside or below a seat cushion of a vehicle seat, including an airbag cushion, an inflator, and a cover that covers at least a portion of the airbag cushion and is capable of being cleaved opened by the expansion and deployment of the airbag cushion. The airbag cushion has front and rear attaching points attached to the vehicle seat side as well as an expanding and deploying part that at least expands and deploys between the front and rear attaching points. The cover has a weak portion that serves as a starting point when cleaved open by expansion and deployment of the airbag cushion and is arranged on a rearward side. The cover covers the front attaching points side of the expanding and deploying part and is attached to the vehicle seat on the front attaching points side.
US11865976B2
A mount for mounting a case of a handheld electronic device to a vehicle includes an arm comprising a pair of arm members, first and second coupling member engaged with the arm for adjustably coupling the device to the vehicle, a spring and a fastener for adjustably securing the two arms together. The fastener is rotatable between a first position in which the arm members are rigidly secured together and the first and second coupling members are rigidly secured to the arm and a second position for adjusting the first coupling member and the second coupling member relative to the arm. The spring biases the arm members towards each other when the fastener is in the second position.
US11865975B2
The invention relates to a method for mounting and dismounting a telematics unit (1) in relation to a vehicle body (101), the telematics unit (1) comprising a telematics box (2) and a holding frame (3), according to which the telematics box (2) is inserted into an opening of the holding frame (3), in a pre-mounting step, and locked to the holding frame (3), and for mounting from the outside, the telematics unit (1) formed from the holding frame (3) and the telematics box (2) is inserted into a recess (102) of the vehicle body (101), adapted to the holding frame (3), and locked to the vehicle body (101). For dismounting out of the interior (106) of the vehicle body (101), the telematics box (2) is unlocked from the holding frame (3) and removed from the holding frame (3) in the interior (106).
US11865973B2
A housing for a rear view element of a rear view device for a vehicle includes a scalp portion including a first circumferential edge being c-shaped extending at least partially around an opening of the scalp portion, a lower casing portion including a second circumferential edge being c-shaped extending at least partially around an opening of the lower casing portion, and a bezel including a third circumferential edge having a lip portion extending at least partially around the bezel section.
US11865954B2
A motor vehicle seat includes a backrest portion, a first body, a second body and a mechanism configured to coupled the backrest portion to the first body in a movable manner between a first position, in which the backrest portion is arranged between the first and the second body, the latter defining a base extending crosswise to the backrest portion in order to support a passenger seating with the back resting against the backrest portion on a first surface of the backrest portion, and a second position, in which the backrest portion has a second surface opposite the first surface and facing the second body; wherein the first surface, in the second position of the backrest portion, defines a wind deflector.
US11865950B2
A seat control device for a vehicle seat of a vehicle is disclosed. The seat control device comprises a first control element which controls an electric adjustment motor for electrically adjusting the vehicle seat and/or an electric heating device for electrically heating the vehicle seat, a fluid valve which controls a fluid flow for the pneumatic adjustment of the vehicle seat, a second control element which controls an operating state of the fluid valve, and a fluid pump which is fluidically connected to the fluid valve, wherein the first control element, the second control element, the fluid valve and the fluid pump are arranged on a common circuit board.
US11865941B2
Provided is a battery management system of an electric vehicle suitable for a sharing service. A battery management system 100 includes: an electric vehicle 2 capable of travelling by driving a motor with an exchangeable battery 1; a battery station 3 capable of charging the battery 1 by adjusting a charging speed; and a management server 4 connected to the electric vehicle 2 and the battery station 3 through a communication network. The management server 4 quantitatively evaluates exchangeability of the battery 1 stored in the battery station 3, on the basis of at least a position of the electric vehicle 2 and a battery remaining amount of the battery 1 mounted on the electric vehicle 2, determines the charging speed of the battery 1 of the battery station 3, on the basis of an evaluation value of the exchangeability of the battery 1, and transmits control information relevant to the determined charging speed, to the battery station 3.
