The systems and methods presented herein provide for the testing of calibration processing within a print controller. In one embodiment, a method provides for testing a printer calibration module. The method includes simulating an optical density response of the printer to generate a plurality of optical density curves for the printer and determining spectral reflectance values for corresponding optical density values in the optical density curves. The method also includes processing the spectral reflectance values via the printer calibration module to generate a calibration output. The method also includes analyzing the calibration output to determine accuracy of the printer calibration module.
An inverse transfer function is computed from a forward transfer function of an image rendering device. During the computation, device-dependent values are extrapolated for border nodes. The extrapolated values are out-of-gamut.
An image processing system includes an image forming apparatus and first and second image processing servers connected to the image forming apparatus via a network, the first image processing server includes: a first image processor which performs a first image processing operation on target image data received from the image forming apparatus; and a protected area calculator which calculates a protected area to be prohibited from being processed next, which is related to the area processed by the first image processor, and generates image protection information including information of the protected area, and the second image processing server includes a second image processor which performs a second image processing operation on the areas excluding the protected area whose information is included in the image protection information generated by the protected area calculator.
Disclosed is an image forming system including a series tandem configuration in which a plurality of image forming apparatuses are linked and the plurality of image forming apparatuses each form an image of a different printing face to perform a job, the system including: a storage section which is provided in each of the image forming apparatuses and which stores job data and image data regarding all pages of the job; and a control section which is provided in each of the image forming apparatuses, and which reads out job data and image data of an already performed job from the storage section, and performs control of performing the job again based on the read out job data and image data.
Disclosed is an image forming apparatus including a plurality of components, a display section to display information of the components, a storage section to store replacing person information of the components and a control section to make the information of the components which are displayed in the display section be different according to the replacing person information of the components.
A scanner, an image forming apparatus including the same, an image processing method of the scanner and a printing method of the image forming apparatus. The image processing method includes acquiring an environment image, acquiring a main scan image by scanning a document on a flatbed, and extracting a document image from the main scan image using the environment image when the document is scanned with the cover in an open position.
A computer generated method disclosed. The method includes performing an exact comparison between a first bitmap and a second bitmap, calculating a number of miscompared pixels that occurred during the comparison and calculating a quantity value representing a characteristic of the miscompared pixels.
An image scanning system includes (1) an image scanning device, which includes an input unit configured to acquire an instruction by a user, an image scanner configured to scan an image and generate image data and a transmitting unit configured to transmit the image data; (2) a display lock judging unit configured to judge whether a display lock is necessary based on whether a predetermined instruction is acquired by the input unit; and (3) a data processing device which includes a first reception unit configured to receive the image data transmitted by the transmitting unit of the image scanning device, a first display unit configured to display the image data received by the first reception unit and a display control unit configured to control the first display unit so as not to display the image data if the display lock judging unit judges that the display lock is necessary.
A multi-function printer (MFP) is provided, which includes a user interface, a storage unit, a network module and a control module. The user interface is served as an input interface and a display interface of the MFP. The storage unit stores address information and at least one really simple syndication (RSS) message of at least one subscription website on the Internet. The network module enables the MFP to have network connectivity. The control module is served as an operation core of the MFP, and has a built-in RSS reader. The control module is periodically connected to the subscription website through the network module according to the address information of the subscription website, and reads the at least one RSS message of the subscription website through the RSS reader for storing into the storage unit and further displaying the at least one stored RSS message on the user interface.
A method for generating a hardcopy document, including: receiving, by a printer, a direct print request for an Office Open XML (OOXML) document having a plurality of pages; identifying, by the printer, a tag in the OOXML document specifying a multiple page printing feature (MPPF) for the plurality of pages, where the tag is located within a settings.xml file of the OOXML document; identifying, by the printer, a first printer setting required to implement the MPPF; invoking, by the printer, the first printer setting on the printer; and generating, by the printer and from the OOXML document, the hardcopy document with the MPPF feature after invoking the first printer setting.
Attachment of a USB memory is sensed and whether the USB memory can be recognized or not is determined based on data information output from the USB memory. When the USB memory cannot be recognized, an emulation transition screen is displayed. Thereafter, when an instruction to start transition to an emulation mode is given, an emulation mode transition instruction signal and an IP address of an MFP on a network are output. Receiving the input of the emulation mode transition instruction signal, an emulation mode start-up/end unit starts up the emulation mode.
An optical imaging system includes an optical radiation source, a frequency clock module outputting frequency clock signals, an optical interferometer, a data acquisition (DAQ) device triggered by the frequency clock signals, and a computer to perform multi-dimensional optical imaging of the samples. The frequency clock signals are processed by software or hardware to produce a record containing frequency-time relationship of the optical radiation source to externally clock the sampling process of the DAQ device. The system may employ over-sampling and various digital signal processing methods to improve image quality. The system further includes multiple stages of routers connecting the light source with a plurality of interferometers and a DAQ system externally clocked by frequency clock signals to perform high-speed multi-channel optical imaging of samples.
The invention relates to a method and device for determining the static and/or dynamic scattering of light. In the method, a plurality of different zones within a sample vessel (6) is illuminated during various time periods, wherein light is scattered on the sample. The scattered light is detected by means of a plurality of detectors (11, 12, 13, 14), wherein during the implementation of the method each detector captures scattered light from a plurality of different zones, and during a time period each detector detects scattered light from one zone and generates a signal. Said signals are transmitted to an electronic evaluation unit and are processed by said unit, wherein in each case those signals which are generated by the same detector and result from the detection of scattered light from the same zone are processed together.
Measurement cannot be made when trying to measure a wavefront aberration of a wide-angle lens, being wide in a field of view, comparing to a focus distance, by a Shack-Hartmann sensor, since an inclination of the wavefront exceeds an allowable value of inclination of the Shack-Hartmann sensor. The Shack-Hartmann sensor is inclined at a position of a pupil of a lens, and is controlled so that it lies within the allowable value mentioned above. Photographing is made through step & repeat while overlapping at the same position, to compose in such a manner that overlapping spots are piled up, and thereby measuring the wavefront aberration of the lens having a large pupil diameter.
A microlithographic illumination system can include a light distribution device that can generate a two-dimensional intensity distribution in a first illumination plane. A first raster array of optical raster elements can generates a raster array of secondary light sources. A device with an additional optical effect can be disposed spatially adjacent to the two raster arrays. The device can be configured as an illumination angle variation device. The device can influence the intensity and/or the phase and/or the beam direction of the illumination light. The influence can be such that an intensity contribution of raster elements to the total illumination intensity can vary across the illumination field. This can enable the illumination intensity to be influenced across the illumination field in a defined manner with respect to the total illumination intensity and/or with respect to the intensity contributions from different directions of illumination.
A liquid crystal display includes a first insulation substrate, a plurality of gate lines and a plurality of data lines disposed on the first insulation substrate, a plurality of thin film transistors connected to the plurality of gate lines and the plurality of data lines, a plurality of pixel electrodes connected to the plurality of thin film transistors, a second insulation substrate disposed substantially opposite to the first insulation substrate; a plurality of column spacers disposed between the first and second insulation substrates and which supports the first and second insulation substrates, a light blocking member disposed on the first insulation substrate and including a sheet portion which includes an opening, a height controlling member disposed at the opening of the sheet portion of the light blocking member, where the plurality of column spacers is disposed on the height controlling member or the light blocking member.
An electro-optic device includes: an electro-optic panel; a first flexible printed circuit; a second flexible printed circuit; and a conductive section. Each of the first flexible printed circuit and the second flexible printed circuit has a structure in which a reference potential layer and a signal potential layer are laminated after being insulated from each other, the reference potential layer applying a reference potential to the electro-optic panel, the signal potential layer applying a signal potential to the electro-optic panel, and the first flexible printed circuit and the second flexible printed circuit each having an opening in which a part of the reference potential layer is exposed. The conductive section electrically connects the part exposed in the opening of the reference potential layer in the first flexible printed circuit and the part exposed in the opening of the reference potential layer in the second flexible printed circuit to each other.
A method for the control of a liquid crystal display that includes a matrix of pixels arranged in crossed lines and columns. A switching of state of the liquid crystal molecules, is controlled by application of an electrical control signal between two electrodes (50, 52) framing each pixel, generates a flow according to a particular direction (18), characterized in that, to control the switching of at least some of the pixels (P). The method includes applying to at least one neighboring pixel (58), according to the direction of flow, of a pixel (P) whose switching is controlled by the electrical control signal, auxiliary electrical signals whose amplitude is less than the anchorage breaking voltage and whose rising or falling edges are temporally placed in advance or in coincidence with the active falling edge of the electrical control signal, to favor the switching of the said pixel to be controlled (P).
A connector for a light source module includes a body portion and a terminal portion. The body portion includes a first opening portion and a second opening portion. The first opening portion receives a portion of the light source module. The second opening portion receives a portion of a light source driver which drives the light source module. The terminal portion includes a first terminal and a second terminal. The first terminal is in the first opening portion of the body portion. The second terminal is connected to the first terminal. The second terminal is in the second opening portion of the body portion.
In a method for manufacturing a liquid crystal display device in which a liquid crystal layer is formed by dropping liquid crystal by a dropping method, a surface of a sealant which is formed over a first substrate is cured by a first cure treatment before dropping the liquid crystal, and then the liquid crystal is dropped. A second substrate has a plurality of projections in a sealant adhesive region. The first substrate and the second substrate are attached to each other with the liquid crystal interposed therebetween so that the plurality of projections is in contact with an uncured region in the sealant formed over the first substrate.
A deployment system for user interface devices with enhanced interface capabilities and methods for manufacturing and using same. The deployment system includes a main rotating joint system and a device mounting assembly that are coupled via an extension support system. The main rotating joint system enables the deployment system to be installed at any suitable installation location, such as an armrest; whereas, the device mounting assembly is configured to receive a selected user interface device. Advantageously, the deployment system provides an enlarged internal channel for accommodating larger communication cables and a progressive clutch system for supporting the increased weight of the user interface devices. The deployment system thereby can maintain near-constant tension during deployment of the user interface devices, inhibiting drop injuries to users and damage to the user interface devices.
An image display device and method may be provided for pairing with a remote control device for transmitting a command to the image display device. Upon power-on, the image display device may be paired with the remote control device. When the image display device is power-on, a guide screen may be displayed to indicate how to pair the image display device with the remote control device. A user may easily pair the remote control device with the image display device through the pairing guide screen.
The present invention discloses an apparatus a television apparatus capable of showing, on a screen, a menu screen and an input switching screen instead of an image display screen, while being capable of changing setting data through a remote controller operation, comprising: an operation history recording unit configured to record operation instructions to the television apparatus as the items of an operation history; and a unit for returning from erroneous operation configured to be started up by the panic key mounted on the remote controller and perform a return movement from erroneous operations so as to return the setting of the television apparatus to the state corresponding to the item of the operation history recorded before the panic key operation by the operation history recording unit.
An apparatus for transmitting broadcasting content including a control signal in a broadcasting network, the apparatus includes: a modulator configured to modulate broadcasting content by a predetermined modulation method; a control signal generator configured to generate a control signal for remote control of infrastructure; an adder configured to add the control signal to the modulated broadcasting content; and a DTV transmitter configured to convert the added signal to a DTV broadcasting signal and transmit the DTV broadcasting signal.
Disclosed herein is a video processing apparatus for performing video processing compatible with a dual link progressive scheme, said video processing apparatus including: two video processing circuits; and a control section.
A wireless audio-video (AV) transmission module is to be disposed in an AV source device. The AV source device includes an AV source unit for generating an AV signal. The wireless AV transmission module includes a video scaler unit and a wireless transmission unit. The video scaler unit is to be coupled electrically to the AV source unit, upscales a video signal of the AV signal from the AV source unit, and outputs an upscaled AV signal including the upscaled video signal. The wireless transmission unit is coupled electrically to the video scaler unit and wirelessly transmits the upscaled AV signal that includes the upscaled video signal.
An imaging optical system, an imaging device, and a digital apparatus have a four lens construction with positive, negative, positive, and negative refractive powers. A surface position at the maximum effective diameter of the second lens element is located on the object side than a surface vertex thereof. The fourth lens element has an inflection point at a position other than the intersection of the optical axis and the fourth lens element. The optical system satisfies the following conditions. 0.772 ν4>50, and 0.55
An imaging system may include an array of lenses, each of which is aligned over a respective one of a plurality of imaging pixels. The array of lenses may be formed in two layers. The first layer may include a first set of non-adjacent lenses and centering structures between the first lenses. The centering structures may be aligned with the first set of lenses as part of a mask design with a high level of accuracy. The second layer may include a second set of lenses, each of which is formed on a respective one of the centering structures. Forming the second set of lenses may include a reflow process in which surface tension forces center the second set of lenses on their respective centering structures, thereby aligning the second set of lenses with the first set of lenses with a high level of accuracy.
An apparatus and method to generate a thumbnail image in a moving image photographing mode, and storing the generated thumbnail image are disclosed. The apparatus to photograph the thumbnail image generates a thumbnail image at intervals of a predetermined time simultaneously with photographing the moving image. In addition, the apparatus selects a thumbnail image to be preserved and a thumbnail image to deleted from among generated thumbnail images in such a manner that the number of generated thumbnail images does not exceed a predetermined number, thereby limiting the number of generated thumbnail images.
This image display apparatus includes a display unit that displays at least an image, an operation input unit that is divided into a plurality of areas, predetermined operations being assigned to the respective areas, and a control unit that displays an operation manual screen on the display unit for a predetermined time when a full-screen display process starts, that presents content of the operations assigned to the respective areas of the operation input unit by the screen, and that performs control to perform, when one of the areas is pressed, the operation assigned to the area.
Disclosed are a pixel, a pixel array, an image sensor including the pixel array and a method for operating the image sensor. The pixel includes a photo-electro conversion unit; a capacitor for storing charges converted by the photo-electro conversion unit; an output switching device for outputting an electric potential of the capacitor; and a removal unit for removing a part of the charges converted by the photo-electro conversion unit.
Solid-state image sensing elements p and q arranged on an image sensor at a higher density than other solid-state image sensing elements are configured so that the focus error amount due to the axial chromatic aberration of an imaging lens between the solid-state image sensing elements p and q is equal to or larger than an amount corresponding to the depth of focus in a maximum aperture. Also, the imaging lens has a f-number which allows the focus error amount to fall within the range between the two ends of the depth of focus.
A solid-state imaging device includes: photodiodes formed for pixels arranged on a light sensing surface of a semiconductor substrate; a signal reading unit formed on the semiconductor substrate to read a signal charge or a voltage; an insulating film formed on the semiconductor substrate and including optical waveguides; color filters formed on the insulating film; and on-chip lenses formed on the color filters. The first and second pixel combinations are alternately arranged both in the horizontal and vertical directions, the first pixel combination having a layout in which two green pixels are arranged both in the horizontal and vertical directions and a total of four pixels are arranged, the second pixel combination having a layout in which two pixels are arranged both in the horizontal and vertical directions, a total of four pixels are arranged, and two red pixels and two blue pixels are arranged cater cornered.
Various systems and methods are provided to implement a flexible approach to the remote control of camera systems. For example, camera systems and related methods may be implemented to recognize a protocol that supports a multi-tiered configuration of camera system components. In one example, routing tables may be maintained at various tiers of a camera system to facilitate the selective routing or execution of commands at different tiers in a hierarchical manner. In one example, the routing tables may be dynamically built and may include routing information related to lower level tiers but not higher level tiers.
An electronic mirror includes a first display section, a second display sections and a half mirror disposed between the display sections. The first display section displays a surrounding image captured by an imaging device in a display region. The second display section displays a frame image that has a shape taken along an outer periphery of the display region. A distance between the first display section and a point of the half mirror is greater than a distance between the second display section and the point the half mirror so that the frame image is offset relative to the outer periphery of the surrounding image when viewed in the half mirror.
To overcome problems with vergence, a binocular head mounted display (HMD) is used in a simulator in which an out-the-window scene is displayed in real time on a screen arrangement. Imagery for the left and right eyes of the HMD is derived by generating a starting HMD image for a Cyclops viewpoint between the user's eves, and then rendering respective views for each eve from the position of the eye in a virtual 3D model of the screen arrangement, wherein the starting HMD image is frustum projected against the screen arrangement of the 3D model.
An image display apparatus for displaying an image of an object on a screen by using a projector includes a three-dimensional image display unit having a plurality of screens overlaid but spaced apart from one another, each of the screens diffusing and reflecting part of the light incident thereon and transmitting the remainder of the light, and an image projection unit having a plurality of projectors, each of the projectors is assigned to the corresponding one of the screens and projects an image of the object on the screen. The image projection unit displays a three-dimensional image of the object in the three-dimensional image display unit by projecting on the screens the shapes of the object in sectioning positions corresponding to the positions of the screens.
A method for transmitting a three-dimensional (3D) caption signal and caption display method are disclosed to three-dimensionally display caption text such that it fits a 3D image in a 3D display device. 3D caption box configuration information and caption text are generated to display a 3D caption within a 3D image, and the 3D caption box configuration information and the caption text are inserted into a video picture header region to code the image signal, and then, the image signal is transmitted. In the caption display method, a broadcast signal including a 3D image signal is received, and 3D caption box configuration information and caption text included in the broadcast signal are acquired. A caption image including 3D caption text disposed within a 3D caption box is then generated based on the 3D caption box configuration information and the caption text, and displayed.
One or more horizontal stripes are defined in a continuous presence video conferencing image, comprising one or more segments of the video image. The horizontal stripes may have different heights. A horizontal stripe builder associated with a continuous presence videoconferencing port composes and compresses the horizontal stripe from two or more video images received from a plurality of endpoints of the video conferencing system. A continuous presence image stream generator organizes compressed horizontal strips into a plurality of compressed continuous presence video streams for sending toward sites of the video conferencing system.
System and method for performing a videoconference. The videoconference may be established between at least three videoconferencing locations. Each videoconferencing location may include respective pluralities of displays, video inputs, and videoconferencing units. A first videoconferencing unit at a first videoconferencing location may receive an indication that there is an active talker at the first videoconferencing location. An indication that there is an active talker at the first videoconferencing location may also be provided to a second videoconferencing unit at the first videoconferencing location. The first and second videoconferencing units may provide signals to corresponding videoconferencing units at second and third videoconferencing locations indicating that videoconferencing signals from the first videoconferencing location should be displayed. The second and third videoconferencing locations may switch to display videoconferencing signals from the first videoconferencing location based on the signals which indicate that videoconferencing signals from the first videoconferencing location should be displayed.
A videoconferencing system which encodes different streams of information. The information may include video, audio, speech recognized versions of the audio, and language translated versions of the audio. Text may be sent as part of the videoconference.
A force measurement system having a displaceable force measurement assembly includes: a force measurement assembly with a surface configured to receive a subject, and having at least one force transducer; at least one actuator operatively coupled to the force measurement assembly, the at least one actuator configured to displace the force measurement assembly; at least one visual display device having an output screen, the at least one visual display device configured to display one or more virtual reality scenes on the output screen so as to create a simulated environment for the subject; and one or more data processing devices operatively coupled to the force measurement assembly, the at least one actuator, and the at least one visual display device. In one or more embodiments, a method for testing a subject disposed on a displaceable force measurement assembly is further disclosed.
A transform model is established by the calibration system for color transformation between a first color space and a second color space. Three first target curves are defined and transformed by the transform model so as to establish three look-up tables. The display is calibrated according to the three look-up tables such that the color temperature of the display may be substantially constant for every gray-level.
In embodiments of power saving field sequential color (FSC), an illumination source illuminates pixels of a displayable image by sequentially generating RGB (red, green, blue) components of a pixel in a timed sequence of field sequential color. The pixels of a displayable image may also include a white component derived from the RGB components. An illumination reduction algorithm is implemented to determine the highest RGB (or RGBW) components from any of the pixels of the displayable image. The highest RGB (or RGBW) components can be determined from any combination of the same or different pixels of the displayable image. The illumination reduction algorithm then divides each of the highest RGB (or RGBW) components by a maximum brightness value to generate respective RGB (or RGBW) component factors. A display controller then processes each pixel of the displayable image for display according to the RGB (or RGBW) component factors.
A sink device having a display panel capable of performing a video frame self-refresh as directed by a source device is described. A source determines that a video frame will persist (i.e., remain the same). In this situation, the frame data does not need to be repeatedly transmitted over a main link between the source and sink devices. The main link can be turned off and transmission can cease for a certain time thereby reducing power usage by the devices or system as a whole. The source ensures that the last frame transmitted to the sink is correct by performing CRC checks and then instructs the sink, via certain bit settings in a video status indication symbol, to store the last transmitted frame in the sink's local buffer and use that frame to refresh the panel. The source can then disable the self-refresh when the frame changes.
One embodiment of the present invention sets forth a technique for parallel distribution of primitives to multiple rasterizers. Multiple, independent geometry units perform geometry processing concurrently on different graphics primitives. A primitive distribution scheme delivers primitives from the multiple geometry units concurrently to multiple rasterizers at rates of multiple primitives per clock. The multiple, independent rasterizer units perform rasterization concurrently on one or more graphics primitives, enabling the rendering of multiple primitives per system clock.
A method for synchronizing an input data stream with an output data stream in a video processor. The method includes receiving an input data stream and receiving an output data stream, wherein the input data stream and the output data stream each comprise a plurality of pixels. The method further includes sequentially storing pixels of the input data stream using an input buffer and sequentially storing pixels of the output data stream using an output buffer. Timing information is determined by examining the input data stream and the output data stream. A synchronization adjustment is applied to the input buffer and the output buffer in accordance with the timing information. Pixels are output from the input buffer and the output buffer to produce a synchronized mixed video output stream.
A model is associated with a deep pose. When the model is changed from an attractor pose to a current pose, the current pose and the attractor pose are compared with the deep pose. If any portion of the current pose is more similar to the deep pose than the attractor pose, then the attractor pose is updated. A portion of the attractor pose may be set to the corresponding portion of the current pose. The attractor pose may be modified by a function. Pose attributes of each pose degrees of freedom for the attractor pose, the current pose, and the deep pose may be evaluated to potentially modify all or a portion of the attractor pose. The attractor pose and pose constraints are used to determine a pose of the model, for example by an optimization process based on the attractor pose while satisfying pose constraints.
An interactive multi-mesh modeling system allows users to employ a variety of modeling techniques to interactively create objects for a variety of different tasks or tools. Some of these different tasks or tools can have requirements for computer-generated representations of objects on which they operate. These requirements may differ from how some computer-generated representations were originally created (e.g., 3D solid objects output using solid modeling techniques vs. 2D flat “panel constructed” objects required for some computer simulations). Thus, the interactive multi-mesh modeling system may further employ a variety of techniques for taking a source computer-generated representation of an object and providing the automatic creation, management, and maintenance of instances or versions of the source. The interactive multi-mesh modeling system may further employ a variety of techniques for the automatic management and transfer of information defined thereon or associated with these meshes.
There is provided a display device capable of displaying an image that barely changes with low power consumption on the basis of video data included in a transmitted command, and there is also provided a method for driving the same. A display timing controller (31) determines every frame period whether or not an externally transmitted command includes updated video data. As a result, when it is determined that no updated video data is included, screen refreshing is paused by not reading video data stored in frame memory (36). Moreover, when it is determined that updated video data is included, the screen refreshing is performed by reading video data stored in the frame memory (36).
A driving control apparatus and method for use with a display array are provided. The display array comprises a plurality of pixel areas arranged in an array configuration. The driving control apparatus comprises a system control circuit and a drive circuit. The system control circuit is adapted to detect an activation signal and determine an enabling period after the detection. The drive circuit is adapted to control the activation of the display array. The drive circuit comprises a plurality of scan lines and data lines. During the enabling period, each of the scan lines activates part of the pixel areas while each of the data lines transmit a voltage to the activated pixel area so that at least a part of the activated pixels corresponds to a predetermined luminance. The driving control method comprises steps for implementing the driving control apparatus.
A light sensing circuit, a method of controlling the same, and a touch panel including the light sensing circuit. In the method of controlling the light sensing circuit, including sensing light incident on a photodiode, generating current corresponding to the brightness of the sensed light, amplifying the current using a driving transistor, and outputting the amplified current, the ambient temperature is sensed, and a time period during which the light is sensed by the photodiode or the amplified current is output is controlled by the sensed ambient temperature. Thus, the sensitivity of the light sensing circuit may be constantly maintained without being influenced by the ambient temperature.
The present invention provides an active matrix image display apparatus including an organic EL element capable of efficiently arranging a wiring pattern on an insulating substrate compared to the related art. The present invention provides a dummy region arranged at the outermost periphery of a display unit as a scanning line coupling region or a pitch conversion region. A power supply scanning line is commonly used by a pixel circuit of an odd-numbered line and a pixel circuit of a following even-numbered line.
There is provided a decoder in which a matrix of transistors, a plurality of reference voltage signal lines arranged on a first interconnect layer and extended in a row direction, being separated to one another over the matrix, and a plurality of reference voltage signal lines arranged on a second interconnect layer and extended in the row direction, being separated to one another over the matrix. The reference voltage signal lines on the mutually different layers are respectively connected to impurity diffusion layers of the transistors that are adjacent in the row direction. The reference voltage signal lines on the mutually different layers are respectively connected to the impurity diffusion layers of the transistors that are adjacent in a column direction.
A display apparatus and display method are provided. The display apparatus capable of displaying an image and receiving light simultaneously or alternately, the display apparatus including: a plurality of display devices laid out to form a matrix; a plurality of light receiving devices for receiving light hitting a display screen; a received-light image generation unit for generating image data representing the state of a substance brought into contact with the display screen or brought to a position in close proximity to the display screen; an image processing/evaluating unit for evaluating the position and size of a substance as well as evaluating changes in the position and in the size; and a command determination unit for recognizing a command entered by an operator. In the display apparatus, predetermined processing according to a command recognized by the command determination unit is carried out.
A touch display apparatus including a light guide plate, a light emitting module, a display panel, a plurality of prism structures, an image transmission unit, and an image detector is provided. The light guide plate has a first surface, a second surface opposite to the first surface, and a light incident surface connecting the first surface and the second surface. The light emitting module includes at least one visible light source and at least one invisible light source. The prism structures are disposed between the first surface and the display panel. The image transmission unit includes a wedge portion and a light guide portion. The wedge portion is disposed between the prism structures and the display panel. The image detector is disposed beside the light guide portion for receiving the invisible light beam from the light guide portion. A backlight module is also provided.
A liquid crystal display (LCD) with a built-in touch screen includes: a first substrate including a pixel area having a plurality of pixels and a sensor area having a plurality of photosensors; a second substrate positioned over the first substrate, and including a color filter, a light receiving portion, a transparent electrode layer, and a front polarizing plate; an LCD panel including a liquid crystal layer interposed between the first and second substrates; and a touch screen driver circuit to sense a capacitance variation provided through a first sensing line connected to the transparent electrode layer when an object is in contact with the LCD panel, and to output position information of the object, sensed by using optical information sensed through a second sensing line connected the plurality of photosensors when the capacitance variation is greater than or equal to a predetermined threshold value.
An electronic device, a method for viewing a desktop thereof, and a computer-readable medium are provided. One of n continuous areas of the desktop and a navigation bar are displayed in a touch screen of the electronic device. The navigation bar includes an indicator and n indexes, wherein the n indexes are respectively corresponding to the n areas, and the indicator points to the index corresponding to the area currently displayed in the touch screen. When a sliding operation applied to the indicator is detected on the navigation bar, the desktop and the indicator are moved according to the sliding operation. When the sliding operation terminates, an index closest to the indicator is selected from the n indexes as a target index. Finally, the indicator is controlled to point to the target index, and a target area corresponding to the target index is displayed in the touch screen.
An information processing apparatus includes a first touch panel, a second touch panel, a touch sensor, and a controller. The first touch panel displays an object and detects a first touch operation of a user on the object. The second touch panel detects a second touch operation of the user. The touch sensor is provided between the first touch panel and the second touch panel and detects a third touch operation of the user. The controller moves the object displayed on the first touch panel in accordance with the first touch operation, and displays the object on the second touch panel when the third touch operation is detected within a first time period since the first touch operation has become undetected and the second touch operation is detected within a second time period since the third touch operation is detected.
Two different sets of electrodes in a touch sensitive device are formed to produce an electric field gradient from one end of the electrodes to the other end when opposite ends of the electrodes are driven with different voltages. A signal measuring cycle is performed by alternately driving the ends of one set of electrodes, while using the other set of electrodes to receive signals. The roles of the sets of electrodes are then reversed, such that the set that that was driven is now used to receive signals from the other set of electrodes. Reference signals may be obtained by driving both sides of one set of electrodes, and then both sides of the other set of electrodes. The signals obtained are then used to determine the touch position on the touch sensitive device.
A mobile terminal is presented. The mobile terminal includes a touchscreen for displaying an object, an output unit for outputting a vibration when the object is selected and moved along a display area of the touchscreen, and a control unit for controlling a characteristic of the vibration according to at least one of an attribute of the object, an attribute of the display area, or a combination thereof.
In some embodiments, a touchscreen may display a graphical user interface with one or more input options and may detect which input options are selected by a user by detecting a user's contact on the touchscreen. The system may determine a new graphical user interface configuration to increase the size and/or spacing of the input options. In some embodiments, one or more of the input options may be removed to increase the space available to increase the size of the other input options. In some embodiments, the system may maintain a history of input option use to determine which input options to remove. In some embodiments, the new graphical user interface configuration may include smaller (and/or additional) input options (e.g., if the contact areas are detected as consistently within the displayed input options).
Methods, systems, and apparatus, including computer program products, in which an input method editor receives input in a first writing system and presents input candidates in the first writing system or a second writing system. In one implementation, a method is provided. The method includes receiving input in a first writing system; presenting the input in the first writing system in a first interface element of an interface as content input; automatically identifying one or more candidates in a second writing system based on the input in the first writing system; and presenting the one or more candidates in the second writing system in a second interface element that is separate from the first interface element.
