US10724086B2

A sensor apparatus includes a substrate, a semiconductor device disposed over the substrate, the semiconductor device having a surface electrode structure, and a saccharide coating formed over the surface electrode structure. The saccharide coating can be removed prior to use. The semiconductor device can further include a well and optionally a bead disposed in the well.
US10724077B2

The present invention relates to self-contained integrated systems and methods for constructing nucleic acid profiles of human individuals and for identification of the human individuals.
US10724076B2

Materials and methods for specifically isolating and identifying biomolecules that bind to selected targets.
US10724072B2

Use of phospho-Akt as a biomarker for predicting the response, such as resistance, to a compound, wherein phospho-Akt is Akt that has been phosphorylated on one or more residues, with the proviso that fir Akt1, Akt2, and Akt3 the designation phospho-Akt is used to indicate phosphorylation at a site other than T308, T309 or T305 respectively, wherein the compound is a compound of general formula (I) wherein R represents phenyl, thienyl or pyridinyl wherein phenyl is optionally substituted by one or two substituents independently selected from alkyl, halo-lower alkyl, hydroxy-lower alkyl, lower alkoxy-lower alkyl, acyloxy-lower alkyl, phenyl, hydroxy, lower alkoxy, hydroxy-lower alkoxy, lower alkoxy-lower alkoxy, phenyl-lower alkoxy, lower alkylcarbonyloxy, amino, monoalkylamino, dialkylamino, lower alkoxycarbonylamino, lower alkylcarbonylamino, substituted amino wherein the two substituents on nitrogen form together with the nitrogen heterocyclyl, lower alkylcarbonyl, carboxy, lower alkoxycarbonyl, cyano, halogen, and nitro; and wherein two adjacent substituents are methylenedioxy; and wherein pyridinyl is optionally substituted by lower alkoxy, amino or halogen; X represents a group C═Y, wherein Y stands for oxygen or nitrogen substituted by hydroxy or lower alkoxy; R1 represents hydrogen, lower alkylcarbonyl, hydroxy-lower alkyl or cyano-lower alkyl; R2, R3 and R6 represent hydrogen; R4 and R5, independently of each other, represent hydrogen, lower alkyl or lower alkoxy, or R4 and R5 together represent methylenedioxy, and pharmaceutically acceptable derivatives thereof; or wherein R represents phenyl or pyridinyl wherein phenyl is optionally substituted by one or two substituents independently selected from alkyl, halo-lower alkyl, hydroxy-lower alkyl, lower alkoxy-lower alkyl, acyloxy-lower alkyl, phenyl, hydroxy, lower alkoxy, hydroxy-lower alkoxy, lower alkoxy-lower alkoxy, phenyl-lower alkoxy, lower alkylcarbonyloxy, amino, monoalkylamino, dialkylamino, lower alkoxycarbonylamino, lower alkoxycarbonylamino, substituted amino wherein the two substituents on nitrogen form together with the nitrogen heterocyclyl, lower alkylcarbonyl, carboxy, lower alkoxycarbonyl, formyl, cyano, halogen, and nitro; and wherein two adjacent substituents are methylenedioxy; and wherein pyridinyl is optionally substituted by lower alkoxy, amino or halogen; X represents oxygen; R1 represents hydrogen, lower alkylcarbonyl, hydroxy-lower alkyl or cyano-lower alkyl; R2, R3 and R6 represent hydrogen; R4 and R5, independently of each other, represent hydrogen, lower alkyl or lower alkoxy, or R4 and R5 together represent methylenedioxy; and pharmaceutically acceptable derivatives thereof. Methods of treatment of neoplastic and autoimmune diseases with these compounds we also disclosed.
US10724071B2

The present invention addresses the problem of providing a novel method for classifying cancer cells by an analysis method in which measurement of the activity of two types of protein kinase is used. Cancer cells are newly classified and drug sensitivity is predicted on the basis of the ratio of the activity of two types of protein kinase derived from the same sample.
US10724069B2

The present disclosure relates to a cartridge, detection module, system, and kit for cell and particle detection and analysis. Devices disclosed herein may include at least an optical source, a fluidic chip, and a detection module, wherein the sample flows within the fluidic chip past a detection window, where the cells or particles are imaged by an image acquisition and analysis module that may include an optical detector. The image acquisition and analysis module may count the cells or particles of interest in real-time, or near real-time, or the module may capture images of the cells in order to analyze the sample from combined images at a later time.
US10724061B2

The present invention relates to a novel use of β-1,3-1,6-endoglucanase producing oligosaccharides or glucose from β-glucan. More specifically, the present invention provides an effect of producing oligosaccharides or glucose of various degrees of polymerization in high yields by using a β-1,3-1,6-endoglucanase exhibiting β-1,3-endoglucanase and ββ-1,6-endoglucanase activity on β-glucan and exhibiting transglycosylation activity on laminarioligosaccharide.
US10724056B2

A novel isolated Pichia stipitis strain is provided. The strain is capable of fermenting at least a pentose sugar in the presence of one or more inhibitory substances to produce ethanol. A method of utilizing the strain to produce ethanol is also provided.
US10724051B2

A gene of interest and the gene encoding hypoxanthine-aminopterin-thymidine (HPRT) can be co-targeted for Casp9 nuclease-mediated editing or alteration in a cell. Based on whether the HPRT gene is altered to encode a non-functional protein, or is not so-altered, the co-targeted cells can be selected and counter-selected. HPRT co-targeting can be used to sequentially disrupt as many genes of interest as cell viability permits.
US10724044B2

The present invention relates to plants of the Compositae family exhibiting a reversible genic male sterility trait, characterised in that the genic male sterility may be caused by a reduction or complete absence of endogenous jasmonic acid production, resulting from interference with one or more target genes involved in endogenous jasmonic acid production, selected from the group consisting of lipoxygenase, allene oxide synthase, allene oxide cyclase and 12-oxo-phytodienoic acid-10,11-reductase, or their functional homologues.
US10724035B2

Among other things, the present disclosure relates to chirally controlled oligonucleotides of select designs, chirally controlled oligonucleotide compositions, and methods of making and using the same. In some embodiments, a provided chirally controlled oligonucleotide composition provides different cleavage patterns of a nucleic acid polymer than a reference oligonucleotide composition. In some embodiments, a provided chirally controlled oligonucleotide composition provides single site cleavage within a complementary sequence of a nucleic acid polymer. In some embodiments, a chirally controlled oligonucleotide composition has any sequence of bases, and/or pattern or base modifications, sugar modifications, backbone modifications and/or stereochemistry, or combination of these elements, described herein.
US10724027B2