US11865940B2
An adaptive electric vehicle supply equipment (EVSE) unit provides intelligent control to vary the EVSE load placed upon the local electric connection based upon real time load measurements of both the overall premises load and the specific capacities and requirements of the EVSE. The EVSE unit includes a current power transformer at the main service entry point to capture real time power level at the meter. Additional real time current measurements are available within unit to measure the real time output power on the AC legs going to a vehicle. The unit is configured to a controller module which measure and controls the pilot signal output based on a comparison of the power level at the meter with the power level at the EVSE unit against the desired or required power output to the vehicle.
US11865926B2
An apparatus in which electric power is generated for an electrical load from differentials in electric field strengths within a vicinity of powerlines includes: a plurality of electrodes separated and electrically insulated from one another for enabling differentials in voltage resulting from differentials in electric field strength experienced there at; and electrical components electrically connected therewith and configurable to establish one or more electric circuits whereby voltage differentials cause a current to flow through the established electric circuit for powering the electrical load. Preferably, the apparatus includes a control assembly having one or more voltage-detector components configured to detected relative voltages of the electrodes; and a processor enabled to configure—based on the detected voltages and based on voltage and electric current specifications for powering the electrical load—one or more of the electrical components to establish an electric circuit for powering the electrical load.
US11865922B2
A drive arrangement for a vehicle, the drive arrangement comprising a rotatable interface arranged to be mounted to the vehicle, wherein the rotatable interface is rotatably coupled to a mounting arm to allow continuous rotation of the mounting arm in a clockwise and anti clockwise direction that is substantially perpendicular to the longitudinal and transverse axis of the vehicle; and a first electric motor having a stator and a rotor, wherein the stator is coupled to the mounting arm to allow the axis of the rotor to be substantially perpendicular to the rotational axis of the rotatable interface, wherein the rotor is arranged to be coupled to a wheel of the vehicle to allow the electric motor to provide drive torque to the wheel.
US11865921B2
A military vehicle includes a chassis, a front axle, a rear axle, an energy storage system, an engine, a transmission, and a motor. The chassis includes a passenger capsule, a front module coupled to a front end of the passenger capsule, and a rear module coupled to a rear end of the passenger capsule. The passenger capsule defines a tunnel extending longitudinally along a bottom thereof. The front module includes a front subframe assembly. The rear module includes a rear subframe assembly. The front axle is coupled to the front subframe assembly. The rear axle is coupled to the rear subframe assembly. The engine is supported by the front subframe assembly. The transmission is positioned within the tunnel and coupled to the front axle and/or the rear axle. The motor is at least partially positioned within the tunnel and positioned between the engine and the transmission.
US11865917B2
A normal information display quantity of a head-up display device is set as a first information display quantity, an information display quantity of the head-up display device after a control unit receives a detection signal of detection of installation of a mobile terminal on a terminal holder from a mobile terminal installation detection unit is set as a second information display quantity, in which the second information display quantity is set to be smaller than the first information display quantity, and at least a part of display information that is displayed in the first information display quantity but is not displayed in the second information display quantity is displayed on the mobile terminal.
US11865915B2
A three-dimensional augmented reality head-up display includes a display device functioning as a light source; and a freeform surface mirror for reflecting light from the light source onto a windshield of a vehicle. An image created by the light from the light source is focused on the ground in front of the vehicle as a virtual image of a three-dimensional perspective, through a reflection method in which the light from the light source is reflected onto the windshield by means of the freeform surface mirror.
US11865912B2
A transfer for a four wheel drive vehicle includes first and second distribution mechanisms. The first distribution mechanism includes a first clutch and is configured to distribute a portion of power from a power source to a second transmission mechanism through the first clutch. The second distribution mechanism includes a planetary gear set and a second clutch, and is configured to distribute a portion of power from the power source to a second transmission mechanism through the planetary gear set and the second clutch in order. The first and second clutches are configured to be controlled to a half-engaged state between engagement and disengagement. An input shaft of the first distribution mechanism and an input shaft of the planetary gear set are unitized.