A method for driving a display cell filled with an electrophoretic fluid comprising two types of pigment particles carrying opposite charge polarities and of two contrast colors wherein said two types of pigment particles are dispersed in a solvent of a color, which method comprises driving said display cell to a color state which color is the color of the solvent by applying a driving voltage which is about 1 to about 20% of the full driving voltage.
An electrophoretic display includes a display area where images are displayed, and an edge area around the display area and where a single color is displayed. The display area includes a plurality of display pixels which include gate lines on a first substrate, data lines intersecting the gate lines, thin film transistors connected to the gate lines and data lines, display pixel electrodes on the first substrate and connected to the thin film transistors, a common electrode on a second substrate and facing the first substrate, and an electronic ink layer between the display pixel electrodes and the common electrode The edge area includes a plurality of edge pixels which include edge pixel electrodes in a same shape as the display pixel electrodes.
A system for powering and controlling an LED-backlit liquid crystal display (LCD) where redundancy is used to provide two independent paths from a pair of power supplies to the LED backlight. Further, two independent paths are also used from a pair of power supplies to the LCD. If any one of the paths were to fail or begin to degrade in performance, the system contains monitoring circuits which can direct another path to be used by the system. Two separate control circuits for the LCD may be used so that either one may be used to control the LCD if one were to fail. Two separate temperature sensors and luminance sensors may also be used to increase the durability of the system.
A control apparatus for controlling a three-dimensional (3D) display apparatus includes: an image processing unit to receive an image source signal and convert the image source signal to an interval signal. The interval signal is defined as a first timing interval and a second timing interval. A backlight control device, coupled to the image processing unit, receives the interval signal and generates a plurality of backlight control signals according to the interval signal. A backlight device, coupled to the backlight control device, receives the plurality of backlight control signals and provides a lighting source to a display device during the first timing interval and/or the second timing interval according to the plurality of backlight control signals.
A display apparatus includes a display panel which receives a light, a backlight which provides the light to the display panel in response to a driving voltage, and a backlight driver which applies the driving voltage to the backlight. The backlight is turned on and off during a communication period to transmit data to an external receiver using visible light communication during the communication period. The backlight driver controls a voltage level of the driving voltage according to a number of turn-on periods of the driving voltage during the communication period.
A line-on-glass liquid crystal display device includes data lines for supplying data signals to drive sub-pixel units on a substrate, gate lines for supplying gate signals, and a gate low voltage stabilization circuit connected to a gate low voltage line from a data printed circuit board for applying a gate low voltage signal to the sub-pixel units.
A display device capable of obtaining a constant luminance without being influenced by temperature change is provided as well as a method of driving the display device. A current mirror circuit composed of a first transistor and a second transistor is provided in each pixel. The first transistor and second transistor of the current mirror circuit are connected such that their drain currents are kept almost equal irrespective of the level of load resistance. By controlling the OLED drive current using the current mirror circuit, a change in OLED drive current due to fluctuation in characteristics between transistors is avoided and a constant luminance is obtained without being influenced by temperature change.
Techniques for watching a location of a device with respect to a destination target include obtaining a current location of a device from a localization operation, calculating an interval, and performing a next localization operation after the interval has expired. The interval may be calculated based on a velocity and a distance from the current location to a destination target. The techniques may also include calculating a displacement distance from the current location and adjusting the interval based on the displacement distance to thereby adjust a time for performing the next localization operation. The techniques may include performing state detection to determine a motion state of the device and performing the next localization operation based on the determined motion state.
According to one embodiment, a radar return signal processing apparatus includes a detector, an estimation unit and an extraction unit. The detector detects an average Doppler frequency, a spectrum width, and a received power of each of echoes, from a radar return signal obtained repeatedly at regular intervals. The estimation unit estimates an optimum mixed density function by learning modeling a shaped of the frequency spectrum by calculating repeatedly a sum of density functions of each of the echoes. The extraction unit extracts information on any one of the echoes included in the radar return signal, from a parameter of the estimated mixed density function.
Methods and systems for post processing synchronization of bistatic radar data are disclosed. A transmitter is configured to transmit pulses at a first rate controlled by a first local oscillator. A receiver is configured to receive pulses at a second rate controlled by a second oscillator. A processing device is configured to synchronize, with respect to the first rate, in-phase quadrature data received from the receiver using a keystone formatting technique.
A dipole based decoy system provides an inexpensive alternative to chaff. A non-conductive filament patterned with lengths of conductive material that form dipole antennas at one or more radar frequencies is stored on the air vehicle and attached to a projectile. In response to a RWR warning, a programmed time or location or a time-to-target, a mechanism releases the projectile(s) to deploy the filament with its dipole antennas at a speed greater than or equal to the speed of the air vehicle to present an extended target or a separate false target to enemy radar. The projectile is either towed behind the air vehicle or launched away from the air vehicle. Either approach is effective to overcome Doppler and moving range gating by presenting coherent signal returns and ranges and velocities consistent with the air vehicle during a threat interval posed by the radar defense systems.
A track-and-hold circuit comprises at least first and second amplifier stages, and switched capacitor circuitry coupled between the first and second amplifier stages. In a track mode of operation of the track-and-hold circuit, the switched capacitor circuitry is configured to decouple inputs of the second amplifier stage from respective outputs of the first amplifier stage and to couple the inputs of the second amplifier stage to a common mode voltage via respective first and second capacitors. In a hold mode of operation of the track-and-hold circuit, the switched capacitor circuitry is configured to couple the inputs of the second amplifier stage to the respective outputs of the first amplifier stage via the respective first and second capacitors. Multiple instances of the track-and-hold circuit may be implemented in parallel in a time-interleaved analog-to-digital converter.
A mechanism is provided in a data processing system for pipelined compression of multi-byte frames. The mechanism combines a current cycle of data in an input data stream with at least a portion of a next cycle of data in the input data stream to form a frame of data. The mechanism identifies a plurality of matches in a plurality of dictionary memories. Each match matches a portion of a given substring in the frame of data. The mechanism identifies a subset of matches from the plurality of matches that provides a best coverage of the current cycle of data. The mechanism encodes the frame of data into an encoded output data stream.
A packet processing framework is provided for a vehicle-to-vehicle communication packet processing system. The framework includes a neighborhood vehicle tracking module for tracking neighboring vehicles relative to a host vehicle. The neighborhood vehicle tracking module assigns a priority level of neighboring vehicles relative to a host vehicle. An adaptive security processing module regulates messages streamed to the neighboring vehicle tracker module that are in accordance with the priorities set forth by the neighborhood vehicle tracking module. The adaptive security processing module selects security modes and schedules messages streamed to the neighborhood vehicle tracking module as a function of priorities set forth by the neighborhood vehicle tracking module, a communication reliability of the transmitting neighboring vehicle, and a likelihood that a message from the neighboring vehicle is genuine as determined by the adaptive security processing module. The neighborhood vehicle tracking module outputs processed kinematics and alert information to at least one vehicle-to-vehicle application.
An electromechanical toilet leak detector comprises first and second enclosure portions. An adhesive structure disposed on the second enclosure portion, the adhesive structure in use for being removably adhered to the porcelain outer surface of a flush toilet. One of the first and second enclosure portions includes a groove that mates with a lip provided by the other of the first and second enclosure portions to provide a substantially water-resistant seal therebetween. A vibration sensing transducer disposed between the first and second enclosure portions generates a signal responsive to vibration generated by the toilet due to water inflow turbulence.
A computer-implemented method includes registering at least one medical condition associated with a vehicle occupant. The method also includes monitoring environmental conditions for the onset of a trigger likely to cause complications with regards to the medical condition. The method further includes warning the vehicle occupant about the onset of the trigger. The method also includes adjusting a vehicle component or system, via the VCS, in response to the onset of the trigger.
An electronic article surveillance (EAS) tag incorporates alternative theft deterrence systems. The security tag incorporates both a benefit-denial ink-based system and two independent EAS detection elements operating at two different frequencies such that the tag can alternatively be operated in two different systems. The security tag is further adapted to be reusable after ink ampoule breakage and includes a visual indication of ink to serve as a further visual deterrence to shoplifters.
A work direction determining device includes a passive tag type IC tag secured at a predetermined position on the front surface thereof. The IC tag includes a substrate, an IC module and an antenna coil disposed on the substrate in an offset manner. The device includes an antenna communicating with the IC tag, and a determination circuit. Where the work and the direction determining device are located at respective predetermined communication positions, communication is done between the antenna of the direction determining device and the antenna coil of the IC tag, and the magnitude of communication intensity during the communication is determined by the determination circuit to thereby determine a direction of the work.
A system and method for monitoring a structure and for distinguishing between an alarm condition, and a nuisance event such as rain. An optical fibre sensor (20,22) produces a signal indicative of a disturbance and level crossing rates are determined to distinguish between noise in the signal (nuisance event) and a required event. A FFT technique is also disclosed as well as classification of an event by extracting predetermined features from the signal.
A smartcard or other media that detects the presence of chemical and/or biological compounds or other items of interest on individuals handling by using chemical-selective devices. These chemical-selective devices can include non-linear (e.g., diode and/or transistor) and/or time non-linear (e.g., controlled resistor) electrical components and can indicate exposure to an item of interest through a change in one or more electrical characteristics. The exposure of the chemical-selective devices to items of interest is stored such that, when the smartcard or other media is presented to a card reader, the detection data can be transmitted to the card reader for appropriate processing by the system.
A method of analyzing participant activity includes providing an identification unit to a participant, receiving signals from the identification unit, determining location of the participant based on the received signals, storing the location information and the associated timestamp and analyzing the stored information.
A satellite aided location tracking and data services with user interface. A graphical user interface is provided that enables users to monitor the status of movable assets. Detailed information in a position history enables the user to obtain status information (e.g., starts and stops) at each position report. This status information promotes visibility into the journey of each movable asset.
A method for reminding objects being away, a communication device and a computer readable medium using the same method are proposed. The proposed method is adapted to the communication device, and includes the following steps. Location information of the communication device is recorded. A connection between the communication device and a specified object is established. A safety zone of the specified object is configured according to a user configuration signal. It is determined whether the specified object is away from the communication device, which is carried by the user. It is further determined whether the specified object is not in the safety zone. When the specified object is determined to be away from the communication device and is not in the safety zone, an alarm signal is provided to the user.
An approach for providing presence-based communication over a cellular network for a dwelling is described. A notification message is received over a wireless network to a mobile device associated with a user, wherein the notification message indicates generation of a presence indication signal by a device within a premise of the user. A registration status of the mobile device with the notification service is determined. The notification message is forwarded to the mobile device based on the registration status.
A system, apparatus, and method are provided for controlling equipment operable by a plurality of operators. A control state evaluation device is configured to evaluate a control state of an equipment control. A signal detection device is configured to detect if a signal associated with an operator of the equipment control is present. A process controller is configured to activate a first equipment function if the signal from the equipment control is present, and is configured to activate a second equipment function if the signal is not present.
Disclosed is a haptic feedback case for electronic equipment, including: a main body configured to accommodate the electronic equipment; a communication unit configured to receive haptic generation information from the electronic equipment; a filmy type actuator configured to generate haptic sensations; and a control unit configured to operate the film type actuator according to the haptic generation information input from the communication unit.
A method of preventing fraud at a self-service terminal is described. The method comprises: receiving a signal from an electromagnetic sensor located in the vicinity of an electromagnetic signal transmitter; monitoring a drive signal being delivered to the electromagnetic signal transmitter; and comparing the drive signal with the electromagnetic sensor signal. The method then ascertains if a state of the electromagnetic sensor signal is inconsistent with a state of the drive signal; and triggers an alarm when the state of the electromagnetic sensor signal is inconsistent with a state of the drive signal.
In one or more embodiments, an intelligent communications device is disclosed. In one embodiment, an apparatus is disclosed for controlling the operations of temperature-sensitive electronic devices in an enclosure, based on a requisite temperature range. The apparatus includes a main circuit board with a plurality of secondary circuit board connectors that are operative to connect secondary circuit boards to the main circuit board. The apparatus also includes one or more temperature sensors that are operative to sense temperature within the enclosure, and one or more selectively actuatable heating elements that are mounted to the main circuit board in proximity to the plurality of secondary circuit board connectors. Each heating element is operative to emit heat when actuated. The apparatus further includes a programmable processor that is programmed to cause the temperature sensors to sense the temperature within the enclosure and, if the sensed temperature is above or below the requisite temperature range, selectively actuate or shut down at least one of the heating elements.
A linear actuator includes a drive arm and an extension arm each extending along a common drive axis. One of the arms has a plurality of resiliently deformable fingers extending beyond the end of the arm towards the other arm. At least one of the fingers has a thread on its inner face while the other arm has a threaded portion. At least part of the threaded portion is received between the fingers. The fingers are adapted to urge the threads of the two arms into interengagement such that rotation of the drive arm about the drive axis displaces the extension arm along the drive axis. The two threads are arranged such that when the ridge of one thread is received in the groove of the other thread the two sides of the ridge abut the two edges of the mouth of the groove.
A cavity filter includes a base member defining therein a resonant chamber, an antenna port disposed at the center of the resonant chamber, two signal input/output ports respectively disposed at two distal ends of the resonant chamber for signal input/output, a cover member covering the base member, two feedback channels disposed in the base member at two opposite lateral sides relative to the resonant chamber and respectively connected between the signal ports and the antenna port, and wave-absorbing components respectively mounted in the feedback channels for removing surge waves from feedback frequency components in the feedback channels.
A resonant element driver circuit includes a NMOS transistor and a PMOS transistor that are configured to drive a resonant element. The resonant element driver circuit includes biasing circuitry that is configured to bias the PMOS transistor. The biasing circuitry receives a reference signal that is used to set the biasing on the PMOS transistor. The resonant element driver further includes mirror circuitry that tracks current flowing through the NMOS and PMOS transistors.
Apparatus are provided for amplifier circuits and related receiver systems. An amplifier circuit includes a first common-source amplification stage and a second common-source amplification stage. The input of the second common-source amplification stage is coupled to the output of the first common-source amplification stage such that the first common-source amplification stage generates a first amplified signal, and the second common-source amplification stage generates a second amplified signal based on the first amplified signal. The first common-source amplification stage is coupled to a first node and the second common-source amplification stage is coupled to a second node, wherein the common-source amplification stages are configured such that a current between the first node and the second node flows in series through the common-source amplification stages.
A traveling wave amplifier (TWA) primarily for driving a semiconductor optical device is disclosed. The TWA of an embodiment provides a plurality of differential amplifiers of the first type and an additional differential amplifier of the second type, where are they are connected between the input and the output of the TWA. The differential amplifiers of the first type provide a first delay from the input to the output, while, the differential amplifier of the second type provide a second delay longer than the first delay between the input and the output of the TWA.
A switched capacitor circuit employs a single operational amplifier to implement both an integrator and a summer. One input signal is routed to the input of the operational amplifier through (1) one or more integration branches, and (2) one or more first summing branches. A second input signal is routed to the input of the operational amplifier through one or more second summing branches. Each of the branches includes a capacitor and a number of switches controlled by different clock phases. The switched capacitor circuit may be single-ended or differential. The circuit may be used in an access terminal of a cellular communication system. The access terminal may operate under a code division multiple access (CDMA) communication standard.
A level shifting circuit includes a first circuit, a second circuit and an output voltage controlling circuit. The first circuit is coupled to an input node, an output node and a first supply voltage node and configured to pull an output voltage at the output node toward the first supply voltage in accordance with an input voltage applied to the input node. The second circuit is coupled to the first circuit, the output node and the second supply voltage node and configured to pull the output voltage toward the second supply voltage in accordance with the input voltage from the first circuit. The output voltage controlling circuit is coupled to the output node and configured to control the output voltage within a range narrower than a range from the first voltage to the second voltage.
A P-channel MOS transistor MP1 is provided between an input voltage Vin and the low-voltage circuit. The cathode of a first zener diode Z1 is connected to a node between the input voltage Vin and the source of the P-channel MOS transistor MP1. The anode of the first zener diode Z1 is branched into two lines at a branch node N1, and one of the two lines is connected to a ground through a resistor R1. The other of the two lines is connected to the gate of the P-channel MOS transistor MP1. The cathode of a second zener diode Z2 is connected to a node between the low-voltage circuit and the drain of the P-channel MOS transistor MP1. The anode of the second zener diode Z2 is connected to a ground.
A clock mesh network synthesis method is proposed which enables clock gating on the local sub-trees of the clock mesh network in order to reduce the clock power dissipation. Clock gating is performed with a register clustering strategy that considers both i) the similarity of switching activities between registers in a local area and ii) the timing slack on every local data path of the design area. The method encapsulates the efficient implementation of the gated local trees and activity driven register clustering with timing slack awareness for clock mesh synthesis. With gated local tree and activity driven register clustering, the switching capacitance on the mesh network can be reduced by 22% with limited skew degradation. The method has two synthesis modes as low power mode and high performance mode to serve different design purposes.
A wide bandwidth resonant clock distribution comprises a clock grid configured to distribute a clock signal to a plurality of components of an integrated circuit, at least one inductor, at least one tunable resistance switch, and a capacitor network. The inductor, tunable resistance switch, and capacitor network are connected between the clock grid and a reference voltage. The at least one tunable resistance switch is programmable to dynamically switch the at least one inductor in or out of the clock distribution to effect at least one resonant mode of operation or a non-resonant mode of operation based on a frequency of the clock signal.
A method and circuit for implementing low duty cycle distortion and low power differential to single ended level shifter, and a design structure on which the subject circuit resides are provided. The circuit includes an input differential amplifier providing positive and negative differential amplifier output signals coupled to an output amplifier providing a single ended output signal. The output amplifier amplifies and inverts the negative differential amplifier output signal. The output amplifier amplifies and superimposes the positive differential amplifier output signal with the amplified and inverted negative differential amplifier output signal, providing the single ended output signal with low duty cycle distortion.
A delay locked loop (DLL) includes a delay line that delays a clock signal to generate a delayed clock signal, a phase frequency detector (PFD) for detecting a phase and/or frequency difference between the clock signal and the delayed clock signal, and a charge pump having an adjustable bias current for converting the phase and/or frequency difference taking into account a bias current adjustment into a control voltage, in which the control voltage controls an amount of delay in the delayed clock signal.
Phase locked loop (PLL) architectures are provided such as hybrid PLL architectures having separate digital integrating control paths and analog proportional control paths. An analog proportional control path can be implemented with a charge pump circuit that includes resistors in series with CMOS switches to generate control currents (e.g., Up/Down control currents) which are used to adjust a control voltage applied to a digitally controlled oscillator. A digital integrating control path can be implemented with a series of sigma-delta modulators that operate at different frequencies to convert higher bit data signals to lower bit data signals along the digital integrating control path. A single phase frequency detector may be implemented to generate control signals that separately control the analog proportional and digital integrating control paths.
A method and system for synchronizing the output signal phase of a plurality of frequency divider circuits in a local-oscillator (LO) or clock signal path is disclosed. The LO path includes a plurality of frequency divider circuits and a LO buffer for receiving a LO signal coupled to the plurality of frequency divider circuits. The method and system comprise adding offset voltage and setting predetermined state to each of the frequency divider circuits; and enabling the frequency divider circuits. The method and system includes enabling the LO buffer to provide the LO signal to the frequency divider circuits after they have been enabled. When the LO signal drives each of the frequency divider circuits, each of the frequency divider circuits starts an operation. Finally the method and system comprise removing the offset voltage from each of the frequency divider circuits to allow them to effectively drive other circuits.
A drive circuit supplies a charging current via a charging path to drive the control terminal of a voltage-controlled switching device, with a resistor and a switching device being connected in series in the charging path. A control circuit in an integrated circuit of the drive circuit operates an internal switching device such as to selectively enable/interrupt the charging current and to regulate the voltage drop across the resistor to a fixed value. The switching device connected in the charging path can be readily changed from the internal switching device to an external switching device, in accordance with the operating requirements of the driven switching device.
Programmable integrated circuits with configurable logic circuitry and routing resources are provided. Portions of the routing resources on a programmable integrated circuit may be used in implementing a desired user-specified custom logic function, whereas other portions of the routing resources on the programmable integrated circuit may be unused. The unused routing resources may include adjacent pairs of routing paths. These paths may be coupled to control circuitry configured to drive the routing paths to desired voltage levels to provide an optimal amount of decoupling capacitance. In one suitable arrangement, two adjacent routing paths may both be driven to a positive power supply voltage level. In another suitable arrangement, the two adjacent routing paths may be driven to the positive power supply voltage level and a ground power supply voltage level, respectively.
A method of manufacturing a silicon carbide (SiC) bipolar junction transistor (BJT) and a SiC BJT are provided. The SiC BJT comprises an emitter region, a base region and a collector region. The collector region is arranged on a substrate having an off-axis orientation of about 4 degrees or lower. Further, a defect termination layer (DTL) is arranged between the substrate and the collector region. A thickness and a doping level of the DTL are configured to terminate basal plane dislocations in the DTL and reduce the growth of defects from the DTL to the collector region. At least some of the embodiments are advantageous in that SiC BJTs with improved stability are provided. Further, a method of evaluating the degradation performance of a SiC BJT is provided.
A device and method of determining the electrical properties of an electrical device, including taking of at least one measurement of an electrical measured quantity at one or more brought-out electrical connections of each of several equipotential bodies of the electrical device, wherein measurement of the electrical measured quantity of certain equipotential bodies on at least one other brought-out electrical connection of the equipotential body concerned is not performed if a defect, which if appropriate is to be detected, of the relevant equipotential body in the area of this other connection, influences the electrical measured quantity more strongly than a tolerance of the measurement of this measured quantity.
The present approach is based on the use of an integrated capacitance bridge circuit to measure the capacitance of a device under test. A significant feature of this approach is that the operating point is not the null point of the bridge circuit. Instead, the operating point of the bridge circuit is tuned to be away from the null point. By moving away from the null point, the output signal from the bridge circuit is increased. Preferably, this output signal is substantially larger than the input noise floor of an amplifier connected to the bridge circuit output, while being substantially less than GνDUT, where G is the gain provided by the bridge circuit transistor and νDUT is the AC signal applied to the device under test. Experiments on graphene devices and on carbon nanotube FETs demonstrate about 10 aF resolution (graphene) and about 13 aF resolution (carbon nanotube FET) at room temperature.
A system for determining power supply noise in an integrated circuit includes a circuit system comprising a circuit element and a power delivery network, the power delivery network comprising at least one impedance, a channel formed by input and output portions of the circuit element, the channel having the impedance of the power delivery network, a signal source for providing an aggressor signal having a known spectrum to the input portion of the circuit element, and an analysis device for measuring the aggressor signal at the output portion of the circuit element, whereby the aggressor signal at the output portion of the circuit element is influenced by the impedance of the power delivery network and indicates power supply noise.
An apparatus and method for conducting resistivity logging in a borehole. The apparatus may include a housing configured for fluid isolation, an electrical conductor penetrating the housing and a sealing interface. The apparatus may also include at least one of: an electrical component inside the housing and an electrode disposed on the exterior of the housing. The apparatus is configured to allow the electrical conductor to be moved, while maintaining the sealing interface, between an electrically connected state and an electrically disconnected state with at least one of: the electrical component and the electrode. The method may include using the apparatus for resistivity logging operations.
This invention relates generally to detection devices having one or more small wells each surrounded by, or in close proximity to, an NMR micro coil, each well containing a liquid sample with magnetic nanoparticles that self-assemble or disperse in the presence of a target analyte, thereby altering the measured NMR properties of the liquid sample. The device may be used, for example, as a portable unit for point of care diagnosis and/or field use, or the device may be implanted for continuous or intermittent monitoring of one or more biological species of interest in a patient.
Method in which the current is measured inside an integrated PWM control circuit using at least one A/D converter which is likewise integrated in the circuit is described. The PWM controller is provided for the purpose of driving inductive loads and is arranged, in particular, in an electronic circuit of an electronic controller for a motor vehicle braking system. Before determining the actual current of the PWM controller, which is determined using the at least one A/D converter, the current is smoothed using a low-pass filter. A circuit arrangement for carrying out the above method and its use in electronic motor vehicle control systems is also described herein.
A switching power source apparatus includes a high-side MOSFET 11 connected to an input voltage Vin, a ramp signal generator 18 to generate a ramp signal in synchronization with a switching frequency of the high-side MOSFET 11, an amplitude signal generator (second feedback controller 2) to generate an amplitude signal Comp corresponding to an amplitude of the ramp signal, and a controller 1 to control ON timing of the high-side MOSFET 11 according to the ramp signal, a feedback signal FB corresponding to an output voltage Vout, and a first reference voltage REF, as well as controlling an ON width of the high-side MOSFET 11 according to the amplitude signal Comp, the input voltage Vin, and the output voltage Vout.
Provided is a battery pack capable of reducing the number of terminals of a battery protection IC. When a battery (15) enters an overdischarge state, a temperature switch IC (12) included in a battery pack (10) monitors a voltage of a voltage monitoring terminal (VM2) provided to an external connection terminal (EB−), rather than a voltage of a terminal of the battery protection IC (11) for use in communication with the temperature switch IC (12), and then shuts down. Therefore, the battery protection IC (11) included in the battery pack (10) does not require an additional terminal for use in communication with the temperature switch IC (12).
A battery pack and a method of controlling the same is disclosed. The battery pack determines a cell deviation after the battery pack is fully charged or over-discharged, and thus the battery pack can reduce the cell deviation by performing cell balancing.
A battery pack system is disclosed. The battery pack system includes a plurality of battery pack modules that are each configured to be concurrently and removably attached to a base. Each battery pack module includes batteries arranged in a plurality of parallel groups that are connected in series. Each parallel group includes a plurality of batteries connected in parallel. Additionally or alternately, the base has electronics that connect the battery pack modules in a plurality of system parallel groups that are connected in series. Each system parallel group includes a plurality of battery pack modules connected in parallel.
Synchronous motors are controlled using a three-phase AC power controller. According to at least one embodiment of the invention, a fundamental wave having the desired frequency is defined for the first phase, and corresponding fundamental waves which have the same frequency as the frequency in the first phase but are out of phase by specific values are defined in the other phases. The triggering times during which the generated current pulse concurrently has the same polarity as the respective fundamental wave in two of the phases are determined for each phase and are used. Two of the three fundamental waves are generated in phase opposition when the desired frequency amounts to half the system frequency.
A motor-drive circuit includes: a filter circuit to attenuate a frequency band including a resonance frequency of an actuator in a target-current signal, which is a digital signal indicating a target value of a driving current to be supplied to a voice-coil motor that drives the actuator; a digital-analog converter to convert an output signal of the filter circuit into an analog signal, to be outputted as a current-control signal; and a driving circuit to supply the driving current to the motor in accordance with the current-control signal, the filter circuit including: a digital-notch filter to attenuate a frequency band around the resonance frequency in the target-current signal; and a digital-low-pass filter to attenuate a frequency band greater than or equal to a predetermined frequency in the output signal of the digital-notch filter, the digital-low-pass filter having a sampling frequency higher than a sampling frequency of the digital-notch filter.
A method of controlling a fan in a vehicle comprising: measuring a control input signal; measuring a continuous applied voltage to the fan; comparing the continuous applied voltage to a look up table; and activating the fan when the control input signal is open and the continuous applied voltage is greater than a system voltage by about 0.5 volts.
An AC electric motor includes an annular A-phase winding WA wound in the circumferential direction of a stator, a stator pole group SPGA configured to generate magnetic flux φA to interlink with the A-phase winding WA, an annular B-phase winding WB wound in the circumferential direction, and a stator pole group SPGB configured to generate magnetic flux φB to interlink with the B-phase winding WB. The motor additionally includes a third stator pole group SPGC, N and S magnetic poles of the rotor, and X magnetic poles, which serve as third rotor poles, showing magnetic characteristics between the N and S magnetic poles of the rotor. DC currents are supplied to the A-phase and B-phase windings WA and WB to generate rotational torque.
A dimmer switch for controlling the intensity of a dimmable screw-in compact fluorescent lamp provides smooth dimming of the fluorescent lamp and prevents flickering of the lamp due to multiple re-strikes. The dimmer switch prevents multiple re-strikes by avoiding multiple firings of a controllably conductive switching device of the dimmer circuit by limiting the high-end light intensity of the fluorescent lamp. Specifically, the dimmer switch limits the length of a conduction interval of the controllably conductive switching device to less than approximately 75% of each half-cycle. The dimmer switch may include a user-accessible adjustment actuator for changing the dimmer switch between an incandescent operating mode and a screw-in compact fluorescent mode. The dimmer switch may also be operable to automatically change the dimmer switch between the incandescent operating mode and the screw-in compact fluorescent mode by detecting the occurrence of the multiple firings of the controllably conductive switching device.
In one embodiment, an apparatus includes a transformer comprising a primary side and a secondary side. A switch is coupled to the primary side. A control signal circuit is configured to: sample a first current on the primary side of the transformer; estimate a second current value on the secondary side of the transformer using the sampling of the first current on the primary side and a turn ratio of the transformer; and output a signal to control a turn on time for the switch.
The invention provides integrated power supplies, circuit drivers, and control methods for relatively high-current drivers, usable with common battery power sources. Preferred embodiments include one or more high series resistance super-capacitors electrically connected with a power. A low resistance driver circuit regulates power supplied from the super-capacitors to the load.
A method for improving the uniformity of high-frequency discharge plasma by means of frequency modulation is disclosed. In a plasma discharge chamber, there is a pair of parallel electrodes. A high-frequency power supply is adopted to feed the electrodes. The frequency range of the electromagnetic field is 13.56 MHz˜160 MHz. Discharge gas is input to form plasma. The frequency of the fed-in high-frequency electromagnetic field is under automatic tuning control, and keeps changing cyclically without stop in the course of plasma discharge. The range of the frequency change may fall into either a portion of or the entire range of 13.56 MHz˜160 MHz and makes the locations with higher plasma density on the plane in parallel with the electrodes and in the plasma discharge space changed cyclically. In a time slot longer than one frequency change cycle, the average plasma density between the parallel electrodes is uniform.