The present application discloses a method for inducing cells to gain characteristics of naïve stem cell state comprising culturing the cells in the presence of a MUC1* activator.
US10724018B2

The invention relates to a new method of characterising a target polynucleotide. The method uses a pore and a Dda helicase. The helicase controls the movement of the target polynucleotide through the pore. The invention also relates to modified Dda helicases which can be used to control the movement of polynucleotides and are particularly useful for sequencing polynucleotides.
US10724009B2

Nucleic acid molecules from cannabis have been isolated and characterized and encode polypeptides having cannabichromenic acid synthase activity. Expression or over-expression of the nucleic acids alters levels of cannabinoid compounds. The polypeptides may be used in vivo or in vitro to produce cannabinoid compounds.
US10724007B2

The invention is related to a dengue virus or chimeric dengue virus that contains a mutation in the 3′ untranslated region (3′-UTR) comprising a Δ30 mutation that removes the TL-2 homologous structure in each of the dengue virus serotypes 1, 2, 3, and 4, and nucleotides additional to the Δ30 mutation deleted from the 3′-UTR that removes sequence in the 5′ direction as far as the 5′ boundary of the TL-3 homologous structure in each of the dengue serotypes 1, 2, 3, and 4, or a replacement of the 3′-UTR of a dengue virus of a first serotype with the 3′-UTR of a dengue virus of a second serotype, optionally containing the Δ30 mutation and nucleotides additional to the Δ30 mutation deleted from the 3′-UTR; and immunogenic compositions, methods of inducing an immune response, and methods of producing a dengue virus or chimeric dengue virus.
US10724000B2

This application relates to a method for differentiating somatic cells into multi-competent neural crest cells based on linked steps of chemically defined medium inductions. Neural crest cells are able to differentiate into numerous cell types like Schwann cells, chondrocytes, smooth muscle cells or adipocytes.
US10723997B2

The present invention relates to a pharmaceutical composition for preventing or treating chronic pulmonary disease, a pharmaceutical formulation containing the same, and a method for preparing the same, the composition comprising as an active ingredient an exosome derived from thrombin-treated stem cells. The therapeutic agent is advantageous in that since the therapeutic agent is a cell-free preparation, the risk of carcinogenesis is low and there is no problem of transplant rejection reaction, and furthermore, there is no possibility of causing the occlusion of the microvascular system upon systemic administration, and since the therapeutic agent is a non-cell separating material, it is possible to develop a pharmaceutical agent as an off-the-shelf product, thereby reducing the manufacturing cost, and the therapeutic agent has an excellent therapeutic effect for chronic pulmonary disease with a low concentration of exosome by virtue of the thrombin treatment effect.
US10723989B2

The invention relates to a container device (1), comprising: a container receiving portion (4) for receiving a container; at least one valve (6) for controlling a flow of fluid in a fluid line connected to said container; a pump device (8) for generating a conveyor pressure of the fluid in the fluid line; a control device (10) which can be connected to the valve (6) and/or the pump device (8) in order to control the valve (6) and/or pump device (8); and a frame (2) which supports said container receiving portion (4), valve (6), pump device (8) and control device (10).
US10723988B2

Systems, methods and kits are described for culturing one or more biological cells in a microfluidic device, including provision of nutrients and gaseous components configured to enhance cell growth, viability, portability, or any combination thereof. In some embodiments, culturing a single cell may produce a clonal population in the microfluidic device.
US10723985B2

A photobioreactor is described for cultivating phototrophic organisms and in particular a mat, as can be used in one such photobioreactor. The mat has a plurality of first fibres which are light conductive along their longitudinal direction and are constructed to decouple light conducted in the longitudinal direction laterally, at least somewhat transversely to the longitudinal direction. The mat furthermore has a plurality of second fibres which are electrically conductive along their longitudinal direction. With the aid of one such mat, light can on the one hand be coupled in the interior of a photobioreactor. On the other hand, a travelling electric alternating field can be generated by applying a suitable polyphase voltage from a voltage source with the aid of electrically conductive second fibres. This alternating field can act on electrically charged particles.
US10723977B2

Surfactant compositions having a yield point, containing, based on the total weight thereof, (i) at least one surfactant, and (ii) at least one diarylamidocystine compound of the formula (I), wherein X+, independently of each other, stands for a hydrogen atom or an equivalent of a cation, R1, R2, R3, and R4, independently of each other, stand for a hydrogen atom, a halogen atom, a C1-C4 alkyl group, a C1-C4-Alkoxy group, a C2-C4 hydroxyalkyl group, a hydroxyl group, an amino group, an N—(C1-C4 alkyl)amino group, an N,N-Di(C1-C4 alkyl)amino group, an N—(C2-C4 hydroxyalkyl)amino group, an N,N-Di(C2-C4 hydroxyalkyl)amino group, or R1 with R2 or R3 with R4 forms a 5- or 6-segment annulated ring, which can each be substituted with at least one group from C1-C4 alkyl group, C1-C4 alkoxy group, C2-C4 hydroxyalkyl group, hydroxyl group, amino group, N—(C1-C4 alkyl)amino group, N,N-Di(C1-C4 alkyl)amino group, N—(C2-C4 hydroxyalkyl)amino group, N,N-Di(C2-C4 hydroxyalkyl)amino group, and (iii) water.
US10723976B2

A fabric softener composition comprising a quaternary ammonium ester fabric softener compound and an enzyme selected from specific nuclease enzymes, galactanase enzymes and mannanase enzymes. Also, methods of treating a fabric comprising a laundering step, optional rinsing steps and a rinse-treatment step in which the fabric is treated with an aqueous rinse liquor comprising the composition.
US10723975B2

The present invention relates to treatment compositions containing polymer systems that provide stability and benefit agent deposition as well as methods of making and using same. Such treatment compositions may be used for example as through the wash and/or through the rinse fabric enhancers as well as unit dose treatment compositions.
US10723970B2

Embodiments in accordance with the present invention relate generally to a variety of norbornene derivatives exhibiting olfactive properties and are suitable as fragrance ingredients. More specifically, this invention relates to various fragrance compositions containing one or more of a compound of formula (I): Wherein R1, R2, R3 and R4 are as defined herein. The compounds of formula (I) are useful as perfumes, colognes, and in perfume augmenting, modifying, enhancing, and imparting compositions. The compositions of this invention are therefore useful in a variety of products including perfumes, colognes, soaps, detergents, candles, air fresheners, trash bags, tissues, deodorants, lotions, skin care products, hair products, sanitary products, cleaning products, and the like.
US10723965B1