US11865909B2
An electric car provided with a battery compartment, said electric car comprising a car body (17), a chassis (19), a power drive system, a cab (16) and a control system, the power drive system comprising a battery compartment (8), the battery compartment (8) being fixed at a lower portion of the chassis (19), the battery compartment (8) being a rectangular cavity body wherein one end is a battery inlet/outlet (8.1) and the inner side of the other end is provided with a battery connection socket (14), the rectangular cavity body being internally provided with a battery automatic push-out/guide-in apparatus, the battery inlet/outlet (8.1) of the battery compartment (8) facing towards the front, the rear or the side of the electric car, the control system controlling the battery automatic push-out/guide-in apparatus inside the battery compartment (8) to move. The battery compartment can automatically push out a battery therein, and can also automatically guide in a battery, to facilitate rapid swapping with a battery of a charging device, and increase battery loading/unloading efficiency.
US11865907B2
A truck that includes a bed section located rear of a cab section where the bed section is bounded on each side by opposing first and second upward-extending side walls, respectively. The truck includes a tonneau cover which has a first panel section pivotable with respect to the opposing first and second upward-extending side walls. A latching assembly is attached to the first panel section that selectively secures and releases the first panel section with respect to the first and second upward-extending side walls of the truck. The latching assembly includes at least one adjustable pinch latch assembly. The pinch latch assembly includes a latch handle portion and a latch base located on the first panel section adjacent the latch handle portion.
US11865902B2
The present invention reduces the generation of an unusual sound resulting from vibration of a part of a sheet. A first sheet includes: a peripheral portion which is to surround a service hole of a door inner panel; and a central portion surrounded by the peripheral portion, the first sheet having, along a boundary between the central portion and the peripheral portion, a plurality of first holes and a plurality of second holes each of which differs in size from each of the plurality of first holes.
US11865897B2
A vehicle climate system includes a blower and a controller. The controller is configured to, responsive to input of a particular user selected climate setting, operate the blower with an initial power having a predetermined value corresponding to the climate setting provided that cabin temperature is outside a predetermined range. The controller is also configured to operate the blower with an initial power having a value less than the predetermined value provided that the cabin temperature is within the predetermined range.
US11865888B2
A system for minimizing data transmission latency between a sensor and a suspension controller of a vehicle is described. The system includes: a state determination module that determines a physical state of the vehicle; a plurality of data paths for transmitting a first signal from the sensor to the suspension controller; a data path configurator of the controller that selects a first data path of the plurality of data paths based on at least one characteristic of the first data path and the physical state and configures the first data path to transmit the first signal; and an actuation module that generates an actuation signal to control a damping characteristic of the suspension actuator based on at least the first signal.
US11865884B2
A cable system for a truck trailer with connectors having a main power connection, a ground connection, and one, two, or more communication cable connections. Connectors include at least a power and ground connection for electrically connecting an individual trailer to the cable system. A master control circuit may be included in the trailer nosebox, and the master control circuit configured to send commands to slave control circuits mounted within the connectors. The slave control circuits in the connectors are configured to receive a control command sent by the master control circuit that may include an address, mode identifiers, or other indications of which connectors in the cable system should take action, and what actions should be taken.
US11865875B2
A tire high temperature forecasting system includes at least one tire that supports a vehicle, and at least one sensor mounted on the tire for measuring a temperature of the tire. An electronic memory capacity is in a unit mounted on the tire for storing tire identification information. A processor is in electronic communication with the sensor and the electronic memory capacity, in which the processor receives and correlates the measured temperature, a time of the temperature measurement, and the tire identification information. Transmission means transmit the measured temperature, a time of the temperature measurement, and the tire identification information to a remote processor. The remote processor executes a forecasting model, and the forecasting model generates a forecast estimate. If the forecast estimate includes a predicted high temperature that is greater than a predetermined high temperature threshold for the tire, an alert is generated by the forecasting model.