A Hall effect plasma thruster including an annular discharge channel around a main axis presenting an open downstream end and defined between an inner wall and an outer wall, at least one cathode, a magnetic circuit for creating a magnetic field in the channel, a pipe for feeding ionizable gas to the channel, an anode, and a manifold placed in the upstream end of the channel. The manifold is connected to the pipe and enables the ionizable gas to flow into the ionization zone of the channel in concentric manner around the main axis. The anode acts as a manifold, and the manifold includes a directional mechanism that gives rise at an outlet from the manifold to swirling motion of the gas around the main axis.
A light emitting diode (LED) bulb configured to scatter certain wavelengths of light. The LED bulb includes a base having threads, a bulb shell, at least one LED, and a plurality of particles disposed within the bulb shell. The plurality of particles has a first and second set of particles. The first set of particles is configured to scatter short wavelength components of light emitted from the at least one LED and has particles with an effective diameter that is a fraction of the dominant wavelength of the light emitted from the at least one LED. The second set of particles is configured to scatter light emitted from the at least one LED, and has particles with an effective diameter equal to or greater than the dominant wavelength of the light emitted from the at least one LED.
There is herein described a phosphor composition for converting the light emitted from LED dies. The phosphor composition has an emission dominant wavelength responsive to an excitation dominant wavelength. The phosphor composition includes a first phosphor, a second phosphor and a third phosphor. The phosphor composition has a first weight ratio of the first phosphor and the second phosphor, and a second weight ratio of the second phosphor and the third phosphor. The first and second weight ratios are arranged so that the emission dominant wavelength increases as the excitation dominant wavelength increases.
Provided is a lead-free dielectric ceramics having a low leakage current value, and a bismuth iron oxide powder as a raw material thereof. The bismuth iron oxide powder includes at least: (A) grains including a bismuth iron oxide having a perovskite-type crystal structure; (B) grains including a bismuth iron oxide having a crystal structure classified to a space group Pbam; and (C) grains including a bismuth iron oxide or a bismuth oxide having a crystal structure that is classified to a space group I23. The dielectric ceramics are made of bismuth iron oxide in which the bismuth iron oxide crystals having the crystal structure classified to the space group Pbam are distributed at a grain boundary of crystal grains of the bismuth iron oxide crystals having the perovskite-type crystal structure.
Various embodiments are directed to an apparatus, system, and method for driving an end effector coupled to an ultrasonic transducer. The method comprises generating a first ultrasonic drive signal by a generator coupled to an ultrasonic drive system, actuating the ultrasonic transducer with the first ultrasonic drive signal, generating a second ultrasonic drive signal by the generator, and actuating the ultrasonic transducer with the second ultrasonic drive signal. The first drive signal is different from the second drive signal. The first and second drive signals define a step function waveform. The apparatus comprises a generator configured to couple to an ultrasonic instrument. The system comprises a generator coupled to an ultrasonic instrument. The ultrasonic instrument comprises an ultrasonic drive system comprising an ultrasonic transducer coupled to a waveguide and an end effector coupled to the waveguide, and wherein the ultrasonic drive system resonates at a resonant frequency.
A spool carrier has a winding body with a shell having a trapezoidal cross section with two substantially right angles and one acute angle, wherein the spool wire is guided on the obtuse angle edge of the winding body, beginning parallel to the front face edges of the winding body, along the side surface adjoining the obtuse angle edge, around the winding body, to the acute angle edge of the winding body, and guided on the front face from the acute to the obtuse angle edge at an angle to the front face edge, such that it comes to rest on the obtuse angle edge in one winding step directly adjacent to the winding wire of the previous winding, and in one winding step in the next adjacent groove between two windings of the previous layer, or optionally between the flange and the winding of the previous layer.
A rotary electric machine includes a stator in which windings are arranged around a plurality of main poles of a stator core, and a hybrid type rotor arranged with an air gap between the stator and the rotor has a step angle for the rotor of about 4.09° and uses metal bearings for supporting a rotor shaft of the rotor. Setting of the step angle for the rotor to be about 4.09° can make a rotation angle of the rotor caused by excitation of the windings by an input pulse signal larger as compared with a typical motor having a step angle of about 1.8°. With this unique arrangement, the rotor can be rotated at higher speeds, increasing the motor efficiency. Therefore, the motor output at approximately the same level as that of a conventional motor can be obtained without keeping the air gap high precision. Due to this, even if inexpensive slide bearings, i.e., metal bearings to support the rotor, are used, the performance equal to or higher than that of the conventional motor can be ensured, resulting in a large cost reduction.
A parallel device comprises a battery module, a plurality of switching units and a control module being couplable to the battery module. The battery module includes a plurality of battery groups. The plurality of switching units includes a plurality of first switches. Each of the switching units is couplable to a respective battery group in series. Each series combination of the switching unit and the respective battery group is coupled in parallel with another series combination, and each of the switching unit includes a respective first switch coupled with a load in series. The control module is configured to receive values of measured voltages across at least two battery groups, calculate a voltage difference between the two received voltage values, compare an absolute value of the voltage difference to a reference voltage to obtain a voltage comparison result, and turn ON or OFF at least one of the first switches in accordance with the comparison result.
A vehicle power converter including a plurality of switching elements having diodes connected thereto in parallel and constituting a multi-phase bridge circuit and a controller for conducting the switching element corresponding to each diode in synchronization with a conduction state of the diode concerned to perform synchronous rectification and is connected between a power generator-motor driven from the external to generate multi-phase AC power and DC equipment, further includes a load state detecting unit for detecting a load state of the power generator-motor when the multi-phase AC power occurs, wherein a shift from diode rectification to synchronous rectification or a shift from the synchronous rectification to the diode rectification is carried out in accordance with an output of the load state detecting unit.
A generator having a rotor which comprises rotor excitation element-carrying modules, for example magnets, radially movable in relation to the generator shaft in such a manner, when in their retracted position, as to significantly ease generator transport and assembly. The use of these movable magnet-carrying modules is particularly useful in direct drive-type generators which do not require a multiplier. Another object of the invention is an assembly process which comprises a generator equipped with the radially movable magnet-carrying modules.
A system for producing electricity from jet streams and tower therefor extending from a ground surface to an altitude wherein jet streams exist. The tower is self supporting, comprising a plurality of buoyant modules adapted to house a lighter than air gas or gas mixture. The system includes at least one generator for electricity production.
The invention relates to a wave power unit having a submerged station anchored on the sea bottom, a floating body floating on the sea surface and flexible connection means (3) connecting these. The submerged station has a linear generator with a reciprocating translator. According to the invention, the station includes a guiding device (9) for the flexible connection means (3). The guiding device (9) has a plurality of rotatable rollers (15a-18c). The rollers (15a-18c) form a passage for the flexible connection means (3). The invention also relates to use of the wave power unit and to a method for producing electric power.
A thermoelectric generator including a membrane maintained by lateral ends and capable of taking a first shape when its temperature reaches a first threshold and a second shape when its temperature reaches a second threshold greater than the first threshold; at least one electrically conductive element attached to with the membrane and connecting the lateral ends of the membrane; and circuitry capable of generating, at the level of the membrane, a magnetic field orthogonal to the membrane displacement direction, the lateral ends of the membrane being connected to output terminals of the generator.
A semiconductor device has a semiconductor substrate, an insulating film disposed on a surface of the semiconductor substrate, and a porous metal film disposed on the insulating film and having a void region containing voids and a void-free region that does not contain any voids. A protective film is disposed on the porous metal film and has an opening portion defining a pad region having a pad opening end. An interface between the void region and the void-free region of the porous metal film is disposed at one of the pad opening end and a position outside of the pad opening end. A wire is wire-bonded to the porous metal film in the pad region.
A stacked die assembly for an IC includes a first interposer; a second interposer; a first integrated circuit die, a second integrated circuit die, and a plurality of components. The first integrated circuit die is interconnected to the first interposer and the second interposer, and the second integrated circuit die is interconnected to the second interposer. The plurality of components interconnect the first integrated circuit die to the first interposer and the second interposer. The plurality of components that interconnect the first integrated circuit die to the first interposer and the second interposer are located outside an interconnect restricted area of the first interposer and the second interposer, and signals are routed between the first integrated circuit die and the second integrated circuit die via the first integrated circuit die avoiding the interconnect restricted area of the first interposer and the second interposer.
For simplifying the dual-damascene formation steps of a multilevel Cu interconnect, a formation step of an antireflective film below a photoresist film is omitted. Described specifically, an interlayer insulating film is dry etched with a photoresist film formed thereover as a mask, and interconnect trenches are formed by terminating etching at the surface of a stopper film formed in the interlayer insulating film. The stopper film is made of an SiCN film having a low optical reflectance, thereby causing it to serve as an antireflective film when the photoresist film is exposed.
The present invention relates to a surface mount package for a silicon condenser microphone and methods for manufacturing the surface mount package. The surface mount package uses a limited number of components which simplifies manufacturing and lowers costs, and features a substrate that performs functions for which multiple components were traditionally required, including providing an interior surface on which the silicon condenser die is mechanically attached, providing an interior surface for making electrical connections between the silicon condenser die and the package, and providing an exterior surface for surface mounting the package to a device's printed circuit board and for making electrical connections between package and the device's printed circuit board.
A method for forming an integrated circuit including the steps of: a) forming openings in a front surface of a first semiconductor wafer, the depth of the openings being smaller than 10 μm, and filling them with a conductive material; b) forming doped areas of components in active areas of the front surface, forming interconnection levels on the front surface and leveling the surface supporting the interconnection levels; c) covering with an insulating layer a front surface of a second semiconductor wafer, and leveling the surface coated with an insulator; d) applying the front surface of the second wafer coated with insulator on the front surface of the first wafer supporting interconnection levels, to obtain a bonding between the two wafers; e) forming vias from the rear surface of the second wafer, to reach the interconnection levels of the first wafer; and f) thinning the first wafer to reach the openings filled with conductive material.
A semiconductor package includes a lead frame, at least one chip and a molding compound. The lead frame comprises a plurality of leads, each lead comprises a first end portion and at least one coupling protrusion, wherein the first end portion comprises a first upper surface, the coupling protrusion comprises a ring surface and is integrally formed as one piece with the first upper surface. The chip disposed on top of the leads comprises a plurality of bumps and a plurality of solders, the coupling protrusions embed into the solders to make the ring surfaces of the coupling protrusions cladded with the solders. The solders cover the first upper surfaces. The chip and the leads are cladded with the molding compound.
A metal layer is deposited on a planar surface on which top surfaces of underlying metal vias are exposed. The metal layer is patterned to form at least one metal block, which has a horizontal cross-sectional area of a metal line to be formed and at least one overlying metal via to be formed. Each upper portion of underlying metal vias is recessed outside of the area of a metal block located directly above. The upper portion of the at least one metal block is lithographically patterned to form an integrated line and via structure including a metal line having a substantially constant width and at least one overlying metal via having the same substantially constant width and borderlessly aligned to the metal line. An overlying-level dielectric material layer is deposited and planarized so that top surface(s) of the at least one overlying metal via is/are exposed.
A bipolar transistor is fabricated having a collector (52) in a substrate (1) and a base (57, 58) and an emitter (59) formed over the substrate. The base has a stack region (57) which is laterally separated from the emitter (59) by an electrically insulating spacer (71). The insulating spacer (71) has a width dimension at its top end at least as large as the width dimension at its bottom end and forms a Γ-shape or an oblique shape. The profile reduces the risk of silicide bridging at the top of the spacer in subsequent processing, while maintaining the width of emitter window.
A semiconductor device includes an internal circuit provided on a substrate, a plurality of external terminals connected to the internal circuit, a plurality of wires connecting the internal circuit and the external terminals, and a plurality of inductors communicating with an external device. Each of the inductors is connected to each of the wires. The external terminals are formed in a region not to interrupt communication between the inductors and the external device.
The semiconductor device includes: a semiconductor substrate; a pair of injection elements; an active barrier structure; and a p-type ground region. The semiconductor substrate has a main surface and a p-type region formed therein. The active barrier structure is arranged in a region sandwiched between the pair of injection elements over the main surface. The p-type ground region is a ground potential-applicable region which is formed closer to an end side of the main surface than the pair of injection elements and the active barrier structure, bypassing a region sandwiched between the pair of injection elements over the main surface, and which is electrically coupled to the p-type region. The p-type ground region is divided by a region adjacent to the region sandwiched between the pair of injection elements.
A thin-film photoelectric conversion device includes a crystalline germanium photoelectric conversion layer having improved open circuit voltage, fill factor, and photoelectric conversion efficiency for light having a longer wavelength. The photoelectric conversion device comprises a first electrode layer, one or more photoelectric conversion units, and a second electrode layer sequentially stacked on a substrate, wherein each of the photoelectric conversion units comprises a photoelectric conversion layer arranged between a p-type semiconductor layer and an n-type semiconductor layer. At least one of the photoelectric conversion units includes a crystalline germanium photoelectric conversion layer comprising a crystalline germanium semiconductor that is substantially intrinsic or weak n-type and is essentially free of silicon. A first interface layer which is a substantially intrinsic amorphous silicon semiconductor layer is arranged between the p-type semiconductor layer and the crystalline germanium photoelectric conversion layer.
CMOS pixel sensors with multiple pixel sizes and methods of manufacturing the CMOS pixel sensors with implant dose control are provided. The method includes forming a plurality of pixel sensors in a same substrate and forming a masking pattern over at least one of the plurality of pixel sensors that has a pixel size larger than a non-masked pixel sensor of the plurality of pixel sensors. The method further includes providing a single dosage implant to the plurality of pixel sensors. The at least one of the plurality of pixel sensors with the masking pattern receives a lower dosage than the non-masked pixel sensor.
Solid-state imaging device of the present invention is a backside-illumination-type solid-state imaging device including wiring layer formed on first surface side of semiconductor substrate; and light receiving section that photoelectrically converts light incident from second surface side that is opposite from first surface side, wherein spontaneous polarization film formed of a material having spontaneous polarization is formed on a light receiving surface of light receiving section. Accordingly, a hole accumulation layer can be formed on the light receiving surface of light receiving section, and a dark current can be suppressed.
A method and system provide a magnetic junction usable in a magnetic device. The magnetic junction includes a pinned layer, a nonmagnetic spacer layer, a free layer, and at least one damping reduction layer. The free layer has an intrinsic damping constant. The nonmagnetic spacer layer is between the pinned layer and the free layer. The at least one damping reduction layer is adjacent to at least a portion of the free layer and configured to reduce the intrinsic damping constant of the free layer. The magnetic junction is configured such that the free layer is switchable between a plurality of stable magnetic states when a write current is passed through the magnetic junction.
A microelectromechanical system (MEMS) device includes a substrate and an oxide layer formed on the substrate. A cavity is etched in the oxide layer. A microstructure device layer is bonded to the oxide layer, over the cavity. The microstructure device layer includes a substantially solid microstructure MEMS device formed in the microstructure device layer and suspended over a portion of the cavity. An anchor is formed in the device layer and configured to support the microstructure device, the anchor having an undercut in the oxide layer. The undercut has a length along the anchor that is less than one-half a length of an outer boundary dimension of the microstructure MEMS device.
The present invention is directed to a CMOS integrated micromechanical device fabricated in accordance with a standard CMOS foundry fabrication process. The standard CMOS foundry fabrication process is characterized by a predetermined layer map and a predetermined set of fabrication rules. The device includes a semiconductor substrate formed or provided in accordance with the predetermined layer map and the predetermined set of fabrication rules. A MEMS resonator device is fabricated in accordance with the predetermined layer map and the predetermined set of fabrication rules. The MEMS resonator device includes a micromechanical resonator structure having a surface area greater than or equal to approximately 20 square microns. At least one CMOS circuit is coupled to the MEMS resonator member. The at least one CMOS circuit is also fabricated in accordance with the predetermined layer map and the predetermined set of fabrication rules.
A strained Ge-on-insulator structure is provided, comprising: a silicon substrate, in which an oxide insulating layer is formed on a surface of the silicon substrate; a Ge layer formed on the oxide insulating layer, in which a first passivation layer is formed between the Ge layer and the oxide insulating layer; a gate stack formed on the Ge layer; and a channel region formed below the gate stack, and a source and a drain formed on sides of the channel region, in which the source and the drain are a SixGe1-x:C source and a SixGe1-x:C drain respectively to produce a tensile strain in the channel region, in which x is within a range from 0 to 1 and a content of C is within a range from 0 to 7.5%. Further, a method for forming the strained Ge-on-insulator structure is also provided.
A thin film transistor of the present invention comprises, an active layer formed on an insulating substrate and having a channel region and source/drain regions; a gate electrode formed corresponding to the channel region of the active region; a body contact region separately formed with the source/drain regions in the active layer; source/drain electrodes each connected to the source/drain regions; and a conductive wiring for connecting the body contact region and the gate electrode.
A semiconductor structure is provided. The semiconductor structure includes a semiconductor substrate, a dielectric layer, a dielectric structure and an electrode structure. The dielectric layer is on an upper substrate surface of the semiconductor substrate. The dielectric structure and the semiconductor substrate have opposing first and second interfaces therebetween. The electrode structure comprises an electrode truck portion and at least one electrode branch portion. The at least one electrode branch portion is extended from the electrode truck portion down into the dielectric structure. The at least one electrode branch portion and the first interface have the smallest gap distance substantially bigger than 300 Å therebetween.
A dual channel trench LDMOS transistor includes a semiconductor layer of a first conductivity type formed on a substrate; a first trench formed in the semiconductor layer where a trench gate is formed in an upper portion of the first trench; a body region of the second conductivity type formed in the semiconductor layer adjacent the first trench; a source region of the first conductivity type formed in the body region and adjacent the first trench; a planar gate overlying the body region; a drain drift region of the first conductivity type formed in the semiconductor layer and in electrical contact with a drain electrode. The planar gate forms a lateral channel in the body region, and the trench gate in the first trench forms a vertical channel in the body region of the LDMOS transistor.
A three-dimensional semiconductor device includes a stacked structure including a plurality of conductive layers stacked on a substrate, a distance along a first direction between sidewalls of an upper conductive layer and a lower conductive layer being smaller than a distance along a second direction between sidewalls of the upper conductive layer and the lower conductive layer, the first and second directions crossing each other and defining a plane parallel to a surface supporting the substrate, and vertical channel structures penetrating the stacked structure.
Vertical capacitive depletion field effect transistors (VCDFETs) and methods for fabricating VCDFETs are disclosed. An example VCDFET includes one or more interleaved drift and gate regions. The gate region(s) may be configured to capacitively deplete the drift region(s) though one or more insulators that separate the gate region(s) from the drift region(s). The drift region(s) may have graded/non-uniform doping profiles. In addition, one or more ohmic and/or Schottky contacts may be configured to couple one or more source electrodes to the drift region(s).
A semiconductor device has an FET of a trench-gate structure obtained by disposing a conductive layer, which will be a gate, in a trench extended in the main surface of a semiconductor substrate, wherein the upper surface of the trench-gate conductive layer is formed equal to or higher than the main surface of the semiconductor substrate. The conductive layer of the trench gate is formed to have a substantially flat or concave upper surface and the upper surface is formed equal to or higher than the main surface of the semiconductor substrate. After etching of the semiconductor substrate to form the upper surface of the conductive layer of the trench gate, a channel region and a source region are formed by ion implantation so that the semiconductor device is free from occurrence of a source offset.
A device includes a buried well region and a first HVW region of the first conductivity, and an insulation region over the first HVW region. A drain region of the first conductivity type is disposed on a first side of the insulation region and in a top surface region of the first HVW region. A first well region and a second well region of a second conductivity type opposite the first conductivity type are on the second side of the insulation region. A second HVW region of the first conductivity type is disposed between the first and the second well regions, wherein the second HVW region is connected to the buried well region. A source region of the first conductivity type is in a top surface region of the second HVW region, wherein the source region, the drain region, and the buried well region form a JFET.
A die micro electro-mechanical switch management system and method facilitate power conservation by selectively preventing electrical current from flowing in designated components. A present invention semiconductor die comprises a block of transistors for performing switching operations, a bus (e.g., a power bus, a signal bus, etc.) for conveying electrical current and a micro electro-mechanical switch that couples and decouples the block of transistors to and from the bus. The micro electro-mechanical switch is opened and closed depending upon operations (e.g., switching operations) being performed by the block of transistors. Electrical current is prevented from flowing to the block of transistors when the micro electro-mechanical switch is open and the block of transistors is electrically isolated. The micro electro-mechanical switch can interrupt electrical current flow in a plurality of the bus lines and/or can be included in a relay array.
A light-emitting element includes a light-emitting stack for emitting light and a substrate structure including: a first substrate disposed under the light-emitting stack and having a first surface facing the light-emitting stack; and a second substrate disposed under the light-emitting stack and having a second surface facing the light-emitting stack; and a reflective layer formed between the first substrate and the second substrate and having an inclined angle not perpendicular to the first surface.
This invention discloses a light-emitting device comprising a semiconductor stack layer having an active layer of a multiple quantum well (MQW) structure comprising alternate stack layers of quantum well layers and barrier layers, wherein the barrier layers comprise at least one doped barrier layer and one undoped barrier layer. The doped barrier layer can improve the carrier mobility of the electron holes and increase the light-emitting area and the internal quantum efficiency of the active layer.
A semiconductor light emitting device includes: a first conductivity type semiconductor layer; a light emission layer; a second conductivity type semiconductor layer; a conductive portion of a first polarity electrically connected to the first conductivity type semiconductor layer; and a conductive portion of a second polarity electrically connected to the second conductivity type semiconductor layer. At least one of the conductive portion of the first polarity and the conductive portion of the second polarity includes a plurality of separated electrode portions arranged on a light emission surface. The closer the positions of the separated electrode portions are to a center point of the light emission surface, the separated electrode portions are provided sparsely, and the farther the positions of the separated electrode portions are from a center point of the light emission surface, the separated electrode portions are provided densely.
A three-dimensional integrated circuit device includes a first substrate having a first crystal orientation comprising at least one or more PMOS devices thereon and a first dielectric layer overlying the one or more PMOS devices. The three-dimensional integrated circuit device also includes a second substrate having a second crystal orientation comprising at least one or more NMOS devices thereon; and a second dielectric layer overlying the one or more NMOS devices. An interface region couples the first dielectric layer to the second dielectric layer to form a hybrid structure including the first substrate overlying the second substrate.
A light-emitting device includes a drive transistor for controlling the quantity of current supplied to a light-emitting element, a capacitor element electrically connected to a gate electrode of the drive transistor, and an electrical continuity portion for electrically connecting the drive transistor and the light-emitting element, these elements being disposed on a substrate. The electrical continuity portion is disposed on the side opposite to the capacitor element with the drive transistor disposed therebetween.
The present invention improves the aperture ratio of a pixel of a reflection-type display device or a reflection type display device without increasing the number of masks and without using a blackmask. A pixel electrode (167) is arranged so as to partially overlap a source wiring (137) for shielding the gap between pixels from light, and a thin film transistor is arranged so as to partially overlap a gate wiring (166) for shielding a channel region of the thin film transistor from light, thereby realizing a high pixel aperture ratio.
A transistor that may be used in electronic displays to selectively activate one or more pixels. The transistor includes a metal layer, a silicon layer deposited on at least a portion of the metal layer, the silicon layer includes an extension portion that extends a distance past the metal layer, and at least three lightly doped regions positioned in the silicon layer. The at least three lightly doped regions have a lower concentration of doping atoms than other portions of the silicon layer forming the transistor.
An anti-fuse device includes a gate electrode on a semiconductor substrate, a gate insulating layer between the semiconductor substrate and the gate electrode, junction regions in the semiconductor substrate adjacent the gate electrode, and at least one anti-breakdown material layer between the junction regions, the gate insulating layer being between the gate electrode and the anti-breakdown material layer.
A novel stilbene derivative is provided with motivation of providing a blue emissive material showing excellent color purity. The use of the stilbene derivative of the present invention allows the fabrication of a blue-emissive light-emitting element with excellent color purity. The invention also includes an electronic device equipped with a display portion in which the stilbene derivative is employed. The stilbene derivative of the present invention is represented by formula (1), in which Ar1 and Ar2 may form a 5-membered ring by being directly bonded to each other. In formula (1), A11 represents any one of substituents represented by general formulas (1-1) to (1-3). The variables shown in formula (1) and (1-1) to (1-3) are as defined in the specification.
It is an object of the present invention to provide a material having a high Tg and a wide energy gap. The present invention provides a spirofluorene derivative represented by General Formula 1. (In the formula, R1 is any one of hydrogen, an alkyl group having 1 to 4 carbon atoms, or a group represented by General Formula 2. Each of R2 and R3 is either hydrogen or an alkyl group having 1 to 4 carbon atoms and may be identical or different. R4 is an aryl group having 6 to 15 carbon atoms. Each of R5 and R6 is any one of hydrogen, an alkyl group having 1 to 4 carbon atoms, or an aryl group having 6 to 15 carbon atoms and may be identical or different
The present invention relates to memory devices incorporating therein a novel memory cell architecture which includes an array of selection transistors sharing a common channel and method for making the same. A memory device comprises a semiconductor substrate having a first type conductivity, a plurality of drain regions and a common source region separated by a common plate channel in the substrate, and a selection gate disposed on top of the plate channel with a gate dielectric layer interposed therebetween. The plurality of drain regions and the common source region have a second type conductivity opposite to the first type provided in the substrate.
A semiconductor structure with improved capacitance of bit lines includes a substrate, a stacked memory structure, a plurality of bit lines, a first stair contact structure, a first group of transistor structures and a first conductive line. The first stair contact structure is formed on the substrate and includes conductive planes and insulating planes stacked alternately. The conductive planes are separated from each other by the insulating planes for connecting the bit lines to the stacked memory structure by stairs. The first group of transistor structures is formed in a first bulk area where the bit lines pass through and then connect to the conductive planes. The first group of transistor structures has a first gate around the first bulk area. The first conductive line is connected to the first gate to control the voltage applied to the first gate.
An energy filter allows, particularly at lower beam energies, a determined spread of the beam energies in order to preserve the beam edges and to spread the Bragg peak at each individual beam energy. The energy filter behaves similarly to a ridge filter and spreads out the Bragg peak of a low energy proton beam (70-100 MeV) so that energy modulation of the beam can be done with steps of 5 mm in one go over the full range of 235-70 MeV. Due to its mechanical flexibility, the energy filter can be placed on the skin of the patient which minimizes the effect of scattering in the filter due to the short distance behind a layer of a plurality of metal particles within a flexible soft plastic sheet to the skin of the patient.
A device operable to accelerate a particle beam to an energy for irradiating a target volume. The device includes a particle accelerator operable in a first working phase in which particles of the particle beam are accelerated to the energy and a second working phase in which the particles of the particle beam are provided and extracted for irradiating the target volume. The device further includes a control device operable to interrupt an irradiation of the target volume if the target volume assumes a predetermined state. The control device is also operable to control the particle accelerator as a function of a comparison between a residual particle number stored in the accelerator and a reference value.
A method is provided for setting a position of a carrier element, arranged in a particle beam device, that holds an object. The particle beam device has a beam generator for generating a particle beam and an objective for focusing the particle beam. The carrier element is movable using a first stepper motor. A movement of the carrier element is started by actuating the first stepper motor using a first motor current in the form of an alternating current. The first motor current is set to a first frequency and a first amplitude. The movement of the carrier element is decelerated by reducing the first frequency and by reducing the first amplitude of the first motor current. The first frequency is reduced to zero during a first period of time. The first amplitude is reduced to an amplitude of a first holding current during the first period of time.
The present invention provides thermal detectors having an optical cavity that is optimized to couple light into a sensor. Light that is on resonance is coupled with the sensor with as high as 100% efficiency, while light off resonance is substantially reflected away. Light that strikes the sensor from the sides (i.e. not on the optical cavity axis) only interacts minimally with sensor because of the reduced absorption characteristics of the sensor. Narrowband sensors in accordance with the present invention can gain as much as 100% of the signal from one direction and spectral band, while receiving only a fraction of the normal radiation noise, which originates from all spectral bands and directions.
A method of examining a sample using a charged-particle microscope, comprising mounting the sample on a sample holder; using a particle-optical column to direct at least one beam of particulate radiation onto a surface S of the sample, thereby producing an interaction that causes emitted radiation to emanate from the sample; using a detector arrangement to detect at least a portion of said emitted radiation, the method of which comprises embodying the detector arrangement to detect electrons in the emitted radiation; recording an output On of said detector arrangement as a function of kinetic energy En of said electrons, thus compiling a measurement set M={(On, En)} for a plurality of values of En; using computer processing apparatus to automatically deconvolve the measurement set M and spatially resolve it into a result set R={(Vk, Lk)}, in which a spatial variable V demonstrates a value Vk at an associated discrete depth level Lk referenced to the surface S, whereby n and k are members of an integer sequence, and spatial variable V represents a physical property of the sample as a function of position in its bulk.
The current invention involves a method and a device for generating and analyzing ions in order to analyze samples directly without sample preparation. The gaseous neutral molecules are desorbed under atmospheric pressure by a desorption method. The desorbed neutral molecules are then transferred into a low pressure region where they are post-ionized by a mist from an electrospray probe tip or by photons from a vacuum UV source. The generated ions are then focused in a time varying electric field in the low pressure chamber before they are transferred into a mass spectrometer or ion mobility spectrometer for further analysis.