A system and process for producing biofuel from spent coffee grounds (SCGs) comprises the steps of performing a first operation comprising the steps of obtaining spent SCGs from a source, washing the SCGs, mixing the washed SCGs with an inorganic acid and heating and stirring the washed SCGs to form a SCG slurry without separating coffee oil, drying the SCG slurry, mixing the dried slurry with a solvent and heating the dried slurry and solvent mixture to create a reaction to produce biofuel and residual grounds, and separating the biofuel from the solvent and the residual grounds. The process further includes the step of using an activation agent and heating the residual grounds and the activation agent to create activated residual grounds. Biochar is also produced without activation and heating de-oiled SCGs at lower temperatures without oxygen.
US10723964B2

A combustible gas from carbon black production is utilized in a gas engine by adding an oxygen-containing gas to the combustible gas, passing said mixed gas over a selective catalyst, which is active for oxidizing H2S to SO2 but substantially inactive for oxidation of CO, H2 and other hydrocarbons with less than 4 C-atoms, passing the converted gas through an SO2 removal step, and passing the cleaned gas to a gas engine or to an energy recovery boiler. This way, the tail gas from carbon black production, which is normally combusted in a CO boiler or incinerated, can be utilized to good effect.
US10723961B2

A system for producing American Petroleum Institute Standards Group III Base Stock from vacuum gas oil, by injecting hydrogen, heating, partially saturating the vacuum gas oil through a plurality of hydrogen reactors connected in series with a liquid hourly space velocity (LHSV)−1 of from 0.5 to 2.5, forming a saturated heated base oil, and coproduct. The system fractionates the saturated heated base oil to while simultaneously refluxing a cooled fuel oil fraction forming an American Petroleum Institute Standards Group III Base Stock with less than 0.03% sulfur, with greater than 90% saturates and a viscosity index greater than 120 as defined by ASTM D-2270, a viscosity from 2 to 10 centistokes as defined by ASTM D-445 a boiling range from 600 degrees F. to 1050 degrees F., and a cold crank viscosity (CCS) between 1200 and 5000 centipoise at −25 degrees C. and as defined by ASTM D-5293.
US10723955B2

The invention is directed to a fuel composition for diesel engines. The fuel composition comprises 0.1-99% by weight of a component or a mixture of components produced from biological raw material originating from plants and/or animals and/or fish. The fuel composition comprises 0-20% of components containing oxygen. Both components are mixed with diesel components based on crude oil and/or fractions from Fischer-Tropsch process.
US10723954B2

The present invention relates to a process and an apparatus for recovering (recycling) carbon fibers from carbon fiber-containing plastics, in particular from carbon fiber-reinforced plastics (CFPs), preferably from carbon fiber-containing and/or carbon fiber-reinforced composites (composite materials), and also to the recycled carbon fibers obtainable by the process according to the invention and the use thereof.
US10723945B2

Disclosed are a method of producing an aluminate fluorescent material, such an aluminate fluorescent material, and a light emitting device. The aluminate fluorescent material production method includes: subjecting a first mixture prepared by mixing a compound containing at least one metal element selected from the group consisting of Ba, Sr and Ca, and at least one compound selected from the group consisting of a compound containing Mn and a compound containing Eu, and a compound containing Al, in which a compound containing Mg may be optionally mixed, to first heat treatment to give a first calcined product having an average particle diameter D1, as measured according to a Fisher Sub-Sieve Sizer method, of 6 μm or more; and subjecting a second mixture prepared by mixing a compound containing at least one metal element selected from the group consisting of Ba, Sr and Ca, at least one compound selected from the group consisting of a compound containing Mn and a compound containing Eu, and a compound containing Al, and the first calcined product whose content is 10% by mass or more and 90% by mass or less relative to the total amount of the second mixture, in which a compound containing Mg may be optionally mixed, to second heat treatment to give a second calcined product.
US10723938B2

An improvement over known hydraulic fracturing fluids. Boundary layer kinetic mixing material is added to components of fracturing fluid wherein kinetic mixing material is a plurality of particles wherein at least 25% of particles are several types, i.e., having surface characteristics of thin walls, three dimensional wedge-like sharp blades, points, jagged bladelike surfaces, thin blade surfaces, three-dimensional blade shapes that may have shapes similar to a “Y”, “V” or “X” shape or other geometric shape, slightly curved thin walls having a shape similar to an egg shell shape, crushed hollow spheres, sharp bladelike features, 90° corners that are well defined, conglomerated protruding arms in various shapes, such as cylinders, rectangles, Y-shaped particles, X-shaped particles, octagons, pentagon, triangles, and diamonds. The resulting fluid exhibits improved dispersion of additives as well providing stabilization to a hydraulic fracture by reducing incidents of proppant grain column collapse and by reducing proppant flow back.
US10723935B2

Methods including precipitated and mined calcium carbonate lost circulation materials for use in subterranean formation operations. The precipitated calcium carbonate lost circulation materials are formed under a chosen set of precipitation conditions, including in situ in a subterranean formation. The mined calcium carbonate lost circulation materials are obtained in a desired morphological form under naturally occurring mined conditions. The precipitated and mined calcium carbonate lost circulation materials may be needle-shaped aragonite having an aspect ratio of about 1.4 to about 15.
US10723934B2

A method for suspending lightweight beads in a fluid includes combining lightweight beads, a fluid, and a surfactant to form a liquid additive. The liquid additive may be used to reduce the density of a wellbore fluid. The liquid additive or wellbore fluid can be combined with a cementitious material to form a lightweight cement composition.
US10723931B2

A thinner that is a polycondensed fatty acid that is selected from the group consisting of 12-hydroxystearic acid, 12-hydroxyoctadecanoic acid, polyhydroxystearic acid, reaction products with stearic acid, octadecanoate, octadecanoic acid, and homopolymers of stearic acid is able to reduce the viscosity of oil-based drilling fluid, thus allowing for reuse of the oil-based drilling fluid.
US10723930B2

Viscoelastic fluid compositions are provided that have improved properties for suspending particulate active ingredients. Methods for forming the compositions are also provided. The compositions preferably have a non-Newtonian behavior, so that the viscosity of the composition at low shear rates is suitable for keeping solid particles in the form of a stable suspension while also providing a reduced viscosity at higher shear rates (such as a substantially reduced or minimized viscosity) to allow for pumping, tank mixing, and/or distribution of the composition, for instance by spraying.
US10723929B2