US11865873B2
A wheel end assembly having a spindle, a hub, and a rotary seal assembly. The spindle may have a spindle air passage. The hub may have a hub air passage and an annular hub chamber that may extend around an axis. The rotary seal assembly may fluidly connect the spindle air passage to an inlet of the annular hub chamber.
US11865860B2
A method for manufacturing a personalized or customized decorative surface (103) having decorative laminate panels (119) including the steps of: segmenting a digital image of the personalized or customized decorative surface (103) into a plurality of decorative laminate panel images (108), wherein each decorative laminate panel image (108) is sized to fit on a decorative laminate panel (119); assigning a positioning code (109) to a decorative laminate panel image (108) for identifying its position in the digital image of the personalized or customized decorative surface (103); creating a non-staggered digital layout (110) of the plurality of decorative laminate panel images (108); inkjet printing the non-staggered digital layout (110) on a substrate (112); heat pressing the inkjet printed substrate with a protective layer (115) into a decorative laminate (113); dividing the decorative laminate (113) into decorative laminate panels (119), wherein the front side of a decorative laminate panel (119) includes one of the plurality of inkjet printed decorative laminate panel images (108) and the back-side of decorative laminate panel (119) includes the positioning code (109) of the decorative laminate panel image (108) inkjet printed on the front side of the decorative laminate panel (119).
US11865856B2
Aspects of the present invention relate to an anti-fidgeting device. In an aspect, the anti-fidgeting device includes a head, or a first member, that is coupled to a writing instrument. The writing instrument extends at least partially through the first member. The anti-fidgeting device includes a body, or a second member, that is coupled to the writing instrument. The writing instrument extends at least partially through the second member. The anti-fidgeting device includes a spinning mechanism that is positioned at least partially between the first member and the second member. The writing instrument extends through the spinning mechanism. The spinning mechanism is rotatable around the writing instrument.
US11865851B2
An image forming apparatus includes: a housing; an image forming part that forms an image on a recording medium; a medium discharge part that has a space opened to an outside through a front face opening off-centered toward one of left and right on a front face of the housing and a side face opening continuous from the front face opening and in which a recording medium on which an image has been formed by the image forming part is discharged to the space; a first opening and closing covering that is opened and closed to cover a part including a part of the front face opening of the medium discharge part on the front face of the housing; and a second covering that covers at least a part excluding the part covered with the first opening and closing covering on the front face of the housing, is almost perpendicular to an installation surface, and is longer in an up-down direction than the first opening and closing covering. The first opening and closing covering is attached so that a lower end part thereof in a closed state is connected to an upper part of the second covering by an opening closing support member that supports the first opening and closing covering so as to open the first opening and closing covering toward a near side with respect to the front face of the housing by rotating about at least one moving shaft, and thereby the first opening and closing covering is openable to such an extent that a distance between a lower end part thereof in an opened state and the second covering becomes 10 mm or less.
US11865827B2
A panel has a substrate, and a top layer provided thereon. The top layer comprises at least a melamine resin and a binder. The binder is selected from the group comprising: polyacrylates based binder, polyvinyl acetate-based binder, polyester based, acrylic copolymers-based binder or urethane based binder.
US11865819B2
A plastic barrier laminate having at least one at least partially crystallized layer containing polyethylene and a nucleating agent, and at least one pigmented layer containing polyethylene and a portion of flake-shaped pigments, wherein the portion of pigments is in the range from 1.5% by weight to 5.0% by weight relative to the weight of the at least one pigmented layer.
US11865816B2
A package system is provided that includes a main body having a bilayer thermoplastic laminated film structure including a first layer and a second layer with an adhesive layer disposed between the first layer and the second layer. The main body can further include an array of holes and a removable panel disposed on the array of holes. The removable panel can include a plurality of cutouts, where each one of the cutouts corresponds to one of the holes. The removable panel can be configured to be selectively pulled off the main body.