An ion trap for a mass spectrometer has a conductive central electrode with an aperture extending from a first open end to a second open end. A conductive first electrode end cap is disposed proximate to the first open end thereby forming a first intrinsic capacitance between the first end cap and the central electrode. A conductive second electrode end cap is disposed proximate to the second open end thereby forming a second intrinsic capacitance between the second end cap and the central electrode. A first circuit couples the second end cap to a reference potential. A signal source generating an AC trap signal is coupled to the central electrode. An excitation signal is impressed on the second end cap in response to a voltage division of the trap signal by the first intrinsic capacitance and the first circuit.
In a mass spectrometer having an auto-tuning function for sequentially executing parameter adjustments for each part in accordance with a prescribed procedure, a long time is required to tune all of the sections. Therefore, sections which require parameter adjustments are divided into block units, and tuning is executed in a predetermined block order. In each block, tuning is first executed on a representative part of the block, and the result is compared with past tuning results. If the values of both results fall within a prescribed range, the tuning of other sections included in the block is omitted.
Disclosed is a quadrupole mass spectrometer, which is capable of, during an SIM measurement, maximally reducing a settling time-period necessary for an operation of changing an input voltage to a quadrupole mass filter in a staircase pattern, and preventing unwanted ions from excessively entering a detector during a course of changing between a plurality of mass values. Under a condition that a response speed of a DC voltage U to be applied to quadrupole electrodes is less than that of an amplitude of a high-frequency voltage V, a control section 10 is operable to rearrange the mass values in descending order of mass value, and an optimal settling-time calculation sub-section 101 is operable to determine a settling time-period for each of the mass values, based on a mass-value difference and a post-change mass value.
An apparatus includes a housing having a front surface, a rear surface, and at least one sidewall therebetween and a plurality of optical windows formed in the housing to allow light to pass through from multiple directions. The apparatus further includes a plurality of photo detectors to generate electrical signals based on received light, where each of the plurality of photo detectors is disposed within a respective one of the plurality of optical windows. The apparatus also includes a control circuit coupled to the plurality of photo detectors to receive the electrical signals, determine light variations from the electrical signals, and determine a change in position of an object based on variation ratios of the light variations received by at least one pair of photo detectors within the plurality of photo detectors in response to determining the light variations.
An embodiment of present invention discloses an optoelectronic device package including a first auxiliary energy receiver having a first energy inlet and a side wall for substantially directing energy far away from the first energy inlet; an optical element optically coupled to the first auxiliary energy receiver and having a recess facing the first energy inlet; and an optoelectronic device optically coupled to the optical element and receiving the energy from the first energy inlet.
According to an example embodiment, a light-sensing apparatus may include an array of light-sensing pixels, a first gate driver, and a signal output unit. Each of the light-sensing pixels may include a light sensor transistor configured to sense light, a switch transistor configured to output a light-sensing signal from the light sensor transistor, and a conductive light-shielding film on a light-incident surface of the switch transistor. The light sensor transistor and the switch transistor may have the same oxide semiconductor transistor structure. The first gate driver may be configured to provide a gate voltage and a negative bias voltage to each of the light-sensing pixels. The signal output unit may be configured to receive the light-sensing signal from each of the light-sensing pixels and output a data signal.
A photoelectric conversion device has a first photoelectric converter which converts light into a current, a second photoelectric converter which converts light into a current, a first bipolar transistor which amplifies the current input to a base thereof from the first photoelectric converter, and outputs the amplified current from each of a plurality of emitters thereof, a second bipolar transistor which amplifies the current input to a base thereof from the second photoelectric converter, and outputs the amplified current from each of a plurality of emitters thereof, and a current adder which adds the current from one emitter of the plurality of emitters of the first bipolar transistor, and the current from one emitter of the plurality of emitters of the second bipolar transistor, thereby obtaining a sum current.
A heating element includes a support made of flexible material and a flexible grid structure with an electrically conductive paste disposed on the support.
The present application relates to iron based glass forming alloys and their manufacture in powder, cored wire and stick electrode form to produce feedstock for a wide variety of weld overlay hardfacing application techniques. The alloys when welded form structures which are extremely hard and correspondingly extremely wear resistant. The novel approach of these alloys allow the replacement of conventional high hardness and wear resistant hardfacing alloys which are often composite materials made up of a binder and hard particles such as carbides, borides, borocarbides, nitrides, etc.
A laser processing machine has an expanded operating space so that larger workpieces can be processed and/or the spatial requirement for the laser processing machine is reduced.
A connecting piece for a tool of a multi-axis machining center has a support on the machining center side, a holder at the tool side and a pushing device which elastically pushes the holder into a defined position against the support. The pushing force of the pushing device can be varied during the operation of the machining center.
A welding device for powder welding is described, which comprises a welding head for transportation of at least one welding electrode to a welding area, and a powder transportation device for transportation of powder from a container to the welding area. The powder transportation device comprises at least a first pipe which at a first end has an opening which is arranged to be placed in the container in order to transport fluxing agent from the container. The powder transportation device comprises at least a first ejector which is connected to the second end of the first pipe and which is arranged to transport powder from the container via the first pipe using pressurized gas.
A carrier is provided for a control unit of a motor vehicle. The carrier includes, but is not limited to at least one material section for fastening to the body of a motor vehicle. It is provided that the carrier is designed for receiving at least two control units, which via an insertion region of the carrier can be mounted to the carrier from the same side. A control unit is also provided for installation in a carrier and a motor vehicle is provided with a carrier.
An electrical connecting cable with a flexible electrical cable and with at least one electrical plug connector at one end of the cable, with the electrical cable including a bundle of conductors consisting of insulated stranded wires, a foil shield enclosing the bundle of conductors, and a protective sheath encasing the foil shield and serving as the outer surface of the cable. The plug connector includes a metallic plug connector housing, preferably a round housing, holding insulated contacts and a molded-on shield sleeve with which the stranded wires and the foil shield are connected in an electrically conductive manner. The foil shield includes at least one electrically conductive shield tape and the protective sheath includes at least one electrically non-conductive sheath tape that are both wrapped at an angle spiral-like with a lateral overlap along the stranded wires around the bundle of conductors and the shield sleeve.
The invention is directed to a polymer thick film conductive composition comprising (a) a conductive silver-coated copper powder; and (b) an organic medium comprising two different resins and organic solvent, wherein the ratio of the weight of the conductive silver-coated copper powder to the total weight of the two different resins is between 5:1 and 45:1.The invention is further directed to a method of electrode grid and/or bus bar formation on thin-film photovoltaic cells using the composition and to cells formed from the method and the composition.
An H-pattern solar cell structure includes at least one busbar disposed in a first direction on an upper surface of a semiconductor substrate, and parallel gridlines formed on the semiconductor substrate such that each gridline extends over and contacts each busbar, wherein each gridline includes a central gridline portion and at least one endpoint structure disposed on at least one end thereof, the endpoint structure having a nominal width that is at least 1.5 times the width of the central gridline portion. The gridlines are co-extruded with a sacrificial material such that a base portion of each gridline forms a flattened structure with sacrificial material formed thereon. The endpoint structures are formed such that Each central gridline portion forms a raised vertex portion extending upward from the upper surface of each busbar.
In a thin film photoelectric conversion deice fabricated by addition of a catalyst element with the use of a solid phase growth method, defects such as a short circuit or leakage of current are suppressed. A catalyst material which promotes crystallization of silicon is selectively added to a second silicon semiconductor layer formed over a first silicon semiconductor layer having one conductivity type, the second silicon semiconductor layer is partly crystallized by a heat treatment, a third silicon semiconductor layer having a conductivity type opposite to the one conductivity type is stacked, and element isolation is performed at a region in the second silicon semiconductor layer to which a catalyst material is not added, so that a left catalyst material is prevented from being diffused again, and defects such as a short circuit or leakage of current are suppressed.
A heat recycling system for recycling heat from an electronic device includes a pipe with an inside tube and an outside tube coiled around the inside tube. The inside tube is connected to a first airduct to receive heated air from the electronic device. The outside tube is to receive cooling air from outside. A number of thermoelectric modules are formed in walls of the inside tube. A first end of each thermoelectric module is inserted into the outside tube, and a second end of each thermoelectric module is inserted into the inside tube. Therefore, the number of thermoelectric modules may generate current.
The present invention is a device and method for teaching note locations, fretboard patterns, scales, and chords on the fingerboard of a fretted stringed instrument (“fretboard”), such as an electric or acoustic guitar. The invention comprises a set of independently affixable fretboard adhesive labels (“stickers”) that adhere to the surface of the stringed instrument, using a mild adhesive, so as not to damage the instrument, and a number of markings, which indicate musical indicia. The device is applied to the instrument by slipping the various individual stickers between the corresponding frets and strings of the stringed instrument and affixing the stickers directly to the fretboard.
According to the invention, there is provided seed and plants of the corn variety designated CV095080. The invention thus relates to the plants, seeds and tissue cultures of the variety CV095080, and to methods for producing a corn plant produced by crossing a corn plant of variety CV095080 with itself or with another corn plant, such as a plant of another variety. The invention further relates to corn seeds and plants produced by crossing plants of variety CV095080 with plants of another variety, such as another inbred line. The invention further relates to the inbred and hybrid genetic complements of plants of variety CV095080.
The present invention is in the field of soybean variety WN0912893 breeding and development. The present invention particularly relates to the soybean variety WN0912893 and its progeny, and methods of making WN0912893.
The present invention relates generally to the field of molecular biology and concerns a method for increasing various plant yield-related traits by increasing expression in a plant of a nucleic acid sequence encoding an ammonium transporter (AMT) polypeptide. The present invention also concerns plants having increased expression of a nucleic acid sequence encoding an AMT polypeptide, which plants have increased yield-related traits relative to control plants. The invention also provides constructs useful in the methods of the invention.
Provided is an isolated polypeptide having triterpene methyltransferase activity. Also provided is an isolated nucleic acid molecule that encodes the triterpene methyltransferase polypeptides; a vector comprising the nucleic acid molecules that encode the triterpene methyltransferase polypeptides; and a host cell(s) transfected with the aforementioned nucleic acid molecule or vector. In another aspect, a method of producing a methylated triterpene is provided. The method comprises providing a metabolizable carbon source to a host cell transfected with a nucleic acid molecule that encodes a triterpene methyltransferase under conditions sufficient for production of a methylated triterpene. The method optionally further comprises isolating the methylated triterpene produced by the host cell.
A dehydration sensor having a stable, printable, buffered-ink composition that enables one to miniaturize the detection zone and permits both buffer and indicator dye to be applied in the same area of a detection zone, without need for a conventional, large buffer pad region. The ink composition includes a weak polymeric base as its primary buffering agent.
Processes for the conversion, under conditions and with a catalyst system effective for olefin metathesis, of hydrocarbon feedstocks comprising butylene, for example all or a large proportion of a single C4 olefin isomer such as butene-1, are described. Olefin products, and particularly propylene, are formed in the presence of a catalyst comprising a solid support and a tungsten hydride bonded to alumina present in the support. This occurs despite the expectation that the olefin metathesis reaction mechanism leads to the formation of olefin products having other carbon numbers.
This disclosure relates to an EMM-12 molecular sieve having, in its as-synthesized form and in calcined form, an X-ray diffraction pattern including peaks having a d-spacing maximum in the range of 14.17 to 12.57 Angstroms, a d-spacing maximum in the range of 12.1 to 12.56 Angstroms, and non-discrete scattering between about 8.85 to 11.05 Angstroms or exhibit a valley in between the peaks having a d-spacing maximum in the range of 10.14 to 12.0 Angstroms and a d-spacing maximum in the range from 8.66 to 10.13 Angstroms with measured intensity corrected for background at the lowest point being not less than 50% of the point at the same XRD d-spacing on the line connecting maxima in the range of 10.14 to 12.0 Angstroms and in the range from 8.66 to 10.13 Angstroms.
A process for preparing an alkylated hydroxyl aromatic compound comprising reacting(a) a hydroxyl aromatic compound (I), having the following structure; wherein n 1, 2 or 3; m is 0, 1, 2, or 3 and R1 is Hydrogen or hydrocarbyl group; and (b) at least one β-branched primary alcohol component in the presence of an alkylating catalyst thereby producing an alkylated hydroxyl aromatic compound.
Disclosed is an energetic reactive plasticizer for a plastic bonded explosive (PBX), and specifically an energetic reactive plasticizer for PBX which has high performance and insensitiveness without a plasticizer leak by being bonded with a polymer binder for a plastic bonded explosive.
Process for the preparation of substituted dimethyl-(3-aryl-butyl)-amine compounds. The process comprises dehydration by heterogeneous catalysis of substituted 4-dimethylamino-2-aryl-butan-2-ol compounds, to form substituted dimethyl-(3-aryl-but-3-enyl)-amine intermediates, which are then converted by hydrogenation with hydrogen to substituted dimethyl-(3-aryl-butyl)-amine compounds.
PROBLEMThere is provided a melting method of (meth)acrylic acid crystal which is capable of providing a higher quality of (meth)acrylic acid without carrying out an additional purification treatment to (meth)acrylic acid obtained by a crystallization operation accompanied by melting of (meth)acrylic acid. In addition, there is provided a simple method for adjusting a content of polymerization inhibitor in a product (meth)acrylic acid.SOLUTIONIn the crystallization method melting (meth)acrylic acid crystal while wetting with the crystalline molten liquid, a polymerization inhibitor is added to a molten liquid melted after initiation of melting, and all of crystal is melted while circulating and feeding the molten liquid containing said polymerization inhibitor to the crystal. In addition, a content of polymerization inhibitor in product (meth)acrylic acid is adjusted by adding a predetermined amount of polymerization inhibitor corresponding to a product specification to the molten liquid melted after initiation of melting.
Disclosed is a process for the production and purification of glycolic acid or glycolic acid derivatives by the carbonylation of methylene dipropionate in the presence of a solid acid catalyst and propionic acid. This invention discloses hydrocarboxylations and corresponding glycolic acid separations wherein the propionic acid stream is readily removed from the glycolic acid and the propionic acid is recycled.
A process for preparing carboxylic acid derivatives of the formula H—(C═O)—R, R is OR1 or NR2R3, R1 is optionally substituted C1-C15-alkyl, C5-C10-cycloalkyl, C5-C10-heterocyclyl, C5-C10-aryl or C5-C10-heteroaryl, substituents are C1-C15-alkyl, C1-C6-alkoxy, C5-C10-cycloalkyl or C5-C10-aryl; R2 and R3 are independently hydrogen or optionally substituted C1-C15-alkyl, C5-C10 cycloalkyl, C5-C10-heterocyclyl, C5-C10-aryl or C5-C10-heteroaryl, substituents are selected from the group consisting of C1-C15-alkyl, C5-C10-cycloalkyl and C5-C10-aryl or R2 and R3 together with the nitrogen atom form a five- or six-membered ring which optionally comprises one or more heteroatoms selected from O, S and N and bearing the substituent R4, R4 is hydrogen or C1-C6-alkyl; by reacting a reaction mixture comprising carbon dioxide, hydrogen and an alcohol of the formula R1—OH or an amine of the formula NHR2R3 in the presence of a catalyst comprising gold at a pressure from 0.2 to 30 MPa and a temperature from 20 to 200° C. in a hydrogenation reactor.
A naphthopyran compound represented by the formulae (I) to (II) wherein: —mi, Hi2, p, q are each an integer comprised from O to 4 or 5 inclusive; —Ri, R2 and R4, represent a group selected from halogen, H, —Ra, aryl, —OH, —ORa, —SH, —SRa, —NH2, —NR8RaI, —NRbRc, —NRal-CORa, —NRaiCO(aryl), —NRai aryl, —N-aryfe, —N(aryl)CO(aryl), —CO—R3, —CO2R3I, —OC(O)—Rd, and —X—(Re)—Y, and linear or branched (Ci-Ci8) perfluoroalkyl group, wherein R3, Rai, Rb, Rc, X, Y, Re, Rd are as defined into the description; —Zi re resent a group selected from: (formules).
In the production of phthalic anhydride by the oxidation of ortho-xylene with air, the ortho-xylene loading is increased without increasing the likelihood of explosion by insulating the system to avoid cold spots to keep the ortho-xylene at a temperature above its dew point; in addition the system may be electrically interconnected and grounded to reduce the risk of spark initiated explosions or deflagrations.
This invention describes the discovery and synthesis of N-thiolated 2-oxazolidinones as a new class of anti bacterial agents. These compounds can be synthesized from 2-oxazolidinones by Ndeprotection and N-sulfenylation. These new substances were found to exhibit potent anti-bacterial activity, including bacteriostatic properties against Staphylococcus spp., including methicillin resistant Staphylcoccus aureus (MRSA), and Bacillus spp., including Bacillus anthracis.
The invention relates to compounds of formula I and pharmaceutically acceptable derivatives thereof, compositions comprising an effective amount of a compound of formula I or a pharmaceutically acceptable derivative thereof, and methods for treating or preventing a condition such as pain, UI, an ulcer, IBD and IBS, comprising administering to an animal in need thereof an effective amount of a compound of formula I or a pharmaceutically acceptable derivative thereof.
The present invention is directed to phosphonic acid compounds useful as serine protease inhibitors, compositions thereof and methods for treating inflammatory and serine protease mediated disorders.
The present disclosure is generally directed to compounds which can inhibit AAK1 (adaptor associated kinase 1), compositions comprising such compounds, and methods for inhibiting AAK1.
The present invention is directed to salts of 3-(3-amino-2-(R)-hydroxy-propyl)-1-(4-fluoro-phenyl)-8-(8-methyl-naphthalen-1-ylmethyl)-1,3,8-triaza-spiro[4.5]decan-4-one, pharmaceutical compositions containing them and their use in the treatment of disorders and conditions modulated by NOP, for example depression, anxiety, alcohol abuse, etc. The present invention is further directed to process(es) for the preparation of 3-(3-amino-2-(R)-hydroxy-propyl)-1-(4-fluoro-phenyl)-8-(8-methyl-naphthalen-1-ylmethyl)-1,3,8-triaza-spiro[4.5]decan-4-one and its corresponding salts.
In certain aspects, the present invention provides compositions and methods for increasing red blood cell and/or hemoglobin levels in vertebrates, including rodents and primates, and particularly in humans.
The present invention features compositions and methods that make use of complexes comprising one or more inhibitory nucleic acids and a targeting polypeptide, wherein the targeting polypeptide consists of a cell surface receptor ligand. The compositions can be used in methods of silencing gene expression in a cell, in delivering agents to a target cell, and in treating or preventing a disease or disorder in a subject.
The invention provides novel B7-H3 and B7-H4 polypeptides useful for co-stimulating T cells, isolated nucleic acid molecules encoding them, vectors containing the nucleic acid molecules, and cells containing the vectors. Also included are methods of making and using these co-stimulatory polypeptides.
Alternative and improved approaches to the heterologous expression of the proteins of Neisseria meningitidis and Neisseria gonorrhoeae. These approaches typically affect the level of expression, the ease of purification, the cellular localization, and/or the immunological properties of the expressed protein.
A fusion protein of the invention comprises an immunoglobulin Fc region and a first target protein linked to the immunoglobulin Fc region. The first target protein comprises a collagen XVIII fragment, preferably endostatin. The immunoglobulin Fc region preferably comprises a hinge region, a CH2 region, and a CH3 region.
A hyperbranched polyether polyol obtained by a ring-opening reaction between a hydroxyalkyloxetane (a1) and a monofunctional epoxy compound (a2), wherein the polyether polyol includes a primary hydroxyl group (H1) and a secondary hydroxyl group (H2) in the molecular structure thereof, and has a number average molecular weight (Mn) of 1,000 to 4,000 and a hydroxyl value of 150 to 350 mg·KOH/g.
A two part non-sag polyurethane construction sealant or adhesive is provided with the properties of low modulus, high elongation, good paint adhesion, and primerless adhesion to concrete surfaces. The sealant or adhesive is prepared using a polyol, and optionally an epoxy silane and/or a melamine compound, in the base component of the formulation; and a prepolymer reaction product including the residues of xylenol or xylenol and an additional polyol, and a polymeric isocyanate, an aromatic diisocyanate, or a polymeric isocyanate and an aromatic diisocyanate, and optionally an epoxy silane and/or a melamine compound, in the activator component of the formulation.
A curable composition for imprints, comprising a polymerizable monomer (Ax) represented by the following formula: wherein Ar represents a divalent or trivalent aromatic group, X represents a single bond or an organic linking group, R1 represents a hydrogen atom or an alkyl group, and n represents 2 or 3. The content of the polymerizable monomer (Ax) is 45% by mass or more, or the total content of solid polymerizable monomers and liquid polymerizable monomers with high viscosity is less than 50% by mass.
This invention provides a polyfunctional polymer having high stereoregularity, in particular, isotacticity, and provides a production process thereof. The present invention relates to a polymer having, in a molecule, a repeating unit represented by General Formula (2): wherein R1 and R2 are different, and each represents a hydrogen atom, an alkyl group and an aryl group; * represents an asymmetrical carbon, the polymer containing meso diad (m) and racemo diad (r) at a proportion of 60:40 to 100:0 (m:r). The invention also relates to chemical modifications and a production process of the polymer.
The invention is directed to a process for the production of high density polyethylene by polymerization of ethylene in the presence of a supported chromium oxide based catalyst and an activator characterized in that the activator comprises the reaction mixture of a boron compound and/or an alkyl aluminum compound and a nitrogen containing compound wherein the boron compound is a (C1-C10) alkyl boron compound or a (C5-C20) aromatic boron compound, wherein the alkyl aluminum compound is an organo aluminum compound having the formula AIR3 in which R is a hydrocarbon radical containing 1-10 carbon atom and wherein the nitrogen containing compound comprises —NH2, —NHR, —NR2, wherein R may be an alkyl or a substituted alkyl having from 1 to 40 carbon atoms.
The present invention relates to a method for producing a catalyst slurry blend suitable for polymerizing ethylene in an ethylene polymerization loop reactor for obtaining an at least trimodal polyethylene product, comprising the steps of: transferring a first ethylene polymerization catalyst at a first mass flow rate to a mixing vessel, simultaneously transferring a second ethylene polymerization catalyst at a second mass flow rate to said mixing vessel, thereby in situ providing a catalyst slurry blend, wherein said second ethylene polymerization catalyst is different from the first ethylene polymerization catalyst, adjusting and monitoring said first and second mass flow rates, thereby obtaining said catalyst slurry blend at a concentration suitable for polymerizing ethylene, and feeding said catalyst slurry blend to an ethylene polymerization double loop reactor producing said at least trimodal polyethylene product.
Phosphorus-containing benzoxazine-based bisphenols and derivatives thereof are disclosed. The phosphorus-containing benzoxazine-based bisphenols are prepared by reacting DOPO with benzoxazine to form the phosphorus-containing benzoxazine-based bisphenols. The phosphorus-containing benzoxazine-based bisphenols can further to form advanced epoxy resins. The advanced epoxy resins can further be cured to form flame retardant epoxy thermosets.
Enzymes in the body vary among different species, and also vary among individuals of the same species. Thus, it has been demanded to develop a novel steroid-containing pharmaceutical preparation which can release a drug in a manner independent of the enzymes present in the body, and which is expected to have an efficacious therapeutic effect.Disclosed is a high-molecular weight conjugate of a steroid, comprising a structure in which a carboxylic acid group of a polymer having a polyethylene glycol moiety and a succinic acid monoamide moiety having two or more succinic acid monoamide units is ester-bonded to a hydroxy group in the steroid.
The present invention relates to thermoplastic molding compositions composed of the following components: (A) at least one polyarylene ether (A1) having an average of at most 0.1 phenolic end groups per polymer chain, and at least one polyarylene ether (A2) having an average of at least 1.5 phenolic end groups per polymer chain, (B) at least one fibrous or particulate filler, and (C) optionally further additives and/or processing aids. The present invention further relates to a process for producing the thermoplastic molding compositions of the invention, the use of these for producing moldings, fibers, foams, or films, and to the resultant moldings, fibers, foams, and films.
The roller chain comprises inner link plates, a bush, outer link plates, a connecting pin, and a roller. Each of the chain components has a zinc-iron alloy ground film formed on an iron-based base material by impact zinc plating and a first coating film formed by using a water-based rust preventive paint including zinc, nitrate, and an organic compound having a mercapto group other than a mercapto group-containing silane coupling agent. Then a second coating film is formed on the first coating film by using the top coat paint comprising a pigment, sodium silicate, and an acrylic emulsion or a polyurethane water-based composition.
The invention relates to a composition containing a particulate solid, an organic or aqueous medium, and a compound with a head group derived from phosphoric acid. The invention further relates to novel compounds, and the use of the compound as a dispersant.
Disclosed herein is a blend comprising: (a) 5 to 50 percent by weight of the micronized poly(phenylene ether), wherein the mean particle size of the poly(phenylene ether) is 9 microns or less; (b) 50 to 95 percent by weight of a thermoplastic polyurethane; wherein the weight percents are based on the total weight of the blend. Also disclosed are processes for preparing such blends as well as articles derived therefrom.
A two-component epoxy resin composition, including: a resin component which includes at least one epoxy resin and at least one aldehyde, and a hardener component which includes at least one polyamine having at least one primary amino group.
A composition comprising the Components (A) at least one linear olefin polymer; (B) 0.05 to 2%, relative to the weight of Component (A), of at least one photoinitiator; and (C) 0.05 to 5%, relative to the weight of Component (A), of at least one co-additive containing one or more double bonds.
In one aspect, compositions provide antimicrobial therapy as topical disinfectants. Particularly, one aspect relates to an alcohol containing antimicrobial composition that includes at least one paraben, a redox compound and an organic acid at a concentration of from about 1.5 percent to about 10 percent by weight, based on the total weight of the composition. In other aspects, antimicrobial compositions are used to topically sanitize wounds, skin areas and/or to disinfect surgical instruments or other surfaces. Still, in further aspects, methods, devices and kits relating to an antimicrobial composition are provided.
Compositions, methods and kits are provided for the treatment of migraines. The compositions, methods and kits include an effective dose of trimethobenzamide and an ethanolamine antihistamine that, when administered to an individual suffering from migraine headaches, will alleviate symptoms associated with the migraine headaches. Compositions, methods, and kits for the treatment of migraines include pharmaceutical compositions of trimethobenzamide and diphenhydramine.
The present invention provides dialkyl ether compounds and pharmaceutically acceptable salts thereof, compositions containing the same and one or more active agents, and methods of administering active agents with the same.
One embodiment described herein is related to methods and compositions, such as nutraceutical formulations and dietary supplements, comprising C16:1n7-palmitoleate or derivatives thereof. The methods and compositions comprising C16:1n7-palmitoleate, or derivatives thereof, safely and effectively prevent or mitigate manifestations of cardiovascular disease, including coronary artery disease and the accumulation of cholesterol or lipid deposits in the blood vessels of a subject.
Provided is a compound having a spiro chiral carbon backbone, a stereoisomer thereof, an enantiomer thereof, an in vivo hydrolysable precursor thereof, or a pharmaceutically acceptable salt thereof. The compound having the spiro chiral carbon backbone has excellent osteoblast differentiation activity, mast cell inhibitory activity, and fatty acid synthesis inhibitory activity in the liver. Therefore, the compound can be expected to play an innovative role in treatment of osteoporosis, fatty liver, and obesity.
The present invention provides methods of contacting a protein kinase C (PKC) activator with a PKC activator in a manner sufficient to stimulate the synthesis of proteins sufficient to consolidate long-term memory. The present invention also provides methods of contacting a protein kinase C (PKC) activator with a PKC activator in a manner sufficient to downregulate PKC.
Compositions, methods and systems are provided for pulmonary or nasal delivery of two or more active agents via a metered dose inhaler. In one embodiment, the compositions include a suspension medium, active agent particles, and suspending particles, in which the active agent particles and suspending particles form a co-suspension within the suspension medium.
Provided are tris-quaternary ammonium compounds which are modulators of nicotinic acetylocholine receptors. Also provided are methods of using the compounds for modulating the function of a nicotinic acetylcholine receptor, and for the prevention and/or treatment of central nervous system disorders, substance use and/or abuse and or gastrointestinal tract disorders.
An improved process for the preparation of aryl substituted olefinic amines such as (2S)-(4E)-N-methyl-5-[3-(5-isopropoxypyridin)yl]-4-penten-2-amine and (2S)-(4E)-N-methyl-5-[3-(5-methoxypyridin)yl]-4-penten-2-amine and new intermediates used in said process.
There are provided compounds of formula (I), wherein R1, R6, R8, Q2, Q3, Q3a, Q4, L and A have meanings given in the description, and pharmaceutically-acceptable salts thereof, which compounds are useful in the treatment of diseases in which inhibition of the activity of a member of the MAPEG family is desired and/or required, and particularly in the treatment of inflammation and/or cancer.
The present application relates to novel C-1 substituted analogues of pancratistatin and 7-dexoypancratistatin of Formula (I), pharmaceutical compositions thereof and the use of said compounds of Formula (I) in the treatment of cancer The application also relates to processes for the preparation of said compound of Formula (I) and intermediates thereof.
The present invention provides a novel crystalline form of nilotinib hydrochloride, process for its preparation and pharmaceutical compositions comprising it.
The present invention provides a compound which has an effect of inhibiting amyloid-β production and is useful as a therapeutic agent for diseases induced by production, secretion and/or deposition of amyloid-β proteins. The present invention relates to a compound represented by formula (I) or a pharmaceutically acceptable salt or solvate thereof: wherein A is optionally substituted carbocyclic diyl or optionally substituted heterocyclic diyl; B is an optionally substituted carbocyclic group or an optionally substituted heterocyclic group; R1 is a group such as optionally substituted lower alkyl; R2 is a group such as hydrogen; and R3a and R3b are each independently a group such as hydrogen, provided that the following compound is excluded.