A thinner that is a poly fatty amide reacted with maleic acid to form a product, and diluting the product with a compound selected from the group consisting of oleyl alcohol, fatty acid, and poly condensed fatty acid is able to reduce the viscosity of oil-based drilling fluid, thus allowing for reuse of the oil-based drilling fluid.
US10723928B1

A heat transfer mixture is represented by the formula: 1=Vpg/Vnf+Vw/Vnf+Vpw/Vnf+Vsf/Vnf+Vbs/Vnf+Vac/Vnf+Vci/Vnf. Vnf is a volume of a nanofluid. Vpg is a volume of propylene glycol. Vw is a volume of water. Vpw is a volume of a nanopowder. Vsf is a volume of a surfactant. Vbs is a volume of a base additive. Vac is a volume of an acid additive. Vci is a volume of a corrosive inhibitor.
US10723923B2

Provided are an adhesive resin laminate having an excellent adhesive force to two adherends, a laminate in which this adhesive resin laminate is laminated with two adherends, and a method of producing them. An adhesive resin laminate having at least a first adhesive layer and a second adhesive layer, in which the first adhesive layer includes a base resin and a crosslinking agent, the base resin is a modified polyolefin resin, the crosslinking agent is an epoxy-based compound, the second adhesive layer includes a polyolefin-based resin, and the first adhesive layer has a viscoelastic modulus measurement value E (150) at 150° C. of 1.0×104 Pa or more and 1.0×108 Pa or less.
US10723921B2

Coumarin modification of epoxies provide for epoxy adhesives that fluoresce under short wave ultraviolet irradiation while remaining invisible under normal light. Furthermore, these modified epoxy adhesives can have increased adhesive bond strengths. In addition, photochemical curing of an epoxy modified coumarin and a hardening agent with UV irradiation at certain wavelengths affords an epoxy adhesive composition. Further UV irradiation of the composition at certain wavelengths causes photoscission, which breaks the crosslinks that make the cured epoxy adhesive insoluble and intractable.
US10723918B2

Articles and laminates include a substrate with a first polyester surface and a second polyester surface, a crosslinked polyurethane-based primer coated on at least the first polyester surface, and an optically clear heat activated adhesive adjacent to the crosslinked polyurethane-based primer. The articles and laminates are prepared by applying a polyurethane-based dispersion and a crosslinker on at least one polyester surface, drying the applied coating, heating while stretching the substrate and the coating to form a crosslinked primer layer on the stretched polyester surface, and applying an optically clear heat activated adhesive onto the crosslinked primer layer.
US10723917B2

A die coater 10 as a coating member directly applies an adhesive resin G to a joining portion of a workpiece W by a predetermined width while a holding table 1 holding the workpiece W placed thereon moves. A reinforcing substrate T supplied from an original master roll is joined to the resin G applied to the workpiece W while being pressed by a joining roller 15, and the reinforcing substrate T is cut by a predetermined length. That is, an adhesive sheet is directly formed on the workpiece W.
US10723904B2

A decorative material having first and second gloss-adjusting layers, one with lower gloss contains a matting agent having an average particle diameter of 6.0 μm or more and 15.0 μm or less. That is, the average particle diameter of the matting agent in the gloss-adjusting layer with lower gloss, i.e., the gloss-adjusting layer whose scratch resistance is likely to be low, is set within an optimal range in which the gloss-adjusting layer has improved or even excellent scratch resistance and designability.
US10723902B2

A method of forming transparent electrodes using printable conductive ink containing conductive materials dispersed in a viscous liquid which upon printing and thermal treatment will vaporise fully leaving behind the conductive material only. The viscous liquid acts as a medium by which conductive material dispersions are made processable for use in various printing techniques, allowing conductive patterns to be printed onto substrates (e.g. plastics, glass, metals, ceramics).
US10723898B2

In accordance with some embodiments of the present invention, an active energy ray curable composition including a polymerizable compound composition is provided. When the active energy ray curable composition is formed into a film having an average thickness of 10 μm on a substrate and, after a lapse of 15 seconds, the film is irradiated with an active energy ray having a light quantity of 1,500 mJ/cm2 to become a cured product, the cured product satisfies the following conditions (1) and (2): (1) when the substrate is a polypropylene substrate, the cured product has a glass transition temperature of 60° C. or more; and (2) when the substrate is a polycarbonate substrate, an adhesion between the polycarbonate substrate and the cured product is 70 or more, the adhesion being measured according to a cross-cut adhesion test defined in Japanese Industrial Standards K5400.
US10723897B2

The present disclosure relates to an inkjet composition comprising a curable polyurethane dispersion and an aqueous carrier. The curable polyurethane dispersion comprises at least one of a) a polyurethane polymer comprising a first terminal group selected from a styrene-containing group, an allyl-containing group and an acrylamide-containing group, and a polyurethane polymer comprising a second terminal group comprising an ionic group; and/or a polyurethane polymer comprising a first terminal group at one end and a second terminal group at the opposite end, wherein the first terminal group is selected from a styrene-containing group, an allyl-containing group and an acrylamide-containing group, and the second terminal group comprises an ionic group; b) a polyurethane polymer comprising a terminal group selected from at least one of stabilising groups (A) and (B); and c) a polyurethane polymer comprising a polyurethane chain formed by the polymerisation of (i) a blend of at least two different diisocyanates and (ii) a reactive diol.
US10723894B2

Waterborne suspensions include surface treated silica particles, a water dispersable binder resin, at least one surfactant, and an aqueous solvent. The surface treated silica particles have a mixture of hydrophobic and hydrophilic silane surface treatment agents, where the ratio of hydrophilic silane surface treatment agent to hydrophobic silane surface treatment agent is greater than 1. The waterborne suspensions can be coated and dried to form nanostructured tie layers, especially tie layers to silicone or (meth)acrylate layers.
US10723893B2

A composite structure is provided, which includes a support, an active layer wrapping the support, a dendrimer grafted to the active layer through covalent bondings, and a plurality of anti-fouling groups, wherein each of the anti-fouling groups is grafted to terminals of the dendrimer through covalent bondings. The terminals of the dendrimer include amino group, hydroxyl group, or thiol group.
US10723889B2

The present invention provides substantially isocyanate-free multicomponent compositions useful in making rapid dry automotive primer compositions and coatings, the compositions having a % PVC of from 20 to 60, or preferably, from 25 to 50, and comprising one or more pigment, extender or filler, one or more a) polycarbamates from alkyd polyol or acrylic polyol and one or more b) a polyaldehydes or the acetal or hemiacetal thereof as a second component. The multicomponent compositions cure quickly at a temperature of from 0° C. to less than 80° C. to form a crosslinked polyurethane which dries to enable sanding after only 15 to 45 minutes.
US10723879B2