US11865814B2
The present invention provides an aerospace or aircraft transparency which, generally, includes a cast acrylic having a conductive acrylic incorporating a conductive ionic polymer is cast thereatop and cured. In a second embodiment hereof, a stretchable acrylic formulation having a conductive polymer admixed therewith along with a minor amount of a cross-linking agent cast atop a ply of unfilled stretchable acrylic. The stack is simultaneously cured and then stretched.
US11865809B2
Disclosed herein is a method of forming a multi-layered metallic part. The method comprises stacking at least two metallic layers, each made of a metallic material having a ductility, to form a multi-layered metallic assembly. The method also comprises interposing a diffusion-bond preventing element directly between adjacent ones of the at least two metallic layers of the multi-layered metallic assembly. The method further comprises diffusion bonding the at least two metallic layers to each other at locations other than a location contiguous with the diffusion-bond preventing element to produce a multi-layered metallic part having a non-bonded region between the at least two metallic layers at the location of the diffusion-bond preventing element.
US11865803B2
Tooling assembly and pressure vessel thereof for forming composite components such as aircraft stringers and the like. In addition to the pressure vessel, the tooling assembly may include a conveying apparatus and a forming tool for stacking plies on the forming tool and conveying the plies and the forming tool through the pressure vessel. The pressure vessel includes an entrance opening and an exit opening, which are sized and shaped to permit the forming tool supporting the plies to pass through the pressure vessel. The pressure vessel may further include an interior chamber housing multiple spheres. The spheres press against the plies as the forming tool is conveyed through the pressure vessel, thereby pressure treating the plies and forming the composite part.
US11865780B2
An additive manufacturing apparatus includes a feed module and a take-up module that are configured to operably couple with a foil. A stage is configured to hold one or more cured layers of a resin that form a component. A radiant energy device is positioned opposite to the at least one stage. The radiant energy device is operable to generate and project radiant energy in a predetermined pattern. An actuator is configured to change a relative position of the at least one stage and the foil. An accumulator is positioned between the feed module and the take-up module. The accumulator is configured to retain an intermediate portion of the foil to allow a first portion of the foil upstream of the accumulator to move at a first speed and a second portion of the foil downstream of the accumulator to move at a second speed during a defined time period.
US11865779B2
An apparatus, system and method for providing a nozzle having refined print control and enhanced printing speed by providing, on the inside or outside or on an interstitial substrate layer, of any metallic or non-metallic nozzle of a non-conductive surface suitable to support sensors relevant to the FFF process. Heat, force, flow, strain, stress, extrusion force, and like sensors may be provided on the inside or the outside of any nozzle, or on an interstitial substrate layer on the inside or outside of any nozzle. The sensors may be provided about the center access through the nozzle, longitudinally along the center access of the nozzle, or at any of various points along the nozzle, wherein the placement or shape of such sensors may vary in accordance with the type of sensing to be performed by the subject sensor.
US11865773B2
A layer of additive material is formed in a circular printing area on a substrate using additive sources distributed across a printing zone. The additive sources form predetermined discrete amounts of the additive material. The substrate and the additive sources are rotated with respect to each other around a center of rotation, so that a pattern of the additive material is formed in a circular printing area on the substrate. Each additive source receives actuation waveforms at an actuation frequency that is proportional to a distance of the additive source from the center of rotation. The actuation waveforms include formation signals, with a maximum of one formation signal in each cycle of the actuation frequency. The formation signals result in the additive sources forming the predetermined discrete amounts of the additive material on the substrate.