A novel combination comprising the MEK inhibitor N-{3-[3-cyclopropyl-5-(2-fluoro-4-iodo-phenylamino)6,8-dimethyl;-2,4,7-trioxo-3,4,6,7-tetrahydro-2H-pyrido[4,3-d]pyrimidin-1-yl]phenyl}acetamide, or a pharmaceutically acceptable salt or solvate thereof, with a B-Raf inhibitor, particularly N-{3-[5-(2-Amino-4-pyrimidinyl)-2-(1,1-dimethylethyl)-1,3-thiazol-4-yl]-2-fluorophen-}-2,6-difluorobenzenesulfonamide or a pharmaceutically acceptable salt thereof, pharmaceutical compositions comprising the same and methods of using such combinations and compositions in the treatment of conditions in which the inhibition of MEK and/or B-Raf is beneficial, eg. cancer.
Provided herein are compounds of formula (I-A), (I-B), (I-C), or (I-D), pharmaceutical compositions comprising the compounds, and methods of use thereof. The compounds provided herein modulate kinase activity, including PI3 kinase activity, and are useful for treating diseases and conditions associated with kinase activity, including diseases and conditions associated with PI3 kinase activity.
The present invention provides low hygroscopic forms of aripiprazole and processes for the preparation thereof which will not convert to a hydrate or lose their original solubility even when a medicinal preparation containing the aripiprazole anhydride crystals is stored for an extended period.
The present invention relates to compounds of formula I hetaryl I, hetaryl II, R1, R2, R3, Y, m, and o or to pharmaceutically active acid addition salts thereof. The present compounds of formula I are modulators for amyloid beta and thus, they may be useful for the treatment or prevention of a disease associated with the deposition of β-amyloid in the brain, in particular Alzheimer's disease, and other diseases such as cerebral amyloid angiopathy, hereditary cerebral hemorrhage with amyloidosis, Dutch-type (HCHWA-D), multi-infarct dementia, dementia pugilistica and Down syndrome.
The present invention relates to a compound which is 6-amino-2-{[(1S)-1-methylbutyl]oxy}-9-[5-(1-piperidinyl)pentyl]-7,9-dihydro-8H-purin-8-one: in the form of a maleate salt, may be useful in the treatment of various disorders, for example the treatment of allergic diseases and other inflammatory conditions for example allergic rhinitis and asthma, the treatment of infectious diseases and cancer, and may also be useful as vaccine adjuvants.
Mixtures are described comprising two or more compounds selected from at least two of the following groups: i) salicylic acid and/or its functional analogous products (ESA), ii) promoting compounds (PRO) and iii) modulating compounds (MOD), and their use for stimulating the natural defense systems of plants and for inducing resistance in plants. The use is also described, of two or more compounds selected from at least two of the following groups: one or more compounds belonging to the ESA group and/or one or more compounds belonging to the PRO group and/or one or more compounds belonging to the MOD group, individually adopted by means of application programs which envisage alternating application, to stimulate the natural defense systems of plants and inducing resistance in plants.
A method of treating Friedreich's Ataxia with compounds of formula I including pharmaceutically acceptable salts, tautomers or stereoisomers of compounds of formula Lp.
The present invention relates to a cleaning composition for removing cellular components from tissue for transplantation derived from humans and animals. More particularly, the present invention relates to a cleaning composition for treating tissue for transplantation comprising a polyoxyethyleneglycol C14-C20alkyl ether as a first protein solubilizing component, a C6-C8alkylphenol polyethoxylate as a first lipid solubilizing component, a C10-C16alkyl glycoside as a second protein solubilizing component and a C9-C12alkylphenoxy polyethoxy ethanol as a second lipid solubilizing component.
The present invention provides novel compounds useful as proteasome inhibitors. The invention also provides pharmaceutical compositions comprising the compounds of the invention and methods of using the compositions in the treatment of various diseases.
A catheter lock solution which is a catheter lock preparation having a bacteriostatic property at physiological osmotic pressure without practically containing a bacteriostatic component such as a preservative, an antimicrobial agent, or an antibiotic and having high safety, characterized in that the preparation contains a weak acid having an acid dissociation constant (pKa) of 3.0 to 6.5 as a buffer, a pH of the solution is less than 6.0, preferably from 3.0 to about 5.5, an osmotic pressure ratio is from 0.5 to 3.0, and a pH change (variation) can be suppressed to less than the 6.0 with the weak acid, and a container containing the catheter lock solution.
The invention concerns novel biotinylated hexadecasaccharides of general formula (I) wherein: Biot is a biotin derivative; R, R1 and R2, represent independently of one another a C1-C6 alkoxy or and —OSO3; R3 represents a C1-C6 alkoxy or an —OSO3, or R3 constitutes a —O—CH2— bridge; Pe represents a saccharide concatenation; as well as their pharmaceutically acceptable salts, and their use as medicines.
This invention provides a therapeutic target for pancreatic cancer. The invention further provides methods of screening of new therapeutic agents using the target. The invention also provides a pharmaceutical composition comprising fasudil or derivatives thereof for pancreatic cancer treatment, and a kit comprising such a pharmaceutical composition.
The invention relates to novel oligomer analogues and their use in oligonucleotide-based therapies. More specifically, the invention concerns oligonucleotides carrying lipid molecules and their use as potential inhibitors of gene expression.
The present invention relates to bicyclic nucleosides and oligomeric compounds comprising at least one such nucleoside. These oligomeric compounds typically have enhanced binding affinity and nuclease resistance properties compared to unmodified oligomeric compounds. The oligomeric compounds are useful, for example, for investigative and therapeutic purposes.
A purified paracrine factor of a mesenchymal stem cell, such as a Secreted frizzled related protein (Sfrp) is useful to reduce cell death and/or tissue injury associated with ischemic conditions.
Disclosed herein are methods and compositions of treating a subject suffering from a wound. In exemplary examples, the method involves elevating MCPIP levels in a subject in need. Elevating MCPIP levels may involve direct administration (e.g. delivery of protein) or indirect administration (e.g. delivery vehicle capable of increasing expression of MCPIP).
A method for treatment of severe diffuse acute respiratory distress syndrome in an intubated-ventilated patient which includes sedating said patient with at least one alpha-2 agonist, maintaining spontaneous ventilation and applying pressure support ventilation of at least 5-10 cmH2O combined to a high positive end expiratory pressure (PEEP) of 10-24 cmH2O. A pharmaceutical composition containing at least one alpha-2 agonist suitable for treatment of ARDS in combination with, if appropriate, at least one sedative agent which does not depress ventilatory drive is also disclosed.
In certain aspects, the present invention provides compositions and methods for increasing thermogenic adipocytes (e.g., brown adipocytes or other UCP-1 expressing adipocytes) by administering an antagonist of an ActRIIB signaling pathway. Examples of such antagonists include ActRIIB polypeptides, anti-ActRIIB antibodies, anti-myostatin antibodies, anti-GDF3 antibodies, anti-Nodal, anti-activin, and anti-GDF 11 antibodies. A variety of metabolic and other disorders may be treated by causing an increase in thermogenic adipocytes.
This invention relates to novel whitening agents for cellulosic substrates. The whitening agents are comprised of at least two components: at least one chromophore component and at least one polymeric component. Suitable chromophore components generally fluoresce blue, red, violet, or purple color when exposed to ultraviolet light, or they may absorb light to reflect these same shades. The whitening agents are further characterized by having a dispersion component value of the Hansen Solubility Parameter of less than or equal to about 17 MPa0.5. This invention also relates to laundry care compositions including but not limited to liquid and/or powder laundry detergent formulations and rinse added fabric softening (RAFS) compositions that comprise such whitening agents.
Provided are lubrication oil compositions. The compositions contain certain acid esters (monoesters and/or diesters) of polytrimethylene ether glycol, certain additives, and optionally a polytrimethylene ether glycol, and the use of such compositions as lubrication oils.
A functional fluid comprising a major amount of an oil of lubricating viscosity, and an oil soluble amount of glycerol carbonate or an oil soluble amount of a borated glycerol.
The invention relates to a lead-free sliding bearing material having a Cu-based or CuSn-based sintered matrix and a solid lubricant. The solid lubricant contains hexagonal boron nitride in a fine-grained distribution with a mean particle size of 10 μm or less, wherein agglomerates of the particles of hexagonal boron nitride are not greater than 200 μm. The invention also relates to a sintering powder for producing the sliding bearing material, a sliding bearing composite material having a steel protective layer and a bearing layer composed of such a sintered-on sliding bearing material. The invention also relates to a sliding element composed of a sliding bearing composite material of the type mentioned above.
A homopolymer of a monomer selected from those having the general formula: wherein: R1 is H or CH3; R2 is H or an alkyl group having from 1 to about 4 carbon atoms; A is a straight or branched chain alkyl group having from 1 to 10 carbon atoms; and R3, R4, and R5 each are independently an alkyl group having from 1 to 6 carbon atoms; or a copolymer of such monomers as acrylate, acrylamide or methacrylamide may be used to disperse metal sulfides prior to their forming scales during the production and transportation of crude oil. Terpolymers of dimethyldiallylammonium salt, 2-hydroxypropyl acrylate; and acrylic acid may also be used for this purpose. The production fluid may also be treated with a compound that promotes the formation of dispersible sulfide scales.
The disclosure provides methods, devices, compositions and kits for diagnosing or predicting transplant status or outcome in a subject who has received a transplant. The methods comprise determining the presence or absence of one or more nucleic acids from a donor transplant, wherein said one or more nucleic acids from said donor are identified based on a predetermined marker profile, and diagnosing or predicting transplant status or outcome based on the presence or absence of said one or more nucleic acids.
The present invention relates to formulation comprising at least (i) two pesticidal compounds A and B dissolved in a lactic acid ester and wherein a) both A and B have melting points below 900 C b) both A and B are selected from the following list: pyraclos-trobin, metalaxyl, mefenoxam, trifloxystrobin, imazalil, pro-chloraz and ipconazole with the proviso that A is different from B (ii) at least one pesticidal compound C present in solid particles, and having a melting point of 900 C and above, and to their use as seed treatment formulation as well as their use for plant protection, including seed and crop protection.
A process for producing a polysaccharide superabsorbent particulate including the process steps of bringing into contact a polysaccharide with a polyphosphate or a polyphosphoric acid as crosslinking agent in the presence of water to form a polysaccharide gel drying the polysaccharide gel, comminuting the dried polysaccharide gel to form polysaccharide superabsorbent polymer particles, coating the particles with a polyphosphate or polyphosphoric acid, crosslinking the coated particles, and surface treating the particulate with a metal multivalent salt or an acid. The invention further relates to a polysaccharide superabsorbent polymer particulate obtainable by this process, a water-absorbent polysaccharide, a composite, a process for producing a composite, a composite produced by this process, the use of the polysaccharide superabsorbent particulates or of the composites as well as the use of polyphosphates.
A method of forming a supported oxidation catalyst includes providing a support comprising a metal oxide or a metal salt, and depositing first palladium compound particles and second precious metal group (PMG) metal particles on the support while in a liquid phase including at least one solvent to form mixed metal comprising particles on the support. The PMG metal is not palladium. The mixed metal particles on the support are separated from the liquid phase to provide the supported oxidation catalyst.
A method of manufacturing a catalyst body which includes: combining one or more inorganic components with an inorganic binder, and optionally with an organic binder, to form a mixture, the one or more inorganic components comprising a primary phase material being zeolite, or CeO2—ZrO2, or a combination; forming the mixture into a shaped body; firing the shaped body to allow the inorganic binder to bind the one or more inorganic components; impregnating the shaped body with a source of a reducing or oxidizing element; and heating the impregnated shaped body to form a redox oxide from the source, the redox oxide being supported by the shaped body.
A fire barrier fabric further comprising a multilayer fabric having at least two layers, including an outside layer and a fire barrier layer; wherein the fire barrier layer provides flame-retardant and/or flame-resistant properties to the entire fabric without requiring fabric coatings or treatments to provide any contribution to flame retardance or resistance, wherein additional layers may include a filler layer, and wherein the fabric is applied to articles, such as upholstered articles and mattresses.
Binder compositions for making fiberglass products and methods for making and using same are provided. The binder composition can include a phenol-aldehyde resin or a mixture of Maillard reactants and one or more modifiers selected from the group consisting of a copolymer comprising one or more vinyl aromatic derived units and at least one of maleic anhydride and maleic acid; an adduct of styrene, at least one of maleic anhydride and maleic acid, and at least one of an acrylic acid and an acrylate; and one or more latexes.
A method of manufacturing a semiconductor device, includes increasing adherence between a susceptor as a heating element, and a semiconductor substrate disposed on the susceptor, by using an adherence increasing mechanism, or increasing heat transmitted to a semiconductor substrate, which is disposed on a susceptor as a heating element, by using a transmitted-heat increasing mechanism; and heating the semiconductor substrate to have a predetermined temperature by heating the susceptor. The adherence increasing mechanism may include the susceptor and one of a heavy-weight stone disposed on the semiconductor substrate, a cap disposed on the semiconductor substrate and engaged with the susceptor, and an adhesive layer provided between the susceptor and the semiconductor substrate. The transmitted-heat increasing mechanism may include the susceptor and small pieces which are disposed on the semiconductor substrate and have radiated-light absorption ability. The susceptor may hold a plurality of the semiconductor substrates in a stacked form.
Variations in the pitch of features formed using pitch multiplication are minimized by separately forming at least two sets of spacers. Mandrels are formed and the positions of their sidewalls are measured. A first set of spacers is formed on the sidewalls. The critical dimension of the spacers is selected based upon the sidewall positions, so that the spacers are centered at desired positions. The mandrels are removed and the spacers are used as mandrels for a subsequent spacer formation. A second material is then deposited on the first set of spacers, with the critical dimensions of the second set of spacers chosen so that these spacers are also centered at their desired positions. The first set of spacers is removed and the second set is used as a mask for etching a substrate. By selecting the critical dimensions of spacers based partly on the measured position of mandrels, the pitch of the spacers can be finely controlled.
A method includes forming an etch stop layer over and contacting a gate electrode of a transistor, forming a sacrificial layer over the etch stop layer, and etching the sacrificial layer, the etch stop layer, and an inter-layer dielectric layer to form an opening. The opening is then filled with a metallic material. The sacrificial layer and excess portions of the metallic material over a top surface of the etch stop layer are removed using a removal step including a CMP process. The remaining portion of the metallic material forms a contact plug.
A method for manufacturing a semiconductor structure is disclosed. The method comprises following steps. A substrate is provided. A sacrificial layer is formed on the substrate. The sacrificial layer is patterned to develop a first opening and a second opening. The first opening corresponds to an exposed portion of the substrate and the second opening corresponds to an unexposed portion of the substrate. A heat procedure is performed. A target material is formed on the exposed portion of the substrate and a rest part of the sacrificial layer. The rest part of the sacrificial layer and parts of the target material on the rest part of the sacrificial layer are removed. A predetermined patterned target material is obtained.
Embodiments of the invention provide a method of creating vias and trenches with different length. The method includes depositing a plurality of dielectric layers on top of a semiconductor structure with the plurality of dielectric layers being separated by at least one etch-stop layer; creating multiple openings from a top surface of the plurality of dielectric layers down into the plurality of dielectric layers by a non-selective etching process, wherein at least one of the multiple openings has a depth below the etch-step layer; and continuing etching the multiple openings by a selective etching process until one or more openings of the multiple openings that are above the etch-stop layer reach and expose the etch-stop layer. Semiconductor structures made thereby are also provided.
A manufacturing method of a lead frame substrate includes: applying a photosensitive resist or a dry film to first and second surfaces of a metal plate; pattern-exposing the photosensitive resist or the dry film, and then developing the first surface and the second surface to form on the first surface a first resist pattern for forming a connection post and to form on the second surface a second resist pattern for forming a wiring pattern; etching the first surface partway down the metal plate to form the connection post; filling the first surface with a pre-molding resin to a thickness with which the etched surface is buried; removing the pre-molding resin uniformly in a thickness direction of the pre-molding resin until a bottom surface of the connection post is exposed; and etching the second surface to form a wiring pattern.
The semiconductor device includes a silicon substrate having a channel region, a gate electrode formed over the channel region, buried semiconductor regions formed in a surface of the silicon substrate on both sides of the gate electrode, for applying to the surface of the silicon substrate a first stress in a first direction parallel to the surface of the silicon substrate, and stressor films formed on the silicon substrate between the channel region and the buried semiconductor regions in contact with the silicon substrate, for applying to the silicon substrate a second stress in a second direction which is opposite to the first direction.
A phase change material including a high adhesion phase change material formed on a dielectric material and a low adhesion phase change material formed on the high adhesion phase change material. The high adhesion phase change material includes a greater amount of at least one of nitrogen and oxygen than the low adhesion phase change material. The phase change material is produced by forming a first chalcogenide compound material including an amount of at least one of nitrogen and oxygen on the dielectric material and forming a second chalcogenide compound including a lower percentage of at least one of nitrogen and oxygen on the first chalcogenide compound material. A phase change random access memory device, and a semiconductor structure are also disclosed.
An adhesive composition for a semiconductor includes an acrylic polymer (A), an epoxy-based heat curable resin (B), a heat curing agent (C), a silane compound (D) having an organic functional group, molecular weight of 300 or more and an alkoxy equivalent of larger than 13 mmol/g, and a silane compound (E) having an organic functional group, molecular weight of 300 or less and an alkoxy equivalent of 13 mmol/g or less.
An element-group formation substrate (20) having plural semiconductor light emitting elements (21) formed on a substrate front surface (11a) is sequentially irradiated with a laser beam (64) having a first output from a substrate back surface (11b) side in the y direction, and the laser beam (64) is sequentially collected to a part having a first depth D1 from the substrate back surface (11b), thereby forming a first modified region L1. The substrate (20) having the first modified region L1 formed therein is sequentially irradiated with the laser beam (64) having a third output (
A method of forming a semiconductor device is provided, including a step of forming a layer which absorbs light over one face of a first substrate, a step of providing a second substrate over the layer which absorbs light, a step of providing a mask to oppose the other face of the first substrate, and a step of transferring the part of the layer which absorbs light to the second substrate by irradiating the layer which absorbs light with a laser beam through the mask.
There is disclosed a package comprising at least an integrated circuit embedded in an electrically non-conductive moulded material. The moulded material includes at least one moulded pattern on at least one surface thereof, and at least one electrically conductive track in the pattern. There is further provided at least one capacitive, inductive or galvanic component electrically connecting between at least two parts of the at least one electrically conductive track. The conductive track can be configured as an antenna, and the capacitive, inductive or galvanic component is used to adjust tuning and other characteristics of the antenna.
A method of fabricating a substrate includes forming spaced first features and spaced second features over a substrate. The first and second features alternate with one another and are spaced relative one another. Width of the spaced second features is laterally trimmed to a greater degree than any lateral trimming of width of the spaced first features while laterally trimming width of the spaced second features. After laterally trimming of the second features, spacers are formed on sidewalls of the spaced first features and on sidewalls of the spaced second features. The spacers are of some different composition from that of the spaced first features and from that of the spaced second features. After forming the spacers, the spaced first features and the spaced second features are removed from the substrate. The substrate is processed through a mask pattern comprising the spacers. Other embodiments are disclosed.
An SRAM device and method of forming MOS transistors of the device having reduced defects associated with selective epitaxial growth in moat tip regions is discussed. The SRAM device comprises a core region and a logic region, logic transistors within the logic region of the SRAM, and selective epitaxial regions grown on both source and drain regions; and memory cell transistors within the core region of the SRAM, and having the selective epitaxial regions grown on only one of the source and drain regions. One method of forming the MOS transistors of the SRAM cell comprises forming a gate structure over a first conductivity type substrate to define a channel therein, masking one of the source and drain regions in the core region, forming a recess in the substrate of the unmasked side of the channel, epitaxially growing SiGe in the recess, removing the mask, and forming the source and drain extension regions in source/drain regions.
A device is provided that includes memory, logic and capacitor structures on a semiconductor-on-insulator (SOI) substrate. In one embodiment, the device includes a semiconductor-on-insulator (SOI) substrate having a memory region and a logic region. Trench capacitors are present in the memory region and the logic region, wherein each of the trench capacitors is structurally identical. A first transistor is present in the memory region in electrical communication with a first electrode of at least one trench capacitor that is present in the memory region. A second transistor is present in the logic region that is physically separated from the trench capacitors by insulating material. In some embodiments, the trench capacitors that are present in the logic region include decoupling capacitors and inactive capacitors. A method for forming the aforementioned device is also provided.
A method of packaging one or more semiconductor dies includes: providing a first die having a circuit surface and a connecting surface; providing a chip-scale frame having an inside surface and an outside surface, the chip-scale frame having a well region having an opening in the inside surface; coupling the first die to a wall of the well region using a first coupling mechanism for electrical and mechanical coupling; providing a substrate having a top surface and a bottom surface; coupling the inside surface of the chip-scale frame with the top surface of the substrate by a second coupling mechanism, wherein a gap is provided between the circuit surface of the first die and the top surface of the substrate; coupling a heat sink to the outside surface of the chip-scale frame; attaching a lid to the chip-scale frame to form a substantially airtight chamber around the first die.
A method of manufacture of an integrated circuit packaging system includes: providing a package substrate having a warpage-compensation zone with a substrate-interior layer exposed from a top substrate-cover, and the warpage-compensation zone having contiguous exposed portion of the substrate-interior layer over corner portions of the package substrate; connecting an integrated circuit die to the package substrate with an internal interconnect; and forming an encapsulation over the integrated circuit die, with the encapsulation directly on the substrate-interior layer in the warpage-compensation zone.
A solar cell includes an absorber layer formed of a CIGAS, copper, indium, gallium, aluminum, and selenium. A method for forming the absorber layer provides for using an indium-aluminum target and depositing an aluminum-indium film as a metal precursor layer using sputter deposition. Additional metal precursor layers such as a CuGa layer are also provided and a thermal processing operation causes the selenization of the metal precursor layers. The thermal processing operation/selenization operation converts the metal precursor layers to an absorber layer. In some embodiments, the absorber layer includes a double graded chalcopyrite-based bandgap.
The present invention discloses a structure and a manufacturing method for a high-resolution camera module, wherein the method includes the following steps: providing an image sensor wafer comprising multiple image sensor chips; performing inspection and defining if each image sensor chip is a good chip; disposing an optical cover on the image sensor chip defined as the good chip, wherein the optical cover faces a sensing area and does not cover conductive contacts; cutting the image sensor wafer to obtain the discrete image sensor chip covered with the optical cover; and disposing a first surface of the divided image sensor chip on a bottom surface of a ceramic substrate. The present invention can seal the high resolution camera module during early stage of the manufacturing process to improve the yield rate of the camera module, and downsize the camera module effectively.
Disclosed herein is a method for manufacturing an active array substrate. The method includes the steps of: forming a first patterned metal layer on a substrate; sequentially forming a semiconductor layer, an insulating layer and a second metal layer to cover the first patterned metal layer; forming a patterned photoresist layer on the second metal layer; patterning the second metal layer, the insulating layer and the semiconductor layer to form a second patterned metal layer, a patterned insulating layer and a patterned semiconductor layer, and removing a portion of the patterned photoresist layer; heating the remained portion of the patterned photoresist layer such that the remained portion is fluidized and transformed into a protective layer; and forming a pixel electrode.
A metal plate is prepared, on which at least one joint slit made up of a joint and an opening is formed in a predetermined direction for integrating multiple mounting plates of the light emitting apparatuses. Multiple light emitting elements set in array are mounted on the metal plate. An aperture is provided at a position corresponding to a position for mounting the light emitting element on the metal plate, and a plate-like reflector made of resin, on which a first reflector splitting groove is formed at a position coinciding with the joint slit of the metal plate, is mounted and fixed on the metal plate in such a manner as superimposed thereon. The metal plate and the resinous reflector are superimposed one on another and broken together, whereby the metal plate can be split successfully.
A semiconductor device comprising a first insulating layer, a first metal conductor layer formed over the first insulating layer, a second insulating layer comprising a low-k insulating material formed over the first metal conductor, a second metal conductor layer formed over the second insulating layer, vias formed in the second insulating layer connecting the first metal conductor layer to the second metal conductor layer, and a plurality of metal lines. One of the metal lines is expanded around one of the vias compared to metal lines around other ones of the vias so that predetermined areas around each of the vias meets a minimum metal density.
The application provides a laboratory. The laboratory (400) comprises a portable casing (404). The portable casing (404) comprises a tray unit (407), an actuator unit (405, 412), an analyzer unit (419), and a communication unit (402, 415, 438).The tray unit (407) is used for receiving a cartridge (409). The cartridge (409) comprises an analyte reservoir (430) for receiving an analyte fluid, one or more chemical reagent reservoirs (432) for storing one or more chemical reagent fluids, and one or more channels (434) connecting the chemical reagent reservoirs (432) with the analyte reservoir (430). The channel (434) comprises a measurement area (436) while the measure measurement area (436) comprises a sensor. The actuator unit (405, 412) is used for reducing the volume of the analyte reservoir (430) and for reducing the volume of the chemical reagent reservoirs (432). The analyzer unit (419) is used for measuring a physical value in the measurement area (436) using the sensor. The communication unit (402, 415, 438) is used for outputting the physical value.
The invention provides a method for detecting an antigen-specific hematopoietic cell in a biological sample, wherein the method comprises (a) providing a biological sample comprising a hematopoietic cell of a first species; (b) providing a target cell of a second species, wherein the second species is different from the first species, wherein the second species is a macaque species, and wherein the target cell comprises an antigen; (c) contacting the target cell with the sample; and (d) detecting an immune activation marker or activity in the sample, wherein an increase in expression of the immune activation marker or activity in the sample, relative to a control, is an indication that the sample comprises an antigen-specific hematopoietic cell; and wherein a cell identical to the target cell but lacking the antigen does not stimulate expression of the immune activation marker or activity in hematopoietic cells of the first species.
A method of co-expressing a portion of the VSV G protein gene or a truncated “stem” portion with GP64 and a retrovirus increases the titer of retroviral vectors. A truncated VSV G protein, preferably comprised of a small segment from the C-terminal portion of the ectodomain plus the transmembrane (TM) and cytoplasmic tail (CTD) domains of VSV G, co-expressed with retroviral vectors, enhances the production titers of the retroviral vectors. A preferred embodiment uses a VSV G construct that includes an N-terminal c-Myc epitope plus 42 amino acids from the C-terminal portion of the ectodomain, 20 amino acids from the predicted TM domain, and 29 amino acids from the predicted CTD of the VSV G protein.
The present invention relates to the novel Porcine Circovirus type 2 subtype B (PCV2B-Rm) isolate which comprises a short duplication of sequence and is adapted to grow in cell culture and may be propagated at high titres constantly up to 106 TCID50 viral particles per mL. This novel isolate is particularly useful for the production of porcine circovirus type 2 (PCV2) vaccines, for treating and/or preventing and/or diagnosing porcine circovirus associated diseases, as well as for diagnosing the presence of porcine circovirus in pigs. The present invention also relates to novel cell clones derived from Swine Testicles (ST) useful for propagating PCV2 and to a method for production of PCV2 virus with particularly high titers.
The present invention relates to enzyme compositions comprising a polypeptide having cellobiohydrolase II activity, a polypeptide having xylanase activity, and one or more cellulolytic proteins and their use in the degradation or conversion of cellulosic material.
The present invention relates to novel lipase polynucleotide sequences, their corresponding proteins as well as ways of manufacturing said sequences and said proteins and use of the proteins in the preparation of food compositions. The invention further relates to methods for releasing proteins from the exterior of a host cell as well as to a method for killing micro-organisms.
Provided herein are mutant DNA-dependent polymerases which are derived from, or otherwise related to, wild type RB69 DNA polymerase. These mutant polymerases are capable of selectively binding labeled nucleotides. These mutant polymerases are also capable of incorporating a variety of naturally occurring and modified nucleotides, including, for example, terminator nucleotides.
A method of producing (+)-zizaene by contacting at least one polypeptide with farnesyl pyrophosphate (FPP) in vitro or in vivo to produce (+)-zizaene, a compound which can be used as precursor for diverse compounds useful in the fields of perfumery and flavoring. An amino acid sequence of a polypeptide useful in the method, a nucleic acid encoding the polypeptide of the invention, an expression vector containing the nucleic acid and a non-human host organism or a cell transformed to be used in the method of producing (+)-zizaene are also disclosed.
A range of concentrations exists in which fermentation inhibitors derived from pretreatment of lignocellulosic feed stocks inhibit growth of lactic acid bacteria without affecting fermentive yeast. By optimizing levels of fermentation inhibitors to fall within this range, yeast fermentations of lignocellulosic biomass can be conducted under non-sterile conditions with ethanol yields comparable to those achieved under sterile conditions. Optimised inhibitor levels can be achieved by controlling the water/biomass ratio of a lignocellulosic biomass during and after pretreatment, for example by washing the fiber fraction of a previously pretreated lignocellulosic biomass with a pre-defined amount of fresh water or recycled process solutions. Crude extracts of liquid fraction or process solutions from pretreatment of lignocellulosic biomass can also provide an effective anti-baterial treatment for first generation starch fermentations.
The invention relates to the preparation of amino-cyclopamines by the enzymatic transamination of a corresponding keto-cyclopamines in the presence of a cofactor and an amino donor.
The present invention relates to automated devices and methods for the amplification of segments of nucleic acid in a convenient and portable manner. A single-use nucleic acid amplification device for producing an amplicon includes a housing and an amplification chamber. The chamber includes an ingress with a first reversible seal, an egress with a second reversible seal, a sealable sample entry orifice, and a first wall forming a portion of the chamber. The first wall includes a thermally conductive material and includes an interior surface and an exterior surface. The exterior surface includes a heating circuit and a temperature sensor. The sample entry orifice permits a sample of nucleic acid to enter the amplification chamber. The ingress is connected to a first conduit along with a pneumatic pump and a fluid pouch. The egress is connected to a second conduit permitting egress of the amplicon from the amplification chamber.