The invention relates to a thermoplastic composition having improved fluidity in the molten state, comprising at least: (a) a polyamide that has a melt viscosity greater than or equal to 50 Pa·s, and (b) a non-evolutive polyamide having a melt viscosity lower than the melt viscosity of said polyamide (a), above 0.8 Pa·s, and having a number-average molecular weight Mn lower than that of said polyamide (a), said composition having a melt viscosity that is stabilized at a value below the melt viscosity of said polyamide (a), said polyamide (b) having: a concentration of amine end groups (AEG) and/or of carboxyl end groups (CEG) less than or equal to 20 meq/kg, or a concentration of amine end groups (AEG) greater than or equal to 25 meq/kg; a concentration of acid end groups (CEG) greater than or equal to 25 meq/kg; and a concentration of blocked end groups (BEG) greater than or equal to 25 meq/kg.
US10723875B2

The present disclosure relates to a halogen-free epoxy resin composition and a prepreg and a laminate using the same. The halogen-free epoxy resin composition comprises: (A) a halogen-free epoxy resin; (B) an active ester resin; and (C) a reactive phosphorous-containing flame retardant. The prepreg and laminate made from the halogen-free epoxy resin composition have the advantages of high inter-laminar adhesive force, low coefficient of thermal expansion and high heat-humidity resistance, and can achieve the halogen-free flame retardant purpose.
US10723870B2

A process for producing a heterophasic copolymer composition comprising polymerising in multiple steps and multiple polymerisation reactors propylene monomer and a comonomer selected from ethylene, alpha-olefins having 4 to 10 carbon atoms and their mixtures, in the presence of an olefin polymerisation catalyst comprising a solid catalyst component and a co-catalyst, wherein the solid catalyst component comprises titanium, magnesium, halogen and an internal donor of the formula (I): wherein R1 and R2 are the same or different being a linear or branched C1-C12-alkyl group and R is hydrogen or a linear, branched or cyclic C1 to C12-alkyl.
US10723869B2

A polypropylene composition, a preparation method thereof, and a film or a sheet prepared from the polypropylene composition and use thereof. The composition includes 45 parts to 75 parts of a polypropylene, 10 parts to 35 parts of an elastomer, 5 parts to 20 parts of a polyethylene, 0.1 parts to 0.5 parts of an antioxidant, and 0.1 parts to 0.5 parts of a lubricant. A half peak width of a crystallization peak of the polypropylene is 5° C. to 10° C., and a peak temperature of the crystallization peak of the polypropylene is 105° C. to 115° C. The polypropylene composition has a good tenacity, especially a−30° C. low-temperature impact performance. The film or the sheet prepared from the composition and applied to automotive interior parts, can enable the external accessories not only to be less likely to generate sharp fragments while being strongly impacted, but also to have a matte characteristic.
US10723868B2

A polymer composition includes a non-fluorinated, thermoplastic polymer and a minor amount of a fluoropolymer combined with the non-fluorinated polymer. A polymer processing additive composition that includes a fluoropolymer and a polymer processing additive synergist is also disclosed. The fluoropolymer includes diads represented by formula —CF2-CF(R)—CH(R′)—CF(R″)— in a range from about 23 mole percent to about 50 mole percent. Each R is independently —CF3, —Rf, or —ORf, each R′ and R″ are independently H, F, CF3, or —Rf, and each Rf is independently a perfluoroalkyl group having from 1 to 12 carbon atoms and optionally interrupted by one or more —O— groups. A method of reducing melt defects during the extrusion of a polymer is also disclosed.
US10723860B2

The present invention relates to an attrition-resistant superabsorbent polymer comprising a superabsorbent polymer; water; and at least three selected from the group consisting of particles having i) a BET specific surface area of 300 to 1500 m2/g and ii) a porosity of 50% or more, a multivalent metal salt, an organic acid and a polyhydric alcohol, and a preparation method thereof.
US10723859B2

This invention relates to a method for extracting valorized compounds from lignin by contacting lignins with an ionic liquid and/or a deep eutectic solvent and adding a catalyst and/or a biocatalyst to assist in breaking down the source material. Converting lignin into high value chemicals adds revenues for a bio-refinery and helps to improve the economic viability of biofuel production.
US10723856B2

A trifluoroacetic acid-based etchant is described that can remove a sacrificial component of a multi-component polymer, e.g., a self-assembled block copolymer. The etchant can operate at a high etch rate and with excellent selectivity. The etchant can remove a hydrolysable sacrificial component such as a polylactide block from a self-assembled block copolymer. The etchant enables the macroscopic preservation of the nanostructure morphologies of self-assembled copolymers (e.g., poly(styrene-block-lactide) copolymers) and can yield pristine porous films of the non-hydrolysable component of the starting multi-component polymer.
US10723855B2

The invention relates to a method for the production of a rigid PIR foam composite containing man-made vitreous fibres (MMVF), the method comprising: providing MMVF, wherein at least 50% of the fibres by weight have a length of less than 250 μm; providing a polyol component; mixing the MMVF and polyol component in a ratio such that the amount of MMVF is at least 10% by weight based on total weight of polyol component; emulsifying pentane with the mixture of polyol component and MMVF; inducing foam formation by addition of a further component which comprises isocyanate.
US10723849B2

A method for welding aramid fibers, wherein a) at least one area of an aramid fiber is treated with an ionic liquid so that the aramid is partially dissolved, b) the aramid fiber is contacted via the dissolved area with another aramid fiber area with pressure being applied to the contact area, and subsequently c) the partially dissolved area of the aramid is re-coagulated.
US10723843B2

A platinum organosiloxane complex is prepared by a process including combining A) a platinous halide; B) a ketone; C) an enone additive distinct from any other starting materials or rearrangement products thereof; and D) a polyorganosiloxane having, per molecule, 2 to 4 silicon bonded terminally unsaturated hydrocarbon groups having from 2 to 6 carbon. The platinum organosiloxane complex prepared by the process is useful as a hydrosilylation catalyst.
US10723835B2

Multi-layer electrochromic structures, and processes for assembling such structures, incorporating a cross-linked ion conducting polymer layer that maintains high adhesive and cohesive strength in combination with high ionic conductivity for an extended period of time, the ion conducting polymer layer characterized by electrochemical stability at voltages between about 1.3 V and about 4.4 V relative to lithium, lithium ion conductivity of at least about 10−5 s/cm, and lap shear strength of at least 100 kPa, as measured at 1.27 mm/min in accordance with ASTM International standard D1002 or D3163.
US10723818B2

