摘要:
L'invention concerne des oligonucléotides ayant une séquence de nucléotides d'au moins une partie du transcript d'ARN messager du gène humain c-kit. Ces oligonucléotides "non codants" sont hybridables avec le transcript d'ARN messager. Lesdits oligonucléotides sont utiles pour inhiber sélectivement la prolifération de cellules érythrocytes, notamment dans les troubles caractérisés par un hématocyte élevé dû à la surproduction d'érythrocytes. Les oligomères non codants présentent également des celllules néoplastiques hématologiques constituant des agents actifs et sont par conséquent adaptés à une utilisation comme agents purgatifs de la moëlle osseuse.
摘要:
The effectiveness of selected antineoplastic agents may be determined in individual patients by comparing the level of expression of one or more selected growth-regulated genes in neoplastic cells taken from the patient before and shortly after the initiation of therapy. A decrement in expression is prognostic of eventual remission, while a lack of decrement indicates that remission is unlikely. The test may also be accomplished by comparing the level of expression of growth-regulated genes in neoplastic cells in culture before and after incubation of the cells with the selected antineoplastic agents.
摘要:
L'invention concerne des oligonucléotides comportant une séquence de nucléotides complémentaire à au moins une partie du transcrit de l'ARN messager du gène humain c-myb. On peut hybrider ces oligonucléotides non codants avec le transcrit de l'ARNm du c-myb. Lesdits oligonucléotides sont utiles pour traiter des néoplasmes hématologiques et pour induire une immunosuppression. Ils sont particulièrement utiles en tant qu'agents purgeant la moelle osseuse.
摘要:
Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.