There are provided a microorganism characterized by producing poly-γ-L-glutamate with a molecular weight of 1,300,000 or greater and uniform optical purity under liquid culture conditions, a method of screening for the microorganism, a method of producing poly-γ-L-glutamate having large molecular weight by using the microorganism, and poly-γ-L-glutamate having an average molecular weight of 1,300,000 or greater. In addition, usages of these are provided.
This invention provides a method for measuring human megalin that can be performed in a simpler manner within a shorter period of time than is possible with conventional techniques, and that can also quantify human megalin. This invention also provides a method that enables diagnosis of functional diseases, which are specific to cells, tissues, or organs, in a site-directed manner at an early stage. Measurement of human megalin enables detection of a disease in an organ in which megalin expression is observed.
The invention provides a compound comprising a photosensitizing agent coupled to a carrier molecule with a minimum coupling ratio of 3:1 wherein the carrier molecule has a binding specificity for a target cell. There is also provided a process of conjugation comprising the use of a first and second aprotic solvent and uses of the conjugated compounds. FR1 1 2 3 H1-H2Locus123456789012345678901234567890 VH11-31-02QVQLVQSGAEVKKPGASVKVSCKASGYTFT 1-31-03QVQLVQSGAEVKKPGASVKVSCKASGYTFT 1-31-08QVQLVQSGAEVKKPGASVKVSCKASGYTFT 1-21-18QVQLVQSGAEVKKPGASVKVSCKASGYTFT 1-U1-24QVQLVQSGAEVKKPGASVKVSCKVSGYTLT 1-31-45QMQLVQSGAEVKKTGSSVKVSCKASGYTFT 1-31-46QVQLVQSGAEVKKPGASVKVSCKASGYTFT 1-31-58QMQLVQSGPEVKKPGTSVKVSCKASGFTFT 1-21-69QVQLVQSGAEVKKPGSSVKVSCKASGGTFS 1-21-eQVQLVQSGAEVKKPGSSVKVSCKASGGTFS 1-21-fEVQLVQSGAEVKKPGATVKISCKVSGYTFT VH23-1/2-12-05QITLKESGPTLVKPTQTLTLTCTFSGFSLS 3-12-26QVTLKESGPVLVKPTETLTLTCTVSGFSLS 3-12-70QVTLKESGPALVKPTQTLTLTCTFSCFSLS VH31-33-07EVQLVESGGGLVQPGGSLRLSCAASGFTFS 1-33-09EVQLVESGGGLVQPGRSLRLSCAASGFTFD 1-33-11QVQLVESGGGLVKPGGSLRLSCAASGFTFS 1-13-13EVQLVESGGSLVQPGGSLRLSCAASGFTFS 1-U3-15EVQLVESGGGLVKPGGSLRLSCAASGFTFS 1-33-20EVQLVFSGGSVVRPGGSLRLSCAASGFTFD 1-33-21EVQLVESGGGLVKPGGSLRLSCAASGFTFS 1-33-23EVQLLESGGGLVQPGGSLRLSCAASGFTFS 1-33-30QVQLVESSGGVVQPGRSLRLSCAASGFTFS 1-33-30.3QVQLVESGGGVVQPGRSLRLSCAASGFTFS 1-33-30.5QVQLVESGGGVVQPGRSLRLSCAASGFTFS FR2 CDR1 4 H1-H2Locus1ab234567890123456789 VH11-31-02G--YYMHWVRQAPGQGLEWMG 1-31-03S--YAMHWVRQAPGQRLEWMG 1-31-08S--YDINWVRQATGQGLEWMG 1-21-18S--YGISWVRQAPGQGLEWMG 1-U1-24E--LSMHWVRQAPGKGLEWMG 1-31-45Y--RYLHWVRQAPGQALEWMG 1-31-46S--YYMHWVRQAPGQGLEWMG 1-31-58S--SAVQWVRQARGQRLEWIG 1-21-69S--YAISWVRQAPGQGLEWMG 1-21-eS--YAISWVRQAPGQGLEWMG 1-21-fD--YYMHWVQQAPGKGLEWMG VH23-1/2-12-05TSGVGVGWIRQPPGKALEWLA 3-12-26NARMGVSWIRQPPGKALEWLA 3-12-70TSGMRVSWIRQPPGKALEWLA VH31-33-07S--YWMSWVRQAPGKGLEWVA 1-33-09D--YAMHWVRQAPGKGLEWVS 1-33-11D--YYMSWIRQAPGKGLEWVS 1-13-13S--YDMHWVRQATGKGLEWVS 1-U3-15N--AWMSWVRQAPGKGLEWVG 1-33-20D--YGMSWVRQAPGKGLEWVS 1-33-21S--YSMNWVRQAPGKGLEWVS 1-33-23S--YAMSWVRQAPGKGLEWVS 1-33-30S--YGMHWVRQAPGKGLEWVA 1-33-30.3S--YAMHWVRQAPGKGLEWVA 1-33-30.5S--YGMHWVRQAPGKGLEWVA
The present invention provides a method for diagnosing and determining prognosis of gastric cancer in a subject by detecting suppressed expression of the BCL6B gene, which in some cases is due to elevated methylation level in the genomic sequence of this gene. A kit and device useful for such a method are also provided. In addition, the present invention provides a method for treating gastric cancer by increasing BCL6B gene expression or activity.
Isolated non-naturally occurring populations of spermatozoa (15) having high purity and technologies to differentiate spermatozoa (28) based on characteristics such as mass, volume, orientation, or emitted light including methods of analysis and apparatus such as beam shaping optics (30) and detectors (32).
The methods and kits described herein are based, in part, to the discovery phenotype representing a fully-reprogrammed iPS cell and several reprogramming intermediates. The methods and kits described herein permit identification of fully-reprogrammed iPS cells and further permits one of skill in the art to monitor the emergence of iPS cells during the reprogramming process. The methods/kits can also be performed using real time using live cell imaging. Also described herein are methods for screening candidate reprogramming agents by monitoring the emergence of fully-reprogrammed iPS cells in the presence and absence of such an agent.
A pattern-forming method includes forming a resist film on a substrate using a photoresist composition, exposing the resist film, and developing the exposed resist film using a negative developer that includes an organic solvent. The photoresist composition includes (A) a polymer that includes a structural unit (I) including an acid-labile group that dissociates due to an acid, the solubility of the polymer in the developer decreasing upon dissociation of the acid-labile group, and (B) a photoacid generator. The developer includes a nitrogen-containing compound.
Compositions are disclosed having the formula (3): [C′]k[Ta(O2)x(L′)y] (3), wherein x is an integer of 1 to 4, y is an integer of 1 to 4, Ta(O2)x(L′)y has a charge of 0 to −3, C′ is a counterion having a charge of +1 to +3, k is an integer of 0 to 3, L′ is an oxidatively stable organic ligand having a charge of 0 to −4, and L′ comprises an electron donating functional group selected from the group consisting of carboxylates, alkoxides, amines, amine oxides, phosphines, phosphine oxides, arsine oxides, and combinations thereof. The compositions have utility as high resolution photoresists.
A positive resist composition comprising (A) a polymer comprising recurring units of a specific structure adapted to generate an acid in response to high-energy radiation and acid labile units, the polymer having an alkali solubility that increases under the action of an acid, and (B) a sulfonium salt of a specific structure exhibits a high resolution in forming fine size patterns, typically trench patterns and hole patterns. Lithographic properties of profile, DOF and roughness are improved.
Methods for making toner particles comprising a polyester-wax resin, wherein the polyester-wax resin includes a bio-based oil that is chemically incorporated into the main chain of the polyester resin. The toner particles may be formed using emulsion aggregation methods. A toner formed from the toner particles may be used in low-oil or oil-less fusing systems.
To provide a toner A containing: base particles, each containing polyester, microcrystalline wax, and a colorant; and spherical silica particles having an average primary particle diameter of 100 nm to 150 nm, wherein the microcrystalline wax has an onset temperature of 45° C. to 60° C. as determined by DSC, and a carbon number distribution of 25 to 55.
Toner particles include a shell and a core, wherein the shell includes charge control agent-treated spacer particles that cause protrusions from the toner particle surface.
A method is described for recording a volume reflection holographic image that is viewable when illuminated by light at a wavelength Wv. The method includes providing a transparent holographic recording medium having a refractive index n, said holographic recording medium being photosensitive to external light provided at a wavelength W that is different than Wv; disposing a first transparent refracting medium in contact with a first surface of the holographic recording medium; and exposing the holographic recording medium to a signal coherent light source that includes image or other information to be recorded in the holographic recording medium and a reference coherent light source, the signal coherent light source and reference coherent light source emitting light at the wavelength W and entering the holographic recording medium through opposing surfaces thereof, wherein the signal coherent light source or the reference coherent light source passes through the first transparent refracting medium before entering the holographic recording medium at an internal angle of incidence greater than arcsin(1/n).
Fuel feed systems capable of providing substantially consistent flow of fuel to a fuel cell and also capable of tolerating varying pressures from a reservoir (also referred to as fuel supply or fuel cell cartridge) and the fuel cell while maintaining substantially consistent control flow to the fuel cell are disclosed.
Disclosed is an electrolyte. The electrolyte includes an amide compound and an ionizable lithium salt. The amide compound has a specific structure in which an amine group is substituted with at least one alkoxyalkyl group and at least one halogen atom is present. The electrolyte has good thermal and chemical stability, a low resistance and a high ionic conductivity. In addition, the electrolyte has a high upper limit of electrochemical window due to its improved oxidation stability. Therefore, the electrolyte can be useful for the fabrication of an electrochemical device. Further disclosed is an electrochemical device including the electrolyte.
A primary alkaline battery includes a cathode having an alkali-deficient nickel (IV)-containing oxide including metals such as Ni, Co, Mg, Al, Ca, Y, Mn, and/or non-metals such as B, Si, Ge or a combination of metal and/or non-metal ions as stabilizing dopants; a combination of metal ions as dopants; an anode; a separator between the cathode and the anode; and an alkaline electrolyte. The battery can be pre-discharged within one hour after assembly to decrease the open circuit voltage.
A lithium ion battery pack battery pack is disclosed. The battery pack comprises a housing, the housing having a sidewall and a sidewall opening extending there through, a plurality of lithium ion battery cells disposed within the housing, the battery cells having an anode terminal and a cathode terminal, first and second current collectors disposed in the housing, the first and second current collectors electrically engaging respective ones of the anode and the cathode terminals, a metal plate disposed in the sidewall opening adjacent one of the current collectors, and an electrically non-conductive barrier disposed between the adjacent one of the current collectors and the metal plate, wherein the metal plate draws heat from the adjacent one of the current collectors outwardly into the ambient environment.
A rechargeable battery is provided. The rechargeable battery comprises an electrode assembly, a case housing the electrode assembly, at least one lead tab accommodated in the case to electrically connect the electrode assembly to the case, and a welded joint joining the lead tab to the case. In the rechargeable battery, the case is connected to the lead tab without producing any spatter within the case. The welded joint extends from an outer bottom surface of the case to the lead tab. Further provided is a method for manufacturing the rechargeable battery.
The invention relates to a battery including a plurality of juxtaposed cylindrical or prismatic cells located in the through holes of a separating and positioning crate, characterized in that the separating and positioning crate is provided between two contact and holding plates having inner surfaces provided with one or more contact strips attached without welding against said faces and ensuring the electric interconnection between a plurality of cells. Said contact strip or each of said contact strips is made of a flexible conducting material having a plurality of flexible contact tabs cut in said contact strip(s) and maintained against the terminals of the cells by individual elastic pressure means secured by screwing onto the separating and positioning crate so that said contact tabs are individually pressed against one of the terminals or poles of said cells.
A battery pack includes a secondary battery, an outer case receiving the secondary battery, and a cooling unit disposed at a predetermined position of the outer case, wherein the cooling unit includes a first heatsink disposed toward the inside of the outer case, a second heatsink disposed toward the outside of the outer case, and a thermoelectric device between the first heatsink and the second heatsink.
The present invention enables a user to receive a financial service anywhere through a mobile terminal equipped with a UIM (User Identification Module) electronic card. In the present invention, a user enters his or her password to a mobile terminal with a UIM card including subscriber telephone number, finance, authorization, and personal information, then, if the entered password is correct, authorization is processed with a remote authorizing server based on the authorization information. After authorization, user's requesting service, e.g., payment service, transaction particulars inquiry service, prepaid card recharging service is conducted through a mobile network.
An aromatic amine derivative having a specific structure. An organic electroluminescence device which is composed of one or more organic thin film layers sandwiched between a cathode and an anode, wherein at least one of the organic thin film layers, especially a hole transporting layer, contains the aromatic amine derivative. The aromatic amine derivative has at least one substituted or unsubstituted dibenzofuran skeleton and at least one substituted or unsubstituted terphenylene skeleton. Because the molecules in the aromatic amine derivate hardly crystallize, organic electroluminescence devices improving their production yield and having prolonged lifetime are provided.
An intermediate transfer media, such as a belt, that includes a fluorinated polymer associated with, attached to, and more specifically, chemically attached to a carbon black.
A reinforced composite material includes a solid polymer matrix, a reinforcing material in the solid polymer matrix, and a first plurality of capsules. The reinforcing material includes a surface. The capsules are on the surface of the reinforcing material, and include a liquid healing agent. The amount of the healing agent of the capsules is at least 0.01 milligrams per square centimeter of the surface area of the reinforcing material.
Nanostructures on substrates include one or more nanofeatures having unscathed walls and width dimensions of forty-five nm or less. The nanofeatures may include at least one of a nanotrench, nanocapillary, nano-chemical pattern, and nanowire. The nanostructures may include a nano object with a pattern of nano elements. A nano system may include at least one nano system device, which may include at least one nanofeature. A method of forming nanofeatures on substrates includes placing a nano-templating element on the substrate. A masking material is deposited at an acute angle to form shadow gaps on shadowed regions of the substrate. The nano-templating element, the angle, and other factors may be selected to form shadow gaps having width dimensions less than 10 nm. The substrate may be chemically modified in the areas corresponding to the shadow gaps to create nanofeatures with unscathed walls having width dimensions of less than 10 nm.
A knitted spacer fabric has a tightly knitted bottom layer, a more loosely knitted upper layer and linking fibers extending across the space between the lower and upper faces. Settable material, e.g. cement, is introduced into the space between the upper and lower faces and can be caused to set by the addition of a liquid, e.g. water. Until set, the fabric is flexible and can be shaped but after the material in space has set, the fabric is rigid and can be used as a structural element in a wide range of situations. The bottom layer has an extension that extends beyond the upper face and is connected to the upper face by elastic connecting fibers that draw the extension towards the other face, thereby at least partly closing the space at the edge of the cloth and preventing the settable material from spilling out. In addition, the packing of the settable material and maximum space between the faces are such that only a predetermined amount of liquid can be accommodated within the space and that amount is matched to the water required to set the cement.
An image transfer article can include an image-imparting member and a removable substrate disposed adjacent to the image-imparting member. The image-imparting member can have a softening point temperature less than about 220° C. The image-imparting member can include at least one surface configured to receive and carry indicia to be transferred and at least one portion comprising a pigment providing an opaque background for received indicia. In some examples, the image-imparting member can comprise a first polymer including the indicia and at least a second polymer including the pigment. In some examples, the image-imparting member can comprise a polymer including the indicia and the pigment. The indicia and the opaque background can be arranged to concurrently transfer to a woven- or fabric-based article or paper in contact with the image-imparting member, upon application of iron pressing temperatures.
A printed article with optically variable properties that includes a printable media on which a printed feature has been formed with an ink composition. Said ink composition contains metal oxide particles that have an average particle size in the range of about 3 to about 180 nm and that have a refractive index superior or equal to 1.2. The printable media contains a bottom supporting substrate, an ink-absorbing layer and a metallized top layer with pore diameters that are smaller than the size of the metal oxide particles, and the ink composition forms, onto the printable media, a printed feature that exhibits optically variable properties.
A reinforced-fiber sheet impregnated with a matrix resin, a protective film having an irregular surface is applied to at least one surface of the reinforced-fiber sheet impregnated with the matrix resin such that the irregular surface faces the reinforced-fiber sheet. The thus-formed reinforced-fiber sheet covered with a protective film is kept at a temperature of 50-130° C. for four hours or more such that the viscosity of the impregnated resin is 100-10000 poise.
A fixture for mounting and masking cutting tools includes a tool holder and a mask. The tool holder has a cavity adapted to receive a plurality of cutting tools. The mask is coupled to the holder and aligned with the plurality of cutting tools where a majority of the surface area of each cutting tool is covered by the tool holder and the mask. The mask includes a shaped portion having a profile adapted to substantially match the profile of the shaped cutting tip for the cutting tool. The mask is positioned to expose a portion of the cutting tool to the surrounding atmosphere. A method of masking and coating a cutting tool is also presented.
The invention provides an image forming method having at least: applying, onto a recording medium, an ink composition containing at least a water-soluble organic solvent, a pigment, a polymer particle and water; and removing at least a part of the water-soluble organic solvent from the ink composition on the recording medium. The water-soluble organic solvent contains at least a water-soluble organic solvent having a vapor pressure of less than 10 Pa at 20° C., a boiling temperature of less than 260° C., and an SP value of less than 25, at a content of 30 mass % or more with respect to the total water-soluble organic solvent content of the ink composition.
A method of coating a honeycomb monolith substrate comprising a plurality of channels with a liquid comprising a catalyst component comprises the steps of: (i) holding a honeycomb monolith substrate substantially vertically; (ii) introducing a pre-determined volume of the liquid into the substrate via open ends of the channels at a lower end of the substrate; (iii) sealingly retaining the introduced liquid within the substrate; (iv) inverting the substrate containing the retained liquid; and (v) applying a vacuum to open ends of the channels of the substrate at the inverted, lower end of the substrate to draw the liquid along the channels of the substrate.
Thermally stable anhydrous Rebaudioside D can be provided by methods disclosed here and has been found to be more soluble in aqueous solutions than the previously known non-anhydrous Rebaudioside D. This physical property makes the anhydrous Reb D amenable to food and beverage manufacturing applications for which the non-anhydrous form is not suitable. Anhydrous Rebaudioside D is useful in sweeteners, and can be included in food and beverage products, which are also disclosed.
Described herein are tissue grafts derived from the placenta. The grafts are composed of at least one layer of amnion tissue where the epithelium layer has been substantially removed in order to expose the basement layer to host cells. By removing the epithelium layer, cells from the host can more readily interact with the cell-adhesion bio-active factors located onto top and within of the basement membrane. Also described herein are methods for making and using the tissue grafts. The laminin structure of amnion tissue is nearly identical to that of native human tissue such as, for example, oral mucosa tissue. This includes high level of laminin-5, a cell adhesion bio-active factor show to bind gingival epithelia-cells, found throughout upper portions of the basement membrane.
There is a need for water-based sperm- and egg-friendly vaginal lubricant. We describe novel water-based nature-friendly personal moisturizers and lubricants that relive vaginal dryness. In addition to being non-spermicidal, sperm- and egg-friendly and biological-fluids mimicking, these personal moisturizers and lubricants also enhance sperm survival and motility, promote binding of sperm to eggs and facilitate the process of fertilization. Novel articles, and systems as well as methods of preparation and use of the novel compositions are also provided.
The present invention relates to a tablet comprising Nimorazole. In particular, the invention concerns a pharmaceutical composition or a tablet comprising Nimorazole or a pharmaceutically acceptable salt, for dispersion in water and administration via a tube to a patient with swallowing difficulties.
An object of the present invention is to provide a small-sized light-stabilized soft capsule formulation, which has a shell that ensures effective light shielding of an active ingredient encapsulated thereby.The present invention provides a light-stabilized soft capsule formulation comprising a shell containing a non-water-soluble light-shielding agent and having an average thickness of 200 μm or less, and a medicament encapsulated by the shell.
Disclosed are newborn infant formulas comprising fat, carbohydrate, and from 0.5 to 2.5 g of protein per 100 ml of formula, wherein the formula has a caloric density of from 25 to 50 kcal per 100 ml of formula. Also disclosed are methods of administering the infant formulas to provide newborns with optimal nutrition, to reduce the occurrence or extent of insulin resistance in an individual later in life, to reduce the occurrence or extent of atherosclerosis or coronary artery disease in an individual later in life, or combinations thereof, by feeding newborn infants the newborn infant formula described herein.
Nanoemulsion compositions with low toxicity that demonstrate broad spectrum inactivation of microorganisms or prevention of diseases are described. The nanoemulsions contain an aqueous phase, an oil phase comprising an oil and an organic solvent, and one or more surfactants. Methods of making nanoemulsions and inactivating pathogenic microorganisms are also provided.
A method of forming and the resulting hydrogel composition comprising poly(vinyl alcohol) at a final concentration of about 20% (w/w) to about 65% (w/w) and polyethylene glycol at a final concentration of about 2% (w/w) to about 20% (w/w), wherein the hydrogel composition has a total polymer content, above about 30% (w/w), higher than the total polymer content of a precursor polymer solution formulated prior to the formulation of the hydrogel composition. The hydrogel composition may further comprise poly(vinyl pyrrolidone) at a final concentration of about 0.10% (w/w) to about 0.75% (w/w).
The present application relates to immunogenic compositions comprising staphylococcal PNAG which is less than 40% N-acetylated and is conjugated to a carrier protein by a linker bonded to an amine group on PNAG to form a PNAG conjugate. Vaccines, methods of treatment using and processes to make an immunogenic composition comprising PNAG and Type 5 and/or 8 capsular polysaccharides are also described.
According to the present invention there is provided a specific binding member which is specific for and binds directly to the ED-B oncofoetal domain of fibronectin (FN). The invention also provides materials and methods for the production of such binding members.
Embodiments of the invention disclosed herein relate to methods and compositions for bypassing the involvement of CD4+ cells when generating antibody and MHC class I-restricted immune responses, controlling the nature and magnitude of the response, and promoting effective immunologic intervention in viral pathogenesis. More specifically, embodiments relate to immunogenic compositions for vaccination particularly therapeutic vaccination, against HIV and other microbial pathogens that impact functioning of the immune system, their nature, and the order, timing, and route of administration by which they are effectively used.
Disclosed are novel inhibitors of the alternative complement pathway and particularly, novel anti-factor B antibodies. Also disclosed is the use of such inhibitors to reduce or prevent airway hyperresponsiveness and/or airway inflammation by selectively inhibiting the alternative complement pathway, thereby treating diseases in which such conditions play a role. Also disclosed is the use of such inhibitors to reduce or prevent other diseases and conditions, including ischemia-reperfusion injury, by inhibition of the alternative complement pathway.
Antibody variants of parent antibodies are disclosed which have one or more amino acids inserted in a hypervariable region of the parent antibody and a binding affinity for a target antigen which is at least about two fold stronger than the binding affinity of the parent antibody for the antigen.
Methods for soft tissue repair and/or augmentation using injectable, biodegradable polymers are described herein. In one embodiment, the polymer compositions are liquid or pastes at room temperature. In a preferred embodiment, the polymer composition contains liquid or pasty hydroxy fatty acid-based copolyesters, polyester-anhydrides, or combinations thereof. The viscosity of the polymers increases upon contact with bodily fluid to form a solid or semisolid implant suitable for soft tissue repair and/or augmentation. In another embodiment, the polymer composition contains particles of a polymer stereocomplex. One or more active agents may be incorporated into the polymer compositions. Suitable classes of active agents include local anesthetics, anti-inflammatory agents, antibiotics, analgesics, growth factors and agents that induce and/or enhance growth of tissue within the filled cavity or control the growth of a certain type of tissue, and combinations thereof. The polymer compositions may also contain one or more additives or excipients that modify the physical and/or mechanical properties of the polymer. The polymer compositions are typically administered by injection. The injectable polymers can be used for a variety of soft tissue repair and augmentation procedures.
The present invention relates to a composition for the protection of keratinous fibers containing at least one compound chosen from ceramides and glycoceramides, at least one cationic polymer, and at least one amphoteric polymer; to a process and kit for protecting keratinous fibers from damage caused by chemical treatment by applying, prior to chemical treatment, to the keratinous fibers a leave-in composition comprising at least one compound chosen from ceramides and glycoceramides.
The invention relates to stable oleaginous cosmetic or therapeutic foam compositions containing certain active agents, having unique therapeutic properties and methods of treatment using such compositions. The foamable composition includes at least one solvent selected from a hydrophobic solvent, a silicone oil, an emollient, a co-solvent, and mixtures thereof, wherein the solvent is present at a concentration of about 70% to about 96.5% by weight of the total composition, at least a non-ionic surface-active agent at a concentration of about 0.1% to less than about 10% by weight of the total composition; at least one gelling agent at a concentration of about 0.1% to about 5% by weight of the total composition; a therapeutically effective amount of at least one active agent; and at least one liquefied or compressed gas propellant, at a concentration of about 3% to about 25% by weight of the total composition.
Sterically hindered imidazole ligands are described, along with their synthesis, which are capable of coordinating to Group 2 metals, such as: calcium, magnesium, strontium, in an eta-5 coordination mode which permits the formation of monomeric or dimeric volatile complexes.A compound comprising one or more polysubstituted imidazolate anions coordinated to a metal selected from the group consisting of barium, strontium, magnesium, radium or calcium or mixtures thereof. Alternatively, one anion can be substituted with and a second non-imidazolate anion.Synthesis of the novel compounds and their use to form BST films is also contemplated.
The present disclosure provides various methods and systems for manufacture, transport and delivery of material including highly polarized nuclei that is in a hyperpolarized state.
The present disclosure provides devices and rapid methods to acquire a wound sample to detect and measure NOx, and optionally, one or more other analytes that are indicative of the status of a wound.
The present invention provides compositions and methods for synthesizing labeled drugs. The present invention further provides methods for preventing or stopping prescription drug abuse for all agents registered as a Drug Enforcement Agency (DEA) schedule II through schedule V medications. According to the present invention, methods are provided for monitoring patient compliance with prescribed drug treatment. The present invention also provides methods for facilitating a replacement prescription when a patient is left without access to their prescribed drug. Furthermore, the present invention provides a method to improve employee compliance with an employer's drug policies via either a voluntary or compulsory system for enhanced drug testing.
The present invention relates to crystalline cerium oxide prepared in a simple, economical, and efficient manner, of which crystal structure, shape, and size can be easily adjusted and that exhibits excellent polishing properties, and a preparation method thereof. The crystalline cerium oxide can be prepared as sub-micron crystalline cerium oxide that has a mean volume diameter and a diameter standard deviation within a predetermined range.
Immobilized nitronyl nitroxide active sites on the surface of a porous inorganic oxide support act as efficient and rapid oxidants for NO, reacting with >99% of the NO under flow conditions through a packed bed; and, in a parallel configuration with nitroxyl radical active sites, act to remove >99 % of both NO and NO2 from a gas mixture, with >95% of the active sites participating in NOx trapping.
Sorbent compositions containing halogen and calcium are added to coal to mitigate the release of sulfur and/or other harmful elements, including mercury, into the environment during combustion of coal containing natural levels of mercury.
A container assembly for containing a biological graft can include a housing member sized to be able to contain the biological graft while keeping the size of an original shape of the biological graft. An aqueous fluid can fill the housing member such that the biological graft is contained in a suspended state in the aqueous fluid.
The present disclosure provides a kit for detecting counterfeit consumer products. The kit includes a plurality of test protocols to determine the presence or absence of one or more active component, diluent component, and/or preservative component in a consumer product. Methods of making and using the counterfeit detection kit are also described.
A reactor system including an enclosed pressure relief system and/or a control system. The enclosed pressure relief system including a slurry separation system communicatively coupled with a pressure relief valve coupled to a loop reactor such that activation of the pressure relief valve results in discharge of a slurry from the loop reactor to the slurry separation system, wherein the slurry separation system is capable of separating solid and liquid components from gas components of the slurry and transmitting the gas components to a flare via a flare header.
A method for sanitizing headsets during a period of non-use by placing the headsets on a support construct in the form of a rack within which there is a source of ultraviolet radiation. The headsets are mounted straddling the rack, gripping the rack to be secured in place with a resilient biasing force. Then, the rack, with mounted headsets, is enclosed within a case, suitable for storage or transport. The source is activated to pass ultraviolet radiation through the rack to impinge upon the headsets, during a timed duration of operation, with the case automatically locked closed for that duration, thereby sanitizing the headsets. Reflective surfaces within the case serve effectively to immerse the headsets within ultraviolet radiation for the duration of operation, and air is circulated within the case, passing through the rack, during the sanitizing operation to assure complete sanitizing of the headsets.
The present invention includes a composition for enhancing the antimicrobial efficacy of photodynamic disinfection against Gram-negative organism that is receptive to paraben potentiation using a composition comprising a photosensitizer and at least one paraben. The present invention also includes a method for photodynamic disinfection comprising applying the composition to a desired treatment area and applying light to the desired treatment area at a wavelength absorbed by the photosensitizer so as to inhibit Gram-negative organism located within the treatment area wherein the Gram-negative organism is receptive to paraben potentiation.
As a stainless steel for a metal part for clothing ornament capable of working into a complicated form part and having such nonmagnetic properties that the worked part can cope with the detection through needle detecting device is provided a high-Mn austenitic stainless steel having a chemical composition comprising C: 0.02-0.12 mass %, Si: 0.05-1.5 mass %, Mn: 10.0-22.0 mass %, S: not more than 0.03 mass %, Ni: 4.0-12.0 mass %, Cr: 14.0-25.0 mass % and N: 0.07-0.17 mass %, provided that these components are contained so that δ cal (mass %) represented by the following equation (1) is not more than 5.5 mass %: δ cal (mass %)=(Cr+0.48Si+1.21Mo+2.2(V+Ti)+0.15Nb)−(Ni+0.47Cu+0.11Mn−0.0101Mn2+26.4C+20.1N)−4.7 (1) and having a magnetic permeability of not more than 1.003 under a magnetic field of 200 kA/m.