The present invention relates to a novel ligand compound represented by Formula 1 and a novel transition metal compound represented by Formula 2, and the novel ligand compound and transition metal compound according to the present invention has high comonomer incorporation effect in the preparation of an olefinic polymer having a low density and a high molecular weight, and thus can be usefully used as a catalyst for a polymerization reaction.
US10723817B2

An oxolanyl compound-containing composition comprising specified amounts of the meso-isomer of one or more of the oxolanyl compounds of specified structure is provided. Also provided are methods for the use of such compositions as vinyl content modifiers in polymerization processes.
US10723815B2

Methods for preparing silicone-containing polymers by essentially adiabatic polymerization methods are disclosed. The polymerization system includes free radically polymerizable monomers. The monomers include ethylenically unsaturated silicone-containing monomers and/or mercapto-functional silicones as well as additional free radically polymerizable monomers. The silicone-containing polymers are useful as adhesives or release materials.
US10723810B2

This invention relates to a new process for obtaining inulin from roots of cardoon plants, that is those belonging to the Cardueae tribe.
US10723807B2

Provided is a method for producing a hydroxyalkyl alkyl cellulose having high thermal gel strength while suppressing a reduction in thermal gelation temperature. More specifically, provided is a method for producing a hydroxyalkyl alkyl cellulose including steps of: mixing cellulose pulp with a first alkali metal hydroxide solution to obtain alkali cellulose, reacting the alkali cellulose with an alkylating agent and a hydroxyalkylating agent to obtain a first reaction product mixture, adding a second alkali metal hydroxide solution to the first reaction product mixture without further adding any of alkylating and hydroxyalkylating agents to obtain a second reaction product mixture, and subjecting the second reaction product mixture to purification to obtain a hydroxyalkyl alkyl cellulose.
US10723796B2

The present invention pertains to antigen recognizing constructs against tumor associated antigens (TAA), in particular the TAA Serine protease inhibitor Kazal-type 2 (SPINK2). The invention in particular provides novel T cell receptor (TCR) based molecules which are selective and specific for the tumor expressed antigen of the invention. The TCR of the invention, and SPINK2 binding fragments derived therefrom, are of use for the diagnosis, treatment and prevention of SPINK2 expressing cancerous diseases. Further provided are nucleic acids encoding the antigen recognizing constructs of the invention, vectors comprising these nucleic acids, recombinant cells expressing the antigen recognizing constructs and pharmaceutical compositions comprising the compounds of the invention.
US10723794B2

Anti-CCL8 antibodies and antigen binding fragments thereof are described. Antibodies and fragments thereof can be used for prevention of migration of breast cancer cells. Methods include delivery of an anti-CCL8 antibody or an antigen binding fragment thereof to an area including the breast cancer cells, e.g., delivery to a subject in need thereof in an effective amount.
US10723780B2

Disclosed are Somatostatin receptor ligands comprising a peptide moiety, pharmaceutical compositions and uses thereof. Disclosed are also synthetic Somatostatin receptor ligands comprising a cyclic peptide moiety and an active agent moiety covalently bonded to the cyclic peptide moiety through a nitrogen atom of a side chain functional group of an internal residue of the cyclic peptide moiety, pharmaceutical compositions and uses thereof. Disclosed are also synthetic Somatostatin receptor ligands comprising a cyclic peptide moiety and a nanoparticle active agent moiety covalently bonded to the cyclic peptide moiety, pharmaceutical compositions and uses thereof.
US10723778B2

Variant peptides of calcitonin gene-related peptide alpha (αCGRP), calcitonin gene-related peptide beta (βCGRP), and adrenomedullin (AM) are disclosed, wherein the variant peptides have high binding affinity and agonistic or antagonistic activity for at least one receptor complex of CLR:RAMP1, CLR:RAMP2, and CLR:RAMP3. Also disclosed are methods of use of the variant peptides in therapeutic treatments.
US10723768B2

Disclosed are tyrosine-modified rAAV vectors, as well as infectious virions, compositions, and pharmaceutical formulations that comprise them. Also disclosed are methods of preparing and methods for using the disclosed tyrosine-phosphorylated capsid protein mutant rAAV vectors in a variety of diagnostic and therapeutic applications including in vivo and ex vivo gene therapy, and large-scale production of rAAV vectors.
US10723764B2

Anti-microbial peptides and methods of use are provided.
US10723763B2

The present application provides compositions and methods for treating acute lung injury and acute respiratory distress syndrome. The methods include administering one or more tight junction antagonists to the lung of a subject in need thereof.
US10723751B2

Provided are cyanogenic compositions for treating diseases, such as infectious diseases.
US10723749B2

Metal complexes containing substituted allyl ligands and methods of using such metal complexes to prepare metal-containing films are provided.
US10723723B2

Disclosed are compounds of Formula (I) or a salt thereof, wherein R1 is (II) or (III); each W is independently NR1b or O; Z is a bond or CHR1d; and R1, R2, Rd, R3, L1, L2, R1a, R1b, R1c, and n are define herein. Also disclosed are methods of using such compounds as inhibitors of ROMK, and pharmaceutical compositions comprising such compounds. These compounds are useful in treating cardiovascular diseases.
US10723721B2

The invention relates to a process for the preparation of lifitegrast (I) comprising a) reacting benzofuran-6-carboxylic acid (II) with a non-chlorinated carboxyl activating agent; and b) reacting the activated compound obtained in step a) with compound (III) or a salt thereof to give lifitegrast. It also relates to a process for the purification of lifitegrast (I) by i) reacting lifitegrast with dicyclohexylamine to give the dicyclohexylamine salt of lifitegrast (Ia); ii) isolating the salt from the reaction medium; iii) converting the isolated salt into lifitegrast by treatment with an acid; and iv) isolating lifitegrast from the reaction medium. It also relates to the dicyclohexylamine salt of lifitegrast (Ia) and to a process for its preparation. (Formula I, III)
US10723720B2

The present invention provides a compound of formula (I) or a pharmaceutically acceptable salt thereof, pharmaceutical compositions comprising a compound of the invention, a method for manufacturing compounds of the invention and therapeutic uses thereof.
US10723713B2

The present invention relates to novel compounds, particularly to hydrophilic compounds, comprising a photoactive unit, said novel compounds being particularly suitable for ophthalmic devices. The present application also relates to ophthalmic devices comprising such compounds.
US10723707B2