US11865771B2
Additive manufacturing processes, systems and three-dimensional articles include the formation of voxels and/or portions of three-dimensional articles with different properties relative to other voxels and/or portions. The processes generally include changing one or more laser beam parameters including power level, exposure time, hatch spacing, point distance, velocity, and energy density during the formation of selected voxels and/or portions of the three-dimensional articles. Also disclosed are processes that include an additive manufacturing process that provides localized secondary heat treatment of certain voxels and/or regions at a temperature below the melting point of the three-dimensional article but high enough to effect a localized property change.
US11865768B2
Methods and systems for forming objects through photo-curing of a liquid resin in a tank by selective exposure (through a mask) to radiation, in which during printing operations the liquid resin in the tank is displaced relative to the build area along an axis orthogonal to that along which the object is extracted from the liquid resin in the tank. A volume of the photo-curing liquid resin may be cycled through a cooling arrangement by being extracted from the tank, cooled, and then reintroduced into the tank as printing of the object is taking place. The mask is preferably one in which charged colorant particles are dispersed in an optically transparent fluid within a plurality of bi-state cells.
US11865762B2
Provided is an apparatus for transforming plastic preforms into plastic containers having at least one transforming station which has a blow molding device, within which the plastic preforms are able to be transformed into the plastic containers by application with a flowable medium, having an application device which applies the flowable medium to the plastic preforms and having a stretching device which has a rod-like body which is able to be introduced into the plastic preforms, in order to stretch the plastic preforms at least temporarily during their transforming process in the longitudinal direction thereof, wherein the stretching device has a drive device for moving the rod-like body as well as a control device for controlling the drive device and wherein the apparatus has a valve arrangement which controls the application of the plastic preforms with the flowable medium with at least two different pressure levels.
US11865752B2
A plasticizing device includes a passage defining section that is coupled to a hopper which stores a material and that defines a supply passage to which the material is supplied from the hopper, a plasticizing section that includes an introduction portion which communicates with the supply passage, and a screw, and that plasticizes the material supplied from the introduction portion by rotation of the screw to form a molten material, and a material detection section that detects the presence or absence of the material in the supply passage.
US11865748B2
A connector with a first substantially cylindrical section having a cavity with a spring-loaded ball-snap element comprising a ball and a spring. An at least partially conically shaped section connecting the first substantially cylindrical section and a second substantially cylindrical section. The first and the second substantially cylindrical sections and the at least partially conically section define a longitudinal length extension. The first substantially cylindrical section and the second substantially cylindrical section are off-center with respect to the longitudinal length extension. A head having a hollow portion is dimensioned to receive the second substantially cylindrical section, the at least partially conically shaped section and a part of the first substantially cylindrical section. The hollow portion has an inner wall with a circular recess dimensioned to receive the ball, removably attaching the head to the second substantially cylindrical section.
US11865747B2
In general, this disclosure relates to an apparatus that compresses lightweight plastic waste (e.g., used grocery bags, empty trash bags, food wrappers, etc.), and then applies a limited amount of heat to “bake” the compressed plastic into a “brick” of plastic. The plastic is compressed, and then heated enough to cause it to retain its compressed shape, without melting or substantial outgassing.
US11865746B2
In a composite sheet manufacturing device, a second roller having a plurality of first projections and a third roller are disposed so as to be adjacent to a first roller having multiple recessed areas. The outer diameters of the first and third rollers are the same size. The third roller is joined to the first roller with a first gear pair therebetween, so as to rotate at the same rotation frequency as that of the first roller. A first sheet that is fed in between the first roller and the second roller is shaped by being pushed into the recessed areas of the first roller by the first projections of the second roller. A second sheet is then superimposed onto the first sheet and is passed through the space between the first roller and the third roller, and the first and second sheets are thereby bonded to each other.
US11865744B2
The present invention relates to a method for manufacturing a wind turbine blade part. The method comprises providing one or more wind turbine blade components including a wind turbine blade component comprising a fibre material element, an electrically conductive element, a magnetic field generator for generating an Eddy current in the electrically conductive element; arranging the electrically conductive element, the magnetic field generator, and the fibre material element such that at least a part of the fibre material element is positioned between the electrically conductive element and the magnetic field generator; generating an Eddy current in the electrically conductive element using the magnetic field generator; generating, using a magnetic sensor, a signal representing a magnetic field induced by the generated Eddy current, and forming the wind turbine blade part by assembling the wind turbine blade components.
