摘要:
A platelet aggregation inhibiting polypeptide having the following amino acid sequence: X-Cys-R-R-R-Arg-Gly-Asp-R-R-R-R-R-Cys-Y wherein X is H or at least one amino acid; Y is OH or at least one amino acid; and each R, either the same or different, is any amino acid. Polypeptides having this sequence are potent inhibitors of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets, and are therefore potent inhibitors of fibrinogen-induced human platelet aggregation. They are useful in inhibition of platelet aggregation formation.
摘要:
A platelet aggregation inhibiting polypeptide having the following amino acid sequence: X-Cys-R-R-R-Arg-Gly-Asp-R-R-R-R-R-Cys-Y wherein X is H or at least one amino acid; Y is OH or at least one amino acid; and each R, either the same or different, is any amino acid. Polypeptides having this sequence are potent inhibitors of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets, and are therefore potent inhibitors of fibrinogen-induced human platelet aggregation. They are useful in inhibition of platelet aggregation formation.
摘要:
Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.
摘要:
Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.