This invention relates to heterocyclic substituted 2-amino-quinazoline derivatives, processes for their preparation, pharmaceutical compositions, and their use in treating viral infections.
US10723703B2

The present invention relates to a novel serotonin reuptake inhibitor which also exhibits 5-HT2C antagonistic action (antidepressive and anxiolytic effects), in particular, 5-HT2C inverse agonistic action comprising Compound (1): or a pharmaceutically acceptable salt thereof wherein R1, R2, R3 and R4 are independently hydrogen or C1-6 alkyl etc.; R5 is C4-7 alkyl or —(CR8R9)r-E; R6, R7, R8 and R9 are independently hydrogen, fluorine or C1-6 alkyl; A is C6-10 aryl or heteroaryl etc.; r is 1, 2, 3 or 4; E is C3-8 cycloalkyl or C6-10 aryl etc.; L is oxygen, sulfur or —NR10—; n is 1, 2 or 3; R10 is hydrogen or C1-6 alkyl etc.; and X is hydrogen or halogen etc.
US10723700B2

The present disclosure relates to tosylate salts 1-{[4-(methoxymethyl)-4-({[(1R,2S)-2-phenylcyclopropyl]amino}methyl)piperidin-1-yl]methyl}cyclobutanecarboxylic acid, methods of preparation thereof, and intermediates in the preparation thereof, which are useful in the treatment of the LSD1-associated or mediated diseases such as cancer.
US10723699B2

The present invention relates to a cyclohexene derivative, a preparation method thereof, and a pharmaceutical composition for preventing or treating metabolic disease containing the cyclohexene derivative as an active ingredient. The cyclohexene derivative according to the present invention increases the intracellular activity of cyclic adenosine monophosphate (cAMP) by activating G protein-coupled receptor 119 (GPR-119) and simultaneously exhibits weight loss and hypoglycemic effects by inducing the release of glucagon-like peptide-1 (GLP-1), which is a neuroendocrine protein, and thus can be useful as a pharmaceutical composition for preventing or treating metabolic diseases such as obesity, type 1 diabetes, type 2 diabetes, inadequate glucose tolerance, insulin resistance, hyperglycemia, hyperlipidemia, hypertriglyceridemia, hypercholesterolemia, dyslipidemia and syndrome X.
US10723697B2

Provided is a preparation of a thioether-based polythiol in a high purity using a metal monosulfide for the incorporation of a thioether group, wherein the content of such components as a metal polysulfide present in the metal monosulfide is controlled to a predetermined level or lower. As a result, an optical lens of high quality with a high refractive index can be produced using the polythiol.
US10723694B2

Propargyl-functionalized macrocyclic compounds can include non-aggregating compounds having at least one phthalocyanine (Pc), azaphthalocyanine (AzaPc), or naphthalocyanine (Nc) unit. The compounds can be metal-free or metal-complexed. The metal-complexed compounds can include zinc (II), for example. The compounds can include multiple propargyl moieties at different sites, e.g., peripheral or non-peripheral sites, as described herein. Exemplary compounds include an azaphthalocyanine complex (AzaPc1) and phthalocyanine complexes (Pc2-Pc5). The compounds may provide efficient solubility in aqueous and/or organic solvents, optimal physicochemical properties, improved photo-sensitizability, significant tumor specificity, and electron transfer tunability. The compounds can provide suitable non-aggregated molecular scaffolds for construction of numerous macrocycle derivatives via different organic transformation methodologies, e.g., Cu(I)-catalyzed azide-alkyne cycloaddition (CuAAC).
US10723686B2

An object of the present invention is to provide a powder of high-purity 1,4-cyclohexanedicarboxylic acid with excellent powder flowability. The invention provides a powder of high-purity 1,4-cyclohexanedicarboxylic acid having particle size distributions (volume basis) such that D10 is within a range of 5 to 55 μm, D50 is within a range of 40 to 200 μm, and D90 is within a range of 170 to 800 μm; and having an aerated bulk density of 0.4 to 0.8 g/cm3, a packed bulk density of 0.5 to 1.0 g/cm3, and a compressibility of 10 to 23%.
US10723675B2

Processes and apparatus for making xylenes and phenol are described. Phenol and alkyl phenols are separated from coal derived liquid. The phenol is separated from the alkyl phenols. The alkyl phenols can be reacted with aromatics such as benzene and toluene to make xylenes. The xylenes and other aromatics are then separated from the phenol and alkyl phenols. Para-xylene is separated and recovered using a xylene separation process, and meta-xylene and ortho-xylene are optionally converted to para-xylene through an isomerization reaction.
US10723671B2

A new, rapid and inexpensive synthesis method for monodispersed triaminotrinitrobenzene (TATB) microparticles based on micelle-confined precipitation that enables control of microscopic morphology. The morphology of the TATB microparticles can be tuned between quasi-spherical and faceted by controlling the speed of recrystallization. The method enables improved performance and production consistency of TATB explosives for military grade explosives and propellants
US10723668B2

A special film-coated controlled release calcium fertilizer for peanut includes a three-layer structure. Raw materials in an inner layer include calcium nitrate, humic acid, seaweed extract and adhesive. Raw materials in an intermediate layer include calcium nitrate, urea formaldehyde powder and chitosan oligosaccharide. Raw materials in an outer layer include urea formaldehyde powder and fermented livestock and poultry manure. The special controlled release calcium fertilizer for peanut releases Ca since the pod-bearing stage after the basal application. The coating film is a biodegradable film, releases calcium since about 50 days after application into soil.
US10723667B1

Disclosed is a process for making a water-soluble granule enriched in humic acid. Disclosed also is a water-soluble granule enriched in humic acid. Such a granule is useful as an organic aid to crop growth, particularly in applications where solubility is desirable or necessary.
US10723666B2

A method for operating a composter device including directing exhaust from a composting container to a reservoir by way of a first fluid pathway, directing ambient air to the reservoir by way of a second fluid pathway, and mixing the exhaust from the first fluid pathway and the ambient air from the second fluid pathway.
US10723664B1

A stable metal phosphite composition made from water, phosphorous acid (H3PO3), a metal salt and a sufficient a quantity of liquid ammonium hydroxide (NH4OH) where the molar ratio of ammonium ions to metal ions is 1-4 moles ammonium to 1 mole metal. The composition can be diluted for use-application providing beneficial nutrients for plant uptake.
US10723662B2