Provided are methods of preparing high density compacted components that increase that lubricity of metallurgical powder compositions while reducing the overall organic content of the compacted component. Method of preparing high density compacted components having a high density include the steps of providing a metallurgical powder composition having particles at least partially coated with a metal phosphate layer, and compacting the metallurgical powder composition in the die at a pressure of at least about 5 tsi. The metallurgical powder composition comprises a base-metal powder, optional alloying powders, and a particulate internal lubricant. The metal phosphate at least partially coats the base-metal powder, the optional alloying powder, or both. The metal phosphate coating increases the lubricity of metallurgical powders without the need for large quantities of organic material, e.g., lubricants and binders.
Methods of fabricating an implantable medical devices such as stents made from biodegradable polymers are disclosed that reduce or minimize chain scission and monomer generation during processing steps. The method includes processing a poly(L-lactide) resin having an number average molecular weight between 150 to 200 kD in an extruder in a molten state. A poly(L-lactide) tube is formed from the processed resin and a stent is fabricated from the tube. The number average molecular weight of the poly(L-lactide) of the stent after sterilization is 70 to 100 kD.
A novel yellow phosphor of a fluorosulfide having a chemical formula of (A1-x-yCexBy)2Ca1-zSrzF4S2 and a tetragonal crystal phase is disclosed, wherein A and B are different rare earth metals other than Ce, the values of x, y, z are 0
Exemplary embodiments of the present invention disclose inorganic luminescent substances with Eu2+-doped silicate luminophores, in which solid solutions in the form of mixed phases between alkaline earth metal oxyorthosilicates and rare earth metal oxyorthosilicates are used as base lattices for the Eu2+ activation leading to the luminescence. These luminophores are described by the general formula (1-x) MII3SiO5.xSE2SiO5:Eu, in which MII preferably represents strontium ion or another alkaline earth metal ion, or another divalent metal ion selected from the group consisting of the magnesium, calcium, barium, copper, zinc, and manganese. These ions may be used in addition to strontium and also as mixtures with one another.
To provide a liquid crystal composition satisfying at least one characteristic such as a high maximum temperature of a nematic phase, a low minimum temperature thereof, a small viscosity, a suitable optical anisotropy, a large negative dielectric anisotropy and specific resistance, a high stability to ultraviolet light and heat, or a liquid crystal composition having a suitable balance regarding at least two characteristics; an AM device having a short response time, a large voltage holding ratio and contrast ratio, a long service life and so forth; wherein the liquid crystal composition contains a specific compound having a polymerizable group as a first component, and may contain a specific compound having a large negative dielectric anisotropy and a low minimum temperature as a second component, or a specific compound having a small viscosity or a large maximum temperature as a third component, and a liquid crystal display device contains the composition.
The present invention provides a class of thermotropic liquid crystalline polyesters (TLCPs) and molding compositions comprising the polyesters and glass fiber. The TLCPs consist essentially of repeat units derived from p-hydroxybenzoic acid (HBA), 6-hydroxy-2-naphthoic acid (HNA), terephthalic acid (TA), and hydroquinone (HQ), and the mole percent of HBA, HNA, TA and HQ is 34-72%, 12-26%, 4-21% and 4-21%, respectively. The TLCPs have a melting temperature equal to or below 355° C., an inherent viscosity of 4.0-10.0 dL/g and a Heat Deflection Temperature (HDT) in the range of 260-285° C. when compounded with 30% by weight glass fiber. The optimum compositions, selected from the above-mentioned compositional ranges exhibit a relatively low melting temperature and a relatively high HDT. Specified compositions, selected from the above-mentioned compositional ranges have low melting point, which are useful to blend with conventional polymers such as poly (ethylene terephthalate) and nylon etc.
An azeotrope-like mixture consisting essentially of chlorotrifluoropropene and at least one component selected from the group consisting of a C1-C3 alcohol, a C5-C6 hydrocarbon, a halogenated hydrocarbon, methylal, methyl acetone, water, nitromethane, and combinations thereof.
A slimming method includes transferring an object to be processed on which a patterned carbon-containing thin film is formed into a process chamber in an oxidation apparatus; and oxidizing and removing the surface of the carbon-containing thin film by an oxidizing gas while supplying moisture into the process chamber, to reduce widths of the protruded portions on the pattern of the carbon-containing thin film.
A method of balancing a microelectromechanical system comprises determining if a microelectromechanical system is balanced in a plurality of orthogonal dimensions, and if the microelectromechanical system is not balanced, selectively depositing a first volume of jettable material on a portion of the microelectromechanical system to balance the microelectromechanical system in the plurality of orthogonal dimensions. A jettable material for balancing a microelectromechanical system comprises a vehicle, and a dispersion of nano-particles within the vehicle, in which the total mass of jettable material deposited on the microelectromechanical system is equal to the weight percentage of nano-particles dispersed within the vehicle multiplied by the mass of jettable material deposited on the microelectromechanical system. A microelectromechanical system comprises a number of unbalanced structures, and a number of droplets of jettable material disposed on the unbalanced structures, in which the droplets of jettable material balance the unbalanced structures in a plurality of orthogonal dimensions.
A method for treating hydrogen sulfide in a solution includes providing the solution containing hydrogen sulfide. The method also includes adding sodium nitrite to the solution in an amount suitable to react with the hydrogen sulfide and treat the hydrogen sulfide.
Amine-aldehyde resins are disclosed for removing a wide variety of solids and/or ionic species from the liquids in which they are suspended and/or dissolved. These resins are especially useful as froth flotation depressants in the separation of bitumen from sand and/or clay or in the beneficiation of clay (e.g., kaolin clay) from an impure clay-containing ore. The resins are also useful for treating aqueous liquid suspensions to remove solid particulates, as well as for removing metallic ions in the purification of water.
A method and absorbent material for cleaning up contaminants, such as a petroleum-based product, with little to no water absorption. The absorbent material may include sheets, disks, or spheres of polymer-based plastic material of one to two inches thick that is manufactured and pre-conditioned to enhance absorption characteristics. The absorbent material may include smaller sieve sizes ranging from 16 to 100 that facilitate absorption and collection of a petroleum-based contaminant. Alternatively or additionally, the absorbent material may include larger sieve sizes ranging from 4 to 10 that facilitate transfer of the petroleum-based contaminant to the surface of the absorbent material. The absorbent material may be deployed at sea for a matter of minutes, and after absorbing a portion of the petroleum-based contaminant, then recovered by a recovery vessel, such as via netting, scooping, and/or vacuuming means. After which, the petroleum-based contaminant may be extracted from the absorbent material for re-use.
The present invention relates to axial flow chromatography columns, methods for separating one or more analytes in a liquid by the use of such columns, and systems employing such columns. The column comprises a first port and a second port, the first port and said second port being at essentially the same level or elevation above the level of the bed space on the chromatography column.
A process for desulphurizing hydrocarbons includes passing a mixture of hydrocarbon and hydrogen over a hydrodesulphurization catalyst to convert organosulphur compounds present in the hydrocarbon to hydrogen sulphide, passing the resulting mixture over a hydrogen sulphide sorbent including zinc oxide to reduce the hydrogen sulphide content of the mixture, and passing the hydrogen sulphide-depleted mixture over a further desulphurization material. The further desulphurization material includes one or more nickel compounds, a zinc oxide support material, and optionally one or more promoter metal compounds of iron, cobalt, copper and precious metals. The desulphurization material has a nickel content in the range 0.3 to 20% by weight and a promoter metal compound content in the range 0 to 10% by weight.
A process is disclosed for the separation of solids from gases in a mixture which is most particularly applicable to an FCC apparatus. The mixture of solids and gases are passed through a conduit and exit through a swirl arm that imparts a swirl motion having a first annular direction to centripetally separate the heavier solids from the lighter gases. The mixture then enters a gas recovery conduit in which at least one plate radially extending from an inner wall impedes rotational motion of the mixture. The mixture enters cyclones at the other end of the gas recovery conduit without substantial swirling motion.
A method for operating a measurement for a sample on an electrochemical test strip including at least two electrodes is provided. The method includes steps of applying a first voltage between the two electrodes during an interference-removal period after an incubation period succeeding a moment when the sample is detected, and applying a second voltage between the two electrodes during a test period, wherein the first voltage is larger than the second voltage, the first voltage includes one of a first fixed voltage and a first set of plural pulse voltages, and the second voltage includes a second fixed voltage.
It is an object of the present invention to derive the optimum operating condition parameters for plating operation accurately and efficiently. At first, a preliminary test operation is carried out under the energized condition (S12), then in light of such result, a sequential operations such as a first test operation (step S14) in which no energization is carried out for plurality of operating pattern candidates and a second test operation (step S16) under the energized condition are carried out, and then the optimum operating conditions are registered (step S18).
The solution reservoir apparatus of the capillary electrophoresis apparatus securely affixes an evaporation-preventing membrane to a container when a capillary is inserted or withdrawn, without extending the cathode end of the capillary. The solution reservoir apparatus comprises a container for reserving a sample or solution, a cover having a bore through which the capillary is passed and covering the container, an evaporation-preventing membrane having a capillary hole through which the capillary is passed, and a container holder for holding the container. The evaporation-preventing membrane has a projection provided at the periphery of the capillary hole, the projection of the evaporation-preventing membrane is engaged with the bore on the cover when the evaporation-preventing membrane is positioned on the cover, and the evaporation-preventing membrane is supported by the cover.
Disclosed are a method and apparatus that use an electric field for improved biological assays. The electric field is applied across a device having wells, which receive reactants, which carry a charge. The device thus uses a controllable voltage source between the first and second electrodes, which is controllable to provide a positive charge and a negative charge to a given electrode. By controlled use of the electric field charged species in a fluid in a fluid channel are directed into or out of the well by an electric field between the electrodes. The present method involves the transport of fluids, as in a microfluidic device, and the electric field-induced movement of reactive species according to various assay procedures, such as DNA sequencing, synthesis or the like.
Disclosed herein are methods and devices for dielectrokinetic chromatography. As disclosed, the devices comprise microchannels having at least one perturber which produces a non-uniformity in a field spanning the width of the microchannel. The interaction of the field non-uniformity with a perturber produces a secondary flow which competes with a primary flow. By decreasing the size of the perturber the secondary flow becomes significant for particles/analytes in the nanometer-size range. Depending on the nature of a particle/analyte present in the fluid and its interaction with the primary flow and the secondary flow, the analyte may be retained or redirected. The composition of the primary flow can be varied to affect the magnitude of primary and/or secondary flows on the particles/analytes and thereby separate and concentrate it from other particles/analytes.
A mechanism for capturing molecules is provided. A nanopore through a membrane separates a first chamber from a second chamber, and the nanopore, the first chamber, and the second chamber are filled with ionic buffer. A narrowed neck is at a middle area of the first chamber, and the narrowed neck is aligned to an entrance of the nanopore. The narrowed neck has a high intensity electric field compared to other areas of the first chamber having low intensity electric fields. The narrowed neck having the high intensity electric field concentrates the molecules at the middle area aligned to the entrance of the nanopore. Voltage applied between the first chamber and the second chamber drives the molecules, concentrated at the entrance of the nanopore, through the nanopore.
An electrochemical gas sensor includes a housing, a first working electrode within the housing and having a first section of gas transfer medium and a first layer of catalyst on the first section of gas transfer medium, and at least a second working electrode within the housing and having a second section of gas transfer medium and a second layer of catalyst on the second section of gas transfer medium. At least one of the first section of gas transfer medium and the second section of gas transfer medium includes at least one area in which the structure thereof has been irreversibly altered to limit diffusion of gas through the at least one of the first section of gas transfer medium or the second section of gas transfer medium toward the other of the at least one of the first section of gas transfer medium and the second section of gas transfer medium.
A gas sensor including a gas sensor element that extends in an axial direction and has a detection section at a front-end side thereof, and an electrode pad at a rear-end side thereof; a connection terminal that is electrically connected to the electrode pad; and an insulated separator that extends along the axial direction and has an inserting hole into which the connection terminal is inserted. An element side section is arranged within the inserting hole and is connected the electrode pad, and an external circuit side section extends further to the outside in a diametrical direction than an outer surface of the separator through one or more first bending sections from the element side section.
Provided are probes featuring multiple electrodes, which probes have diameters in the nanometer range and may be inserted into cells or other subjects so as to monitor an electrical characteristic of the subject. The probes may also include a conductive coating on at least one probe element to improve the probes' performance. The probes may also be used to inject a fluid or other agent into the subject and simultaneously monitor changes in the subject's electrical characteristics in response to the injection. Related methods of fabricating and of using the inventive probes are also provided.
A water treatment system is disclosed having electrolytic cell for liberating hydrogen from a base solution. The base solution may be a solution of brine for generating sodium hypochlorite, or potable water to be oxidized. The cell has first and second opposing electrode endplates held apart from each other by a pair of supports such that the supports enclose opposing sides of the endplates to form a cell chamber. One or more inner electrode plates are spaced apart from each other in the cell chamber in between the first and second electrode plates. The supports are configured to electrically isolate the first and second electrode plates and the inner electrode plates from each other. The first and second electrode plates are configured to receive opposite polarity charges that passively charge the inner electrode plates via conduction from the base solution to form a chemical reaction in the base solution as the base solution passes through the cell chamber.
Small, autonomous, low cost electrochemical gas generators containing an electrochemical cell assembly, a commercially available battery and a current controlling mechanism. Current control, which defines the gas generation rate, is achieved either electronically by means of a resistor or through mass transfer control by means of a gas permeable film of known permeability. In either case, the gas generation rates are generally from 0.1 to 10 cc/day. The gas source must contain an electrochemically active gas such as oxygen or hydrogen. Air is the preferred source for oxygen. These miniature gas generators, generally are less than 1.5 cm in diameter and length, require novel, compact, electrochemical cell assemblies. Various cell assemblies, generally 1 cm in diameter and less than 0.5 mm thick, are described. These miniature gas generators are used for the controlled release of fluids such as pheromones, fragrances, insect repellents, and the like.
An oxygen generator having a honeycomb body composed of an oxygen ion conducting material is disclosed. The honeycomb body includes one or more air channels, each of which is composed of a plurality of the first channels and the first connecting holes therebetween to form a tortuous air flow path for lengthening the detention time of air, and oxygen collection channels, each of which is composed of a plurality of the second channels and the second connecting holes therebetween for oxygen passage. The first and second channels, which extend laterally through across the body and parallel to each other, are all sealed with glass members at both the front face and back face of the body. The source gas is provided and exhausted from one side face of the body to the other side face via a plurality of air inlets and air outlets, respectively, which laterally intersect the first channels. A power source are with a negative terminal and positive terminal, respectively, connected to the air channels and oxygen collection channels, respectively, to force oxygen ion flow across the oxygen ion conducting material such that gas in oxygen collection channels will become riches in oxygen than in air channels. The oxygen within the oxygen collection channels is collected from the side face of the body through a plurality of oxygen outlets which laterally connect with the second channels.
The invention relates to a process for coating a substrate composed of cemented carbide, a cermet, steel or ceramic with at least one Ti1-xAlxN layer by means of a DC sputtering process. The invention further relates to a workpiece or tool which has been coated by the above-described process and to the use thereof. It is an object of the present invention to provide a process by means of which it is possible to produce coatings which combine the advantages of the sputtering process and the arc process, i.e. to make it possible to obtain a coating which has a low roughness and an advantageous (200) texture. A further object of the present invention is to provide a workpiece which has a coating having the properties mentioned. A further object of the present invention is to use tools which are particularly suitable for machining metals. The object achieved by the process is distinguished by ionization aids being used for increasing the plasma densities.
Parts stuck together in a stack are separated by placing the parts in a vibratory apparatus and vibrating the stack of parts with a vibratory head of the vibratory apparatus to separate them and also constrain the parts with the vibratory head as the parts are vibrated.
Device for generating a plasma discharge for patterning the surface of a substrate, comprising a first electrode having a first discharge portion and a second electrode having a second discharge portion, a high voltage source for generating a high voltage difference between the first and the second electrode, and positioning means for positioning the first electrode with respect to the substrate, wherein the positioning means are arranged for selectively positioning the first electrode with respect to the second electrode in a first position in which a distance between the first discharge portion and the second discharge portion is sufficiently small to support the plasma discharge at the high voltage difference, and in a second position in which the distance between the first discharge portion and the second discharge portion is sufficiently large to prevent plasma discharge at the high voltage difference.
The invention provides a method and an apparatus for manufacturing a glass-sealed package, whereby anodic bonding of a pair of wafers is ensured over substantially the whole area of the wafers, and whereby a vacuum is ensured inside the cavity during the anodic bonding of the wafers. The invention also provides an oscillator having such characteristics. The manufacturing method of a glass-sealed package includes the step of anodically bonding a pair of wafers by applying voltage to positions corresponding to circumferential portions of the wafers stacked in layers, and the step of dividing the pair of anodically bonded wafers into individual pieces. A through hole is formed at a central portion of at least one of the wafers, and the anodic bonding of the wafers is made by applying voltage using a plurality of electrodes disposed at the positions corresponding to the circumferential portions of the wafers.
A high strength and low yield ratio steel that has excellent characteristics such as low temperature toughness, a tensile strength of approximately 600 MPa or more and a low yield ratio of 80% or less. The high strength and low yield ratio steel includes, by weight percent: C: 0.02 to 0.12%, Si: 0.01 to 0.8%, Mn: 0.3 to 2.5%, P: 0.02% or less, S: 0.01% or less, Al: 0.005 to 0.5%, Nb: 0.005 to 0.10%, B: 3 to 50 ppm, Ti: 0.005 to 0.1%, N: 15 to 150 ppm, Ca: 60 ppm or less, and the balance of be and inevitable impurities, and further includes at least one component selected from the group consisting of by weight percent: Cr: 0.05 to 1.0%, Mo: 0.01 to 1.0%, Ni: 0.01 to 2.0%, Cu: 0.01 to 1.0% and V: 0.005 to 0.3%, wherein a finish cooling temperature is limited to 500 to 600° C. after the finish-rolling process. The high strength and low yield ratio steel satisfying characteristics such as low temperature toughness, brittle crack arrestability and low yield ratio, and the manufacturing method thereof may be provided.
The present disclosure relates to a high strength steel sheet having good wettability, a tensile strength of 590 MPa or more and a strength-ductility balance (TS×El) of 16,520 MPa·% or more, and a manufacturing method thereof. The high strength steel comprises, in % by weight, C: 0.03˜0.1%, Si: 0.005˜0.105%, Mn: 1.0˜3.0%, P: 0.005˜0.04%, S: 0.003% or less, N: 0.003˜0.008%, Al: 0.05˜0.4%, Mo or Cr satisfying the inequality 10≦50·[Mo %]+100·[Cr %]≦30, at least one of Ti: 0.005˜0.020%, V: 0.005˜0.050% and B: 0.0005˜0.0015%, and the balance of Fe and unavoidable impurities, wherein a microstructure of the steel sheet is a multi-phase structure comprising, in an area ratio of cross-sectional structure, 70% or more ferrite phase having a Vickers hardness Hv of 120˜250 and 10% or more martensite phase having a Vickers hardness Hv of 321˜555.
A method for cleaning a substrate processing chamber, including processing a batch of substrates within a processing chamber defining one or more processing regions. Processing the batch of substrates may be executed in a sub-routine having various sub-steps including processing a substrate from the batch within the processing chamber, removing the substrate from the processing chamber, introducing ozone into the processing chamber, and exposing the chamber to ultraviolet light for less than one minute. The substrate batch processing sub-steps may be repeated until the last substrate in the batch is processed. After processing the last substrate in the batch, the method includes removing the last substrate from the processing chamber, introducing ozone into the processing chamber; and exposing the processing chamber to ultraviolet light for three to fifteen minutes.
A method of performing a cleaning operation with an autoclavable bucketless cleaning system is disclosed. The method includes the steps of placing a cleaning solution in an inside of an autoclavable vessel, the vessel having a first connection point and a second connection point disposed at an outside of the vessel, removably connecting an autoclavable outlet regulator assembly on the vessel at the first connection point so as to be in fluid communication with the inside of the vessel, removably connecting an autoclavable inlet regulator assembly on the vessel at the second connection point so as to be in fluid communication with the inside of the vessel, pressurizing the inside of the vessel via the inlet regulator assembly, dispensing cleaning solution from the inside of the vessel via the outlet regulator assembly to clean a designated area, removing any pressurized gas that remains inside the vessel after the designated area is cleaned, removing any cleaning solution that remains inside the vessel after the designated area is cleaned, and autoclaving each of the vessel, the outlet regulator assembly, and the inlet regulator assembly.
A method for decontaminating nuclear plant surfaces, which have been contaminated with alpha emitters, is carried out subsequently to a decontamination process which is aimed at the removal of oxide layers. The surfaces are treated with an aqueous solution which contains a cationic or zwitterionic surfactant and oxalic acid. At least a part of the solution, after having acted on a surface, is conducted across an ion exchanger.
A gas distribution plate that is installed in a chamber providing a reaction space and supplies a reaction gas onto a substrate placed on a substrate placing plate, wherein the gas distribution plate includes: first and second surfaces opposing to each other, wherein the second surface faces the substrate placing plate and has a recess shape; and a plurality of injection holes each including: an inflow portion that extends from the first surface toward the second surface; a diffusing portion that extends from the second surface toward the first surface; and an orifice portion between the inflow portion and the diffusing portion, wherein the plurality of inflow portions of the plurality of injection holes decrease in gas path from edge to middle of the gas distribution plate, and wherein the plurality of diffusing portions of the plurality of injection holes have substantially the same gas path.
A method for the evaporative production of phenol-BPA adduct crystals in a crystallizer is provided. First, a supersaturated BPA solution is introduced into a crystallizer that includes a cylindrical vessel and a concentrically-disposed draft tube that defines an annular space between the vessel and tube. Next, the BPA solution is circulated through the draft tube and annular space while a coolant is uniformly distributed in the circulating flow by radially injecting a volatile hydrocarbon compound at between about 30% and 60% of a radial extent of the annular space of to form a BPA mixture. Phenol-BPA adduct crystals are produced in the vessel by evaporating the volatile hydrocarbon compound out of the BPA mixture. The method provides a consistent and uniform concentration of coolant across the surface of the boiling zone that prevents or at least reduces unwanted crystal nucleation.
Azaphthalocyanine compounds of Formula (1) and salts thereof: wherein: MAzPc represents a azaphthalocyanine nucleus of formula (A): M is 2H, Cu or Ni; each P is independently CH or N; R1, R2 are independently H or optionally substituted alkyl; R3 is optionally substituted hydrocarbyl; y is greater than 0 and less than 4; z is greater than 0 and less than 4; and the sum of y+z is in the range of from 1 to 4; 15 provided that at least one P is N in any one of the four component rings of the azaphthalocyanine nucleus. Also compositions, inks, printing processes, printed materials and ink-jet cartridges.
A heat exchanger is provided and includes a frame defining a volumetric body with substantially flat upper and lower sides, heat exchange elements disposed within an interior of the body, sorbent material disposed among the heat exchange elements within the interior of the body, retainer screens disposed at upper and lower sides of the heat exchange elements and sorbent material and structural foam layers supportively disposed between the retainer screens and the substantially flat upper and lower sides to absorb loading applied to the retainer screens.
A protocol for removing condensables from a fluid. The fluid, as an example an acid gas stream captured for EOR or CCS purposes, is initially treated to condense liquids with removal to form a gas stream. The latter is then compressed and cooled. At least a portion of this is then expanded, to form a cooled low pressure stream, and mixed with the initial fluid stream to augment cooling and condensation of condensable components.
A water-atomized iron-based steel powder is provided which comprises by weight-%: 0.45-1.50 Ni, 0.30-0.55 Mo, less than 0.3 Mn, less than 0.2 Cu, less than 0.1 C, less than 0.25 O, less than 0.5 of unavoidable impurities, and the balance being iron, and where Ni and Mo have been alloyed by a diffusion alloying process.
A securable mounting material comprises: a mounting material comprising inorganic fibers and having a major surface; and a layer of thermally activatable adhesive inwardly disposed on the inorganic fibers proximate the major surface. The thermally activatable adhesive comprises at least one compound represented by the formula: (Mm+)d((ZpOq(OH)r)n−)e.(H2O)f M represents a cationic species other than H+; O represents oxygen; Z represents boron or phosphorus; f is a real number greater than or equal to zero; d, n, q, and r are integers greater than or equal to zero; e, m, and p are integers greater than or equal to one; and d times m equals e times n. The mounting material is useful in pollution control devices. A method of making the mounting material is also disclosed.
Methods and reactors for producing a fuel are disclosed herein. In some embodiments, the method uses a biomass feedstock and alkane and/or alcohol feedstock, which can be contacted with a metal-containing catalyst to form products including a bio-oil. In some embodiments, oxygen-containing functional groups can be removed from a bio-oil using one or more zeolite thin films.
The present invention generally relates to implantable devices for producing insulin in diabetic animals and to methods of making same. Some embodiments include amphiphilic biomembranes for use in biological applications (e.g., as an alternative and/or supplemental insulin source). Some embodiments also include live insulin-producing cells contained within one or more amphiphilic membranes so as to prevent or diminish an immuno-response and/or rejection by the host.
A cotyloid implant including a screwable cup receiving an articular insert. The cup is provided with screwing elements (11) on the periphery thereof and more particularly in the equatorial area (2) thereof, the elements being used to penetrate the bone material of the acetabular cup during screwing. The cup includes an osteointegration-facilitating coating such as a selective calcium hydroxyapatite coating. The coating (16) is a thick coating on the convex parts of the outer surface of the cup, including areas or valleys or hollow thread elements which are left free in the screwing elements. The coating is not as thick (17) on raised areas or screw thread areas.
A joint assembly incorporated into a reconditioned end surface established between upper and opposing lower bones. At least one first component is anchored into a first of the reconditioned bone end surfaces and exhibits a rotatably supported wheel. A second component is anchored into a second opposing reconditioned bone end surfaces and exhibits a second exposed support surface in contact with the rotatably supported wheel. The first component includes a supporting well anchored into the reconditioned bone end surface for supporting the wheel in rotatable fashion. A laterally inserting pin displaces relative to a side of the wheel well and into an interior thereof and includes a central axial through hole which receives the pin for supporting the shaft.
An implant assembly for re-establishing a glenohumeral joint between a scapular and humerus. A ball is adapted to being mounted to a reconditioned glenoid cavity defined in the scapula along with a receiver mounted to a reconditioned humeral head associated with the humerus. A substantially spherical shaped element is interposed between the ball and receiver and establishes first and second articulating surfaces. A concave recess is defined in an exposed face of the ball for seating in articulating fashion a portion of the spherical element. A concave recess is defined in the spherical shaped element for seating in articulating fashion an exposed portion of the scapula mounted ball. Each of the ball, spherical element and receiver is constructed of an alternating material including at least one of a polymer, polymer composite, metal, metal composite or polymer/metal admixture.
Disclosed is an implantable one-piece heart prosthesis having a driving artificial ventricle and a driven artificial ventricle. A main actuator is configured to transmit to the driving artificial ventricle diastolic and systolic flow rates having desired respective values for the driving artificial ventricle. An auxiliary actuator is configured to transmit to the driven artificial ventricle correction systolic and diastolic flow rates that correct the systolic and diastolic flow rates transmitted by the main actuator to the driven artificial ventricle.
A device delivers a chemical or biological agent, the device comprises an imprint molecule (IM) to be delivered by the device; an electroactive molecularly imprinted polymer (EMIP) imprinted with the imprint molecule, the EMIP having a plurality of binding sites capable of binding the imprint; and an electric potential producing member (EPM), the EPM being capable of producing an electric potential between the EPM and the EMIP; whereby when the EMIP has a predetermined density of imprint molecule bound at the binding sites, and whereby when a sufficient potential is produced between the EPM and the EMIP, the imprint molecule is released from the binding site and thereby delivered by the device.
A stent deployment device over which a stent is securable for the purpose of delivery into an operative position in a human body is provided. The device comprises a plurality of elongate wings, each of which has a length consistent with the length of a stent to be deployed using the deployment device, the wings being arranged circumferentially about a central body which extends from, and is operable through, a catheter. The wings are movable between a radially withdrawn delivery position and expanded positions in which they are displaced radially outwards of the body. A flow path is defined internally of the wings in the expanded positions thereof and a temporary valve is provided in such flow path to permit the flow of blood though the flow path predominantly in one direction. An inflatable annular balloon is preferably provided over the wings to cause final expansion of the stent. Locator arms are deployable from the body to assist in locating the body within a natural heart valve.
An endovascular delivery device (1) has a portion, such as the nose cone dilator (8), being formed from a radiopaque material and that portion has a selected transverse profile such as a notch (26) so that in a selected rotational orientation of the endovascular delivery device the nose cone dilator can be observed by radiographic means during an endovascular procedure to be in that selected rotational orientation. The selected transverse profile can be a notch, protrusion or aperture. The notch or aperture can be filled with a radio-transparent material to provide a sooth outer surface.
Apparatus and method are provided for treatment of a bifurcation of a body lumen. The apparatus includes an elongated catheter body having a proximal end and a distal end. A balloon is associated with the distal end of the balloon catheter. The balloon includes a main vessel balloon for treating a main vessel of the bifurcation, and a branch vessel balloon for treating a branch vessel of the bifurcation. The branch vessel balloon includes an accordion configuration capable of being expanded from an unexpanded collapsed accordion configuration to an expanded accordion configuration extending into the branch vessel.