US11865743B2
Method for injection moulding one or more parts using an injection moulding machine and tool including at least one mould cavity, and a feed system comprising at least one gate and at least one runner that is located upstream of the at least one gate. The at least one runner includes at least one moveable wall and the method includes changing at least one cross-sectional dimension of the at least one runner by moving the at least one moveable wall in order achieve at least one of to vary a flow rate of material in the at least one runner, to apply a holding pressure to material in the at least one runner and consequently to the at least one mould cavity, or to compress residue in the at least one runner.
US11865742B2
According to the present invention there is provided a preform suitable for subsequent blow molding, and a mold stock for producing the preform. The preform comprises a base having an elliptical inner face with a first flat circular bottom portion, and an elliptical outer face with a second flat circular bottom portion. The first and second flat circular bottom portions each have a center on a vertical center axis of the preform and a radius of equal size.
US11865738B2
A frangibility device for creating a preferred breakage plane or weakness within cured columns such as rigid inclusions (RIs) and/or vibratory concrete columns (VCCs) comprises a cutting disc, an elongate strut attached to the center of the disc, and a detachable handle for turning. The disc comprises a thin geometric plate slit from center to periphery, so that a slicing wing can be bent downward at a shallow angle from the slit. The slicing wing advances the cutting disc through the cementious material of the uncured column. When the disc reaches the desired depth, the handle is removed and both disc and strut are left in place during curing.
US11865736B2
The invention relates to a perforating device for thermoplastic plates, which relates to the technical field of a plate processing device. The device includes an electromagnetic chuck, one side of the electromagnetic chuck is connected with the driving member, the other side of the electromagnetic chuck is connected with a mounting plate and a spike. When the electromagnetic chuck is powered on, the spike is attracted below the mounting plate by an electromagnetic force generated by the electromagnetic chuck. A clamper is arranged below the mounting plate, the thermoplastic plate is fixed by the damper, and a heating system is also provided to heat the thermoplastic plate. As the electromagnetic chuck is powered on or off, the spike can be attracted in or separated from the mounting plate, respectively. Therefore, the perforating device can make a new plate be pierced during the cooling and curing process of the perforated plate.
US11865718B2
A working device includes a link actuation device and a control device for the link actuation device. The control device includes: a storage unit configured to store a plurality of the target positions; a calculation unit configured to sequentially read out the respective target positions stored to calculate movement amounts and movement speeds of the respective actuators between the target positions; and a control unit configured to operate the respective actuators by the movement amounts and at the movement speeds of the respective actuators calculated by the calculation unit. The control unit is capable of changing acceleration and deceleration times of the actuators for each of the target positions.
US11865716B2
A system forms a part in an initial geometry (e.g., a sheet) into a desired geometry. The system includes a robot arm with an end effector, a model and a controller. The model receives an input geometry and an input parameter value indicating an interaction between the part and the end effector. The model determines an output geometry of the part based on the input geometry and the input parameter value. The controller receives the initial and desired geometries; applies the model to the initial geometry and to different input parameter values; based on output geometries of the model, determines a set of parameter values for controlling the robot arm; and controls the robot arm according to the determined set of parameter values to form the part into the desired geometry using the end effector.
US11865714B2
An apparatus for a robotic limb includes one or more limb segments connected via one or more joints. The robotic limb may feature one or more dual-reduction quasi-quasi-direct-drive joint actuators that permit the robotic limb to move throughout a scene. The robotic limb may further include an end-effector connected to a free end of the robotic limb with one or more opposable fingers comprising a four bar linkage. The end-effector may include a main actuator that actuates the one or more fingers via the four-bar linkages to complete various tasks.