A stent includes a first flaring portion including first and second sets of cells that flare outwardly when the stent is expanded from a contracted to a flared condition, and a second main portion connected to the first flaring portion. During use, the stent is introduced into a main vessel in the contracted condition and positioned with the first portion adjacent an ostium. The first portion is flared, causing first struts of the first set of cells to move from an axial towards a radial and partial circumferential orientation and causing second struts of the second set of cells to move from an axial towards a radial orientation. The second portion resists expansion when the first portion is flared. The stent is expanded further such that the second portion expands within the branch body lumen, and the first and second struts move towards a more circumferential orientation.
A device and method for dermatological use with one or a plurality of active components and a failsafe control. The device includes a light source configured to be toggled between an activated state and an inactivated state, a photosensitive detector configured to detect incoming light and a processing unit for the failsafe control. The processing unit is configured to concurrently determine whether light detected by the photosensitive detector is indicative of a safe operating proximity and is indicative of a safe operating skin tonal range; and activate the active components only when the processing unit determines that the device is within the safe operating proximity, and that the light reflected from the surface is indicative of the safe operating proximity and safe operating skin tonal range.
The invention concerns a scanning device for focusing a beam of rays in defined regions of a defined volume, comprising an input optics wherein the beam of rays penetrates first, having at least one first optical element; a focusing optics for focusing the beam of rays exiting from the input optics; and a deflecting device arranged between the first optical element and the focusing optics, for deflecting the beam of rays after it has passed through the first optical element, based on a position of the focus to be adjusted in lateral direction. In order to adjust the position of the focus of the beam of rays in the direction of the beam of rays, and optical element of the input optics can be displaced relative to the deflecting device.
A receiving member has a primary socket for a fixation mechanism and a secondary socket for a locking device. The secondary socket has a first bore intersecting a portion of the primary socket and forming an arcuate cut-out. The secondary socket has a chord member extending into the secondary socket first bore that forms a radial undercut in the secondary socket. The secondary socket has a detent extending from the radial undercut into the chord member. The locking device is rotatable in the secondary socket between an unlocked position in which an engagement surface of a cap of the locking device is angularly displaced from the arcuate cut-out, and a locked position in which the cap engagement surface occupies the arcuate cut-out and engages the fixation mechanism, and the arm engages an underside of the chord member, thereby preventing the fixation member from disengaging the receiving member primary socket.
An interspinous process spacer for implantation in an interspinous space between a superior spinous process and an inferior spinous process includes a balloon-like body, a first deployable protrusion and a second deployable protrusion. The body has a distal end, a proximal end and a longitudinal axis extending between the proximal and distal ends. The spacer is arrangeable in an unexpanded configuration and an expanded configuration. The first deployable protrusion is mounted proximate the proximal end and the second deployable protrusion is mounted proximate the distal end. The first and second deployable protrusions are oriented generally parallel to the longitudinal axis in the unexpanded configuration and generally perpendicular to the longitudinal axis in the expanded configuration.
A dynamic spine prosthesis (such as a facet joint prosthesis having an articulation surface configured to articulate with a corresponding facet joint element) that has a fixation element with an elongated bone entry portion defining a longitudinal axis and a dynamic spine prosthesis component connected to the fixation element at a connection location by an adjustable connection. The adjustable connection has first and second washers each rotatably supported by the fixation element and each having an angled contact surface in a plane not perpendicular to the longitudinal axis of the fixation element, with the connection location being between the bone entry portion and the first and second washers.
A method and apparatus for closing a vascular wound includes a guidewire and/or other surgical implement extending from the wound. A hemostatic material is advanced over the surgical implement and into contact with an area of the blood vessel surrounding the wound. The surgical implement is removed. Blood soaks the hemostatic material, and blood clotting is facilitated by the hemostatic agent within the material. A sealing layer of adhesive can be applied to the hemostatic material, confining the blood flow to the material. The vascular puncture wound is sealed by natural blood clot formation.
A laparoscopic surgical instrument includes a shaft and a head having a distal end to which a variety of surgical instruments are attached. The laparoscopic surgical instrument also includes a flexible joint installed between the shaft and the head; a longitudinal-driving unit including a longitudinal-driving wire connected with both longitudinal ends of the head and a longitudinal-driving roller turning the longitudinal-driving wire and a transverse-driving unit including a transverse-driving wire connected with both transverse ends of the head and a transverse-driving roller turning the transverse-driving wire. The longitudinal-driving unit turns the flexible joint in the longitudinal direction, the transverse-driving unit turns the flexible joint in the transverse direction, and the shaft has a small diameter.
Systems and methods for using a trocar system are disclosed. The system generally includes a handle having a first end a second end, a trocar disposed adjacent the first end of the handle, cannulas disposed on the trocar, and a drive system. The drive system is disposed for forward movement of the cannulas in a longitudinal direction away from the second end of the handle.
A ligature device and method of use are disclosed. More specifically, a ligature device capable of maintaining a ligature band in an elongated position, applying a preformed ligation band to an object to be ligated, manually releasing the ligation band from an elongated position, and securing a ligation band in a tensioned position is described. The ligation device may be used to apply ligation bands to various body parts of various animals.
A delivery catheter with a plug ejection mechanism with a fluid filled actuator incorporated in the catheter's handle is disclosed. After delivery of RF energy, the clinician deploys the plug within the region of the lesion by activating the plug ejection mechanism.
An improved wire guide and method for cannulating a bodily lumen, such the biliary tree are provided for procedures such as endoscopic retrograde cholangiopancreatography (ECRP). The wire guide and cannulation method minimizes the potential for trauma to the ducts while reducing the chances of disconnecting the wire guide from newer access devices. Generally, the wire guide includes an atraumatic tassel tip which is operable between delivery and deployed configurations.
A connecting member insertable, at a fracture, inside a bone structure of a human or animal body to immobilize at least two bone portions. The connecting member has at least one radioactive source located at a predetermined reference point.
A mechanical cutting device that makes use of mechanical (rotary) motion and suction to engage tissue also applies a cutting energy sufficient to vaporize the tissue. The rotation and suction are used to engage the tissue (sucking tissue into cutting windows when the cutting windows of inner and outer blades are aligned), and then the cutting member(s) function as an electrode(s) by having an electrical cutting signal applied thereto so that the cutting member(s) electrically cut the tissue as the cutting members relatively rotate. The electrical cutting signal is only applied as the windows become aligned up until the cutting of the tissue is completed. The cutting signal preferably is stopped after the cutting windows become misaligned. While the cutting windows are misaligned, a coagulation signal can be supplied to the cutting member so that the device functions as an electrocautery device.
A surgical treatment device which is used together with an endoscope, includes a sheath, a treatment portion which is arranged at the distal end portion of the sheath and includes first to third electrodes configured to treat a living tissue by using electrical energy, an operation portion which is arranged at a proximal end portion of the sheath and which is configured to operate the treatment portion, and a switching portion which is configured to switch between a first mode in which a treatment is given by using the first electrode and at least one of the second and third electrodes in the treatment portion and a second mode in which a treatment is given by using the second and third electrodes.
Devices and methods for shaping an ablation treatment volume formed in fluid enhanced ablation therapy are provided. The devices and methods disclosed herein utilize the interaction of fluids to create ablation treatment volumes having a variety of shapes. In one embodiment, a method for forming an ablation treatment volume having a desired shape includes delivering therapeutic energy to tissue to form an ablation treatment volume and simultaneously delivering a first fluid and a second fluid to the tissue. The first and second fluids can convect the therapeutic energy in a desired direction such that the ablation treatment volume has a desired shape.
Disclosed herein are ablation systems and methods for providing feedback on lesion formation in real-time. The methods and systems assess absorptivity of tissue based on a degree of electric coupling or contact between an ablation electrode and the tissue. The absorptivity can then be used, along with other information, including, power levels and activation times, to provide real-time feedback on the lesions being created. Feedback may be provided, for example, in the form of estimated lesion volumes and other lesion characteristics. The methods and systems can provide estimated treatment times to achieve a desired lesion characteristic for a given degree of contact, as well as depth of a lesion being created. The degree of contact may be measured using different techniques, including the phase angle techniques and a coupling index.
The present invention relates to an adaptable therapeutic, diagnostic or surgical guide for an intra-operative adjustment of a guidance element to a pre-planned position. An advantage and innovation of the present invention is that it provides a template or guide that adapts in a controlled way to a changed intra-operative anatomical situation compared to the default planned situation. This adaption maybe purely positional but it may also include force feedback. Feedback, either visual feedback or force feedback that results in an adjustment of a guidance element is also an aspect of the present invention. For example, the feedback can contain information either about the fit of the guide or template onto a bone (in case the guide or template fits onto one bone) or about the relative position of two bones of bone fragments (e.g. ligament tension between the femur and tibia).
A dermal or transdermal drug-delivery skin patch has a blood pressure sensor structurally integrated or built into it. The skin patch when attached to a skin portion of an individual determines a blood pressure of the individual and in response needle-lessly delivers a treatment drug to the individual if necessary.
Method and surgical instrument for treating prostate tissue including a surgical instrument having a main body, a needle deployment port, a needle, first and second handles and a lockout release mechanism to limit needle extension. Additionally, a kit includes the surgical instrument, together with a cystoscope, and optionally a syringe and reservoir of ethanol. The method includes needle-less injection and visualizing the ethanol injection by delivering both an echogenic agent and ethanol either by needle or needle-less injection or by providing an ultrasonically visible marker near the tip of the ethanol delivery cannula. The method also includes extending the needle transversely of the instrument housing using a link assembly.
A medication and identification information transfer system is provided that includes a medication vial, a secondary medication container (syringe) and a medication information transfer apparatus. The medication information transfer apparatus, when coupled to a vial, can transfer information indicative of the contents of the vial to an intelligent injection site. The medication information transfer apparatus has a shape and size enabling it to be connected to a vial adapter for removal of medication from the vial transfer it to a syringe for delivery to an injection site while simultaneously transferring information about the medication in the vial to the injection site. In some implementations, the medication injection site can be placed on a fluid delivery line for infusion into a patient. Related apparatus, systems, and kits are also disclosed.
A catamenial device. The device has a topsheet having a body facing surface, a backsheet joined to said topsheet, and an absorbent core disposed between the topsheet and the backsheet, wherein the absorbent core having three zones differing in stiffness, at least one of the zones including laterally-oriented portions where material from the core has been removed, the portions defining slots.
By providing a non-liquid drug reservoir layer 2 having first and second principal surfaces and containing a drug and a polymer that is to be a base, a drug permeation layer 4 disposed at the first principal surface side of the drug reservoir layer 2 and being lower in permeability of the drug than the drug reservoir layer 2, and a first backing 3 with a bending resistance of 10 to 80 mm that is formed so as to cover a side surface of the drug reservoir layer, skin irritation can be reduced.
In accordance with embodiments of the present invention, a debris removal system is provided for a body-space drainage system having one or more body tubes with a body tube lumen disposed therein. The debris-removal system comprises an elongated cleaning member and a cleaning head adapted to be advanced distally at least a portion of a length of the body tube lumen to dislodge debris therein. A collapsible sheath can be used to maintain a sterile field in the body tube lumen while the cleaning member is being used by enclosing at least a portion of the cleaning member that is not contained within the body tube lumen, and permitting external digital manipulation of the cleaning member through the sheath to advance and/or retract the cleaning member, and cleaning head, in the body tube lumen.
Drug delivery device, comprising a body unit having a first opening and a second opening, a plunger arranged such that its distal end is positioned inside the body unit, wherein the plunger is moveable in the distal direction with respect to the body unit, a needle assembly, with a proximal end and a distal end comprising a needle, wherein the proximal end of the needle assembly and the distal end of the plunger are configured such that they can get into an adhesion connection.
A reservoir and a plunger head contained within may be configured to move relative to each other in response to at least one of the reservoir being detached from a base, the base and/or the reservoir being removed from a packaging, and the base and/or the reservoir being moved relative to each other. A first layer may be configured to define a reservoir, the first layer, which may be made of a material compatible with fluidic media in the reservoir, may be adjacent a second layer for inhibiting a diffusion through the second layer. A first layer that may be less than 0.3 mm and made of a cyclic olefin copolymer may be configured to define a reservoir. A reservoir may be defined by a wall made of a cyclic olefin copolymer and the wall may be for substantially preventing light from passing through the reservoir.
This invention relates to the field of balloon catheters and more particularly to catheter balloons having controlled failure mechanisms for the prevention of catastrophic failure of the balloon during overpressure conditions.
Systems, devices, methods, and compositions are described for providing an actively-controllable disinfecting implantable device configured to, for example, treat or prevent an infection in a biological subject.
A method and apparatus for controlling blood withdrawal and infusion flow rate with the use of a pressure controller. The pressure controller uses pressure targets based upon occlusion limits that are calculated as a function of flow. The controller has the ability to switch from controlling withdrawal pressure to controlling infusion pressure based upon the detection of an occlusion. The controller distinguishes between partial and total occlusions of the withdrawal vein providing blood access. Depending on the nature of occlusion, the controller limits or temporarily reverses blood flow and, thus, prevents withdrawal vessel collapse or reverses blood flow to quickly infuse blood into the vessel without participation from operator.
The present invention relates to a movement disorder monitor, and a method of measuring the severity of a subject's movement disorder. The present invention additionally relates to a treatment delivery system for treating a subject in response to changes in the severity of a subject's symptoms. The present invention further provides for a system and method, which can accurately quantify symptoms of movement disorders, utilizing continuously obtained kinetic information to be analyzed, accurately distinguishing between symptoms of movement disorders and activities of daily living, relating quantified symptoms to a standard clinical rating scale, and correlating a subject's symptoms with certain physiological and environmental factors. The present invention still further provides for home monitoring of symptoms in subjects with these movement disorders in order to capture the complex fluctuation patterns of the disease over the course of days, weeks, months, or years.
Disclosed herein are a method for estimating acoustic velocity of an ultrasonic image and an ultrasonic diagnosis apparatus using the same. The method for estimating acoustic velocity of an ultrasonic image includes: (A) dividing each of the ultrasonic images into a plurality of blocks; (B) extracting contours of ultrasonic images for each block of one frame among the ultrasonic images; (C) calculating and analyzing average luminance values of each block; (D) determining the optimal block number using the average luminance values and selecting the optimal blocks; and (E) estimating and applying the real acoustic velocity, whereby the acoustic velocity is estimated in real time and is applied to the ultrasonic diagnosis apparatus.
An improved laryngoscope that is useful in endotracheal intubation. The laryngoscope includes an inner magnetic element that is situated at an end of the laryngoscope's blade and an outer magnetic element that is positioned on a patient's throat in such a manner that the interaction between the inner and outer elements attracts the end of the blade toward the patient's epiglottic vallecula when the blade is moved into the patient's throat. The blade also includes a magnetic bed located along its longitudinal axis. The magnetic bed is designed to interact with a metallic spiral tube and, by means of this interaction, guide the tube properly in the patient's inner air tract. The blade also includes at least three coplanar elements that able to rotate relative to each other. The adjustment of these elements increases the blade's usefulness for moving the patient's tissues and opening a passage to the patient's trachea.
A valve apparatus device provides surgical instruments with sealable access to an inlet port of an endoscope instrument channel. The valve has a hollow body with a distal end that releasably attaches to the inlet port, and a flexible diaphragm seal dividing the body into a proximal chamber and a distal chamber. An instrument opening extends through the diaphragm seal for the passage of instruments therethrough, and connects the chambers together. The diaphragm seal is configured to seal with a surgical instrument inserted into the instrument opening. At least one fluid transfer member is provided to fluidly interconnect the proximal chamber to the distal chamber when the surgical instrument is sealed within the instrument opening.
Disclosed herein is a maneuverable capsule endoscope. A capsule body is input into an internal organ to take images of the inside of the internal organ. A fan unit is mounted on the body. A fan position-changing device changes a direction in which the fan unit discharges fluid. The fan unit is mounted inside a duct without damaging the inner wall of the internal organ. When input into the internal organ, the capsule endoscope can concentrically take images of a specific portion inside the internal organ, and can freely take images of a portion that is intended to be photographed.
The invention relates to an apparatus for stimulating a healing process comprising a coil arrangement which is coupled to a functional power generator in order to generate an electromagnetic field in an affected body region, a control unit for influencing a voltage curve generated by the functional power generator in accordance with signals transmitted to an input interface of the control unit, a sensor array for sensing a characteristic of the affected body region, transmission device which is coupled to the sensor array in order to transmit a signal characteristic of the detected characteristic of the affected body zone to the control unit.
A centrifuge comprising a zonal rotor, a centrifuge chamber having a side wall and a bottom wall to contain the zonal rotor, an upper shield to cover the top of the centrifuge chamber and enclose the zonal rotor, and an annulus in the centrifuge chamber that is laterally spaced apart from the zonal rotor. The annulus has a channel with a base and a lip, where the channel has an open end facing the direction of the upper shield to collect liquid sample leaked during loading or unloading the zonal rotor.
A variably configured exercise device is provided. The exercise device can include a vertical support member having a longitudinal axis, a sliding member configured to move along the vertical support member in a direction substantially parallel to the longitudinal axis, a pair of rails each having first and second end portions. The first end portion of each rail can be pivotally connected to the sliding member on the vertical support member. The exercise device can further include an actuation mechanism coupled to the sliding member where the actuation mechanism can be configured to selectively adjust the position of the sliding member relative to the vertical support member.
A method and system for performing linear and circular movement patterns is provided. The method and the system include a limb-activated linearly and circularly moveable apparatus comprising a rotatable platform coupled to a slideable base. A limb gripping the apparatus can slide the apparatus across a surface while rotating the platform. The apparatus is designed to constantly realign the joints involved in the movements and without straining the joints of the body to maximize productivity and promote joint comfort.
The nature of this invention is that it is an exercise ring and accessory wand that is twirled by the wrist, ankle or with wand to strengthen various body parts. The ring weighs one to twenty pounds, has an inside diameter of 8-18 inches, an outside diameter of 10-20 inches and is one to two inches thick depending on design and materials. The wand has two knobs for retaining the ring as it is twirled by hand and is one inch thick and 12 to 18 inches long.
The present invention relates to an exercise system for giving feedback to a user thereof and to a method for communication between different devices in the exercise system. The exercise system comprises at least two body coupled communication modules (14) for forming a body area network and at least one exercise device (2) comprising at least one sensor (6), feedback means (8) and one of the at least two body coupled communication devices. The exercise system further comprises a processing unit (4) for collecting and processing user data from the at least one sensor (6) and output the processed data on the feedback means (8) via the body area network in order to give the user feedback on his exercise.
Disclosed herein are training devices useful for improving the agility and/or speed of a trainee, systems comprising same, and methods of improving a trainee's agility and/or speed. In one embodiment a training device comprises a first sensor operatively associated with a control mechanism, wherein the control mechanism is optionally configured to enable the device to move (a) randomly, (b) in a predetermined movement pattern, or (c) in relation to a second sensor.
A system and method for controlling a start-stop system for an engine in a vehicle includes automatically stopping the engine with a transmission gear lever of the vehicle in DRIVE. The engine is automatically restarted when the vehicle is shifted out of DRIVE and at least one condition is met. The at least one condition includes a final position of the gear lever. Automatic restarting of the engine is suppressed when the vehicle is shifted out of DRIVE and at least one other condition is met; the at least one other condition also including a final position of the gear lever.
A system and method for controlling a power source when a transmission malfunctions in a hybrid vehicle is disclosed. In particular, a control unit confirms a speed of a transmission output is 0 rpms, detects whether the transmission is in park or neutral, and limits a speed of an engine and a motor in response to determining that the transmission is in park or neutral and that the transmission output is 0 rpms.
A planetary gear transmission unit (10) includes a ring gear (17), a sun gear (18) and a planet carrier (19) driving a plurality of planet shafts (12) onto which planet gears (11) are rotatably mounted by way of planet bearings (13). The planet shafts are flexpin shafts (12) and each flexpin shaft (12) includes a pair of planet gears (11), each planet gear (11) of the pair being of the single helical type having a helix angle opposite to that of the other planet gear (11) of the pair. A gearbox (20) including a planetary gear transmission unit (10) according to embodiments of the invention and a wind turbine including such a gearbox (20) are also described.
[Object] A unidirectional clutch can reduce a backlash without increasing the number of components, and also can improve silence and durability.[Means of Solving Problem] In a planet gear member 4 including a planet gear 4a which meshes an internal gear 2b of an outer member 2, locking teeth 4b are provided coaxially and integrally relative to the planet gear through a flange 4c. In an inner member 3, U-shaped wall portions 3b receiving the locking teeth 4b are provided. In the U-shaped wall portion, an engaging portion 5 is provided so that teeth of one portion of the locking teeth can engage. A locked state is attained by the locking teeth, so that even if the planet gear receives a restriction of the number of teeth, the number of the teeth (pitch) of the locking teeth can be finely set arbitrarily. Accordingly, an interval of the locked state accompanied by a rotation of the planet gear member becomes fine so as to be capable of reducing the backlash in the unidirectional clutch without increasing the number of components.
A vehicle drive unit includes an axle formed of an output shaft of a motor, and a first support shaft and a second support shaft arranged at both ends of the output shaft. A stator is held on a first holding plate and a second holding plate. The second holding plate and a bearing block form a carrier of planetary gears. The second holding plate includes a bearing holding portion. The second support shaft is supported on the bearing holding portion. The first support shaft is supported on the first holding plate. The output shaft is supported at one end on the first holding plate and the other end on the bearing holding portion.
A golf club includes a shaft and a club head. The club head may include a ball striking face, a crown, a sole, and a hosel region. The hosel region may have a free end configured for receiving a shaft having a longitudinal axis. When the club head is in a 60 degree lie angle position, at least a portion of the free end of the hosel region may extend above the adjacent crown surface. When the club head is in a 60 degree lie angle position, the vertical distance between the horizontal projections of the outermost points of the sole and the crown may be greater than the vertical distance between the horizontal projections of the outermost points of the sole and the hosel region.
A device for changing the mass characteristics of a golf club may include a first movable mass. The device may also include a first movable mass guide configured to accommodate longitudinal travel of the first movable mass along the golf club shaft. The first movable mass guide may not extend beyond the distal end of the golf club shaft. The golf club head may include a second movable mass and a second movable mass guide that accommodates travel of the second movable mass.
A network gaming system and method including a server having plural regular games for selection, and plural tournament games for plural players. The system also has plural gaming devices each in communication with the server to conduct a selected regular game upon receipt of a regular wager, and to enter a first tournament game upon receipt of a first tournament wager, and to simultaneously enter a second tournament game upon receipt of a second tournament wager. The system also has a payout system to award a regular game winning player a regular prize, and to award a tournament winning player a tournament prize.
A video gaming device includes a game computer which is connected to a central computer and a plurality of player stations connected to the game computer. Connection of the player stations may be effected using an interface device which includes at least one serial port which has a transmit line for transmitting data to a player station and a receive line for receiving data from a player station, input port means and output port means for communication with the game computer, and processing means for routing data between the said serial port and the input and output port means.
In a geographic location based game (geogame), players, utilizing wireless devices, are required to continuously physically move within a defined boundary throughout the geogame. The wireless devices, with the aid of a location system, such as GPS, track the movements of the players. As players move, virtual tails are generated behind each player, and their locations are determined and geocast, via a wireless geographic broadcast protocol, to all players of the geogame. Each player observes all players movements and tail locations on his/her wireless device. If a player stops moving, the player is expelled from the game. If a player exits the confines of the boundary, the player is expelled from the game. If a player crosses a virtual tail, the player is expelled from the game. If two virtual tails cross, both players are expelled from the game. The last player remaining is the winner.
A method of regenerating a polishing pad for polishing semiconductor wafers is described wherein the polishing pad is removably stacked, aligned and fixed by a fitting ring to a polishing pad supporting surface of a polishing pad sub plate mounted on a central surface of a sub plate main body on an upper surface of a polisher rotation table and wherein the regeneration may include dressing, as well as cleaning, or regrooving the polishing pad surface.
An improved encasement for underwires for use in brassieres that allow for more efficient sewing, better durability, and improved wearer comfort is disclosed.
A floating technical hollow body (1), in particular for covering open liquid areas, comprises a shell, which is formed by at least two interconnected shell parts (1A, 1B), which at least comprises one opening (2.2) for filling the shell interior with liquid, and in which at least a fluid-in particular an air-tight inner hollow body (4; 4′) is arranged.
Electrical connectors suitable for wet environments and even underwater mating are provided. A replaceable gel filled cartridge affixes over sockets of a female plug. Water channels and radial holes in the receptacle combine to form a pathway for water ejection during connection formation. A coupling nut secures the female plug to the male connector. A spring housed within the coupling nut allows the coupling nut to further rotate, after pins are seated in respective sockets, to seal water holes. The cartridge is filled with hydrophobic gel and has a diaphragm sandwiched between a front and a rear housing. Contact pins pass through the diaphragm and pass through the gel filled rear housing before mating with respective sockets. Trapping of water is minimized with the escape of water via channels in the receptacle. Contaminated or lost gel is readily replaced via the cartridge affording multiple wet-mateable connections for a given connector.
An offensive player operates input means (32) to display on a display screen (31), one or more associated problems from a plenty of problems stored in a memory (42), so that the offensive player and a defensive player both input answers. According to the results (correct or incorrect) of the inputted answers, a damage point is given to the player who has lost. When the damage point of the partner player reaches a predetermined value, a plurality of associated problems are represented. Moreover, two areas (11, 12) are displayed on the display screen (31) for the offensive player and the defensive player. A card (3) for representing the problem this time is placed in the area (11 or 12) of the player who has won. Only when the area (11) is full of cards (3) and the area (12) has a card, a plurality of associated problems may be represented. The present invention enables players to get a systematic knowledge while enjoying a match, thereby increasing the learning effect.
Interactive electronic training systems and methods are described herein. Certain embodiments provide preprogrammed video, audio, and/or textual presentations of training materials which provide information related to skills/information to be trained. A scenario including real or animated actors is presented, simulating an interaction. The training system presents related queries for the trainee who audibly responds. The training system stores a score based in part on a comparison of the trainee's response with an answer stored in training system memory. Optionally, the scores are substantially immediately presented by the system to the trainee.
A sports electronic training system, and applications thereof, are disclosed. In an embodiment, the system comprises at least one monitor and a portable electronic processing device for receiving data from the at least one monitor and providing feedback to an individual based on the received data. The monitor can be a motion monitor that measures an individual's performance such as, for example, speed, pace and distance for a runner. Other monitors might include a heart rate monitor, a temperature monitor, an altimeter, et cetera. Feedback provided to a user typically includes, for example, training information such as whether the user is satisfying specific workout and/or training criteria. In an embodiment, the functionality of the sports electronic training system is enhanced by enabling the portable electronic processing device to interact with other devices and applications, for example, using the Internet.
The present invention features a method of teaching a child the letters of the alphabet, the numbers, the shapes, and the primary colors by a caregiver. The method features obtaining a teachable clothing system featuring a teachable clothing article of clothing having a character attached thereon. The character is located in view of a wearer when worn. The character is reachable by a hand of the wearer when worn. The system features a teachable clothing game book. The method features outfitting the teachable clothing article of clothing on a child, verbalizing a character name, verbalizing a character color, pointing to an object in an occupied room having the same character color as the character, and reading the teachable clothing game book to the child at a child's end of the day and playing a game described in the teachable clothing game book with the child.
A method is provided that includes advancing a drill having a distal end through an occlusal cortex into trabecular bone of an alveolar ridge, and ceasing the advancing of the drill when the distal end of the drill reaches an occlusal surface of a superior cortex of the alveolar ridge. Other embodiments are also described.
An automatic candle blower having a main housing with a base and a back member. The back member has a plurality of vent holes therethrough, each of the vent holes providing an air flow path from the interior of the main housing. A candle support surface is formed adjacent to the back member to support a candle. A blower is positioned to direct air to the vent holes. An air channel is formed within the main housing between the blower and the vent holes. An alternative embodiment of the invention further includes a control circuit, which has a processor, a timer, and a processor-readable medium, is electrically connected to the blower. A user input device is electrically connected to the control circuit.
An extrusion process incorporates a forming manifold where a tubular flow of a second material is intermittently interrupted while a core flow of a first material is discharged substantially continuously. Subsequently, the core flow is severed to form individual food items or treats for humans, animals, and the like, where the tubular flow results in an outer component surrounding an inner component which protrudes from one or both ends of the outer component. Material of the core flow is bone-like, while material of the tubular flow is meat like. Material of the tubular flow may include material from the core flow subjected to mixing in a static mixer to achieve a marbled texture of the outer material.
Screw compressor (1) comprising: a male (2) and a female rotor (3) rotating respectively around a first axis (01) and second axis (02) of rotation, said rotors (2;3) showing, in cross section, meshing lobes (4) and valleys (6) and having profiles generated by enveloping a rack profile (p) including a first curve (z1) of the rack profile (p) extending between a first point (H) and a second point (Q) in a Cartesian reference frame (X, Y) and having a convexity in the positive direction of the axis of abscissa (X), said first point (H) lying on the axis of abscissa (X) at a distance from an origin (0) of the Cartesian reference frame (X, Y) equal to an addendum (hi) of the male rotor (2).
A method of assembling a rotor blade for use with a wind turbine. The method includes coupling a first sparcap to at least one first panel wall to form a first blade section, wherein the first sparcap has a first chordwise width. A second sparcap is coupled to at least one second panel wall to form a second blade section. The second sparcap has a second chordwise width that is larger than the first chordwise width. The first blade section is coupled to the second blade section to form the rotor blade.
An air boost device such as a turbocharger, wherein the compressor wheel thereof is re-designed to permit die inserts (20), which occupy the air passage and define the blades (4, 5) during a process of forming a wax pattern (21) of a compressor wheel, to be pulled without being impeded by the blades. This modified blade design enables the automated production of wax patterns (21) using simplified tooling. The compressor wheel improves low cycle fatigue, withstands high temperatures and temperature changes, and permits operation at high boost pressure ratio while, on the other hand, having low weight, low inertial drag, and high responsiveness.