The invention relates to the field of controlled release fertilizer technology, and in particular to a special film-coated controlled release fertilizer for peanut in saline-alkali soil, which comprises an outer layer, an intermediate layer and an inner layer, integrates the ingredients for salt resistance improvement, etiolated seedling prevention, disease and pest control, growth promotion and pod plumpness promotion, controls the release period, improves the fertilization efficiency without the need of top application throughout the growth period, and saves labor cost.
US10723660B2

Methods for forming a ceramic matrix composite from a melt infiltrated and melt extracted preform that has residual silicon within open pore channels therein are provided. The method may include: introducing a carbon yielding resin into the open pore channels; heating the preform to produce elemental carbon from the carbon yielding resin within the open pore channels; and further heating the elemental carbon to react with the residual silicon to form SiC within the open pore channels to form the ceramic matrix composite.
US10723658B2

A method of fabricating a ceramic material, the method including forming a ceramic material by performing a first chemical reaction at least between a first powder of an intermetallic compound and a reactive gas phase, a liquid phase being present around the grains of the first powder during the first chemical reaction, the liquid gas phase being obtained from a second powder of a metallic compound by melting the second powder or as a result of a second chemical reaction between at least one element of the first powder and at least one metallic element of the second powder, a working temperature being imposed during the formation of the ceramic material, which temperature is low enough to avoid melting the first powder.
US10723654B2

A method of providing highly reactive hydrated lime and the resultant lime hydrate where an initial lime feed comprising calcium and impurities is first ground to a particle-size distribution with relatively course particles. Smaller particles are then removed from this ground lime and the smaller particles are hydrated and flash dried to form a hydrated lime, which is then milled to a significantly smaller particle size than that of the relatively course particles.
US10723650B2

An optical fiber preform includes a silica-glass core portion, and a cladding portion surrounding the core portion, the cladding portion being composed of a fluorine-containing silica glass having a lower refractive index than the core portion, the core portion including a first region that does not include the central axis thereof, the first region containing a first dopant selected from sodium, potassium, and compounds thereof, and a second region that includes the central axis, the second region containing a second dopant that reduces the viscosity of the silica glass, the second dopant having a diffusion coefficient of 1×10−12 cm2/s or more and less than the first dopant at 2,000° C. to 2,300° C., in which the entire core portion has an average first dopant concentration of 10 atomic ppm or more and 2,000 atomic ppm or less and an average second dopant concentration of 10 atomic ppm or more.
US10723649B2

A black lithium silicate glass ceramic is provided. The glass ceramic includes lithium silicate as a primary crystal phase and at least one of petalite, β-quartz, β-spodumene, cristobalite, and lithium phosphate as a secondary crystal phase. The glass ceramic is characterized by the color coordinates: L*: 20.0 to 40.0, a*: −1.0 to 1.0, and b*: −5.0 to 2.0. The glass ceramic may be ion exchanged. Methods for producing the glass ceramic are also provided.
US10723636B2

A purification device for water has a housing with a longitudinal axis, an upper and a lower end and a substantially round cross section. The device includes a first receptacle, arranged parallel to the longitudinal axis of the housing, for a first purification medium, and a second receptacle, which is also arranged parallel to the longitudinal axis of the housing, for a second purification medium. The receptacle for the second purification medium is arranged eccentrically with respect to the longitudinal axis of the housing.
US10723634B1

The present disclosure provides a system for extracting potable water from saline water. The system includes a pre-treatment unit configured to receive the saline water from a reservoir, and configured to heat the saline water to a predetermined temperature. An evaporator is coupled to the pre-treatment unit for receiving the heated saline water, and includes a housing for receiving the heated saline water, a porous material disposed in the housing and an evaporator gas port. The evaporator gas port routes gas into the housing via the porous material, and disperses to form gas bubbles. The gas bubbles induce turbulent motion within the housing for converting the heated saline water into the mixture of the water vapors and the concentrated saline water. Further, a condenser is coupled to the housing for receiving the mixture of the gas and the water vapors, and configured to condense water vapors to form potable water.
US10723627B2

The disclosure provides a system and method for production of activated carbon from a coal-originating particulate feed material. Feed material and activating gas are introduced into a reaction chamber, the activating gas being introduced at a velocity above the average terminal velocity of particles within the feed material. Feed material is then entrained in the activating gas such that a recirculating flow path for the feed material is established within the reaction chamber. Activated material may then be recovered from the chamber.
US10723615B2

A sensor assembly for being mounted on a circuit board comprises an interposer with at least one opening extending between a first and a second main surface of the interposer. The interposer comprises at least two stress decoupling elements, each comprising a flexible structure formed by a respective portion of the interposer being partially enclosed by one of the at least one opening. A sensor die is connected to the flexible structures on the first main surface. At least two board connection elements are arranged on the first main surface and adapted for connecting the assembly to the circuit board.
US10723612B2

A method for transferring volatile liquid from a refueling tank to the fuel tank of an internal combustion device including the steps of providing a volatile liquid refueling apparatus, having a probe including an outer collar and a receiver including a receiving collar, where the outer collar and the receiving collar are configured to join to create a vapor-tight enclosure, installing the receiver in the fuel tank of an internal combustion device, installing the probe in the refueling tank, inserting the probe into the receiver, engaging the receiving collar and the probe outer collar to create a vapor-tight enclosure, transferring volatile liquid from the refueling tank to the fuel tank, and disengaging the probe from the receiver, including sealing the refueling tank and the tank.
US10723610B2

Examples disclosed herein relate to conduits, devices, systems and methods, which may include a hollow element including an inner surface and an outer surface which allows for a passage of one or more of one or more fluid elements and one or more gaseous elements, a constraining element with one or more openings and one or more non-open elements, one or more blocking elements configured to stop the passage of the at least one of the one or more fluid elements and the one or more gaseous elements when the one or more blocking elements are in a first position relative to the one or more openings, and a movement device configured to move the one or more blocking elements to a second position relative to the one or more openings which allows for the passage of the one or more fluid elements and the one gaseous elements through the one or more openings in the constraining element.
US10723608B2

Systems, methods, and apparatus for pull-tab seal removal are provided. An extraction tool for removal of integrated pull-tab seals from containers may comprise a cover slidably coupled to a body portion in which an extraction shaft and/or a seal gap separator operate to remove the seal while requiring less dexterity and/or less applied force than would otherwise be required.
US10723607B2

An electric personnel lift device that includes a base assembly having two columns that are laterally spaced apart. Each of the two columns has a lift cylinder device mounted in the respective column and extending upward. The electric personnel lift device further includes a height adjustable platform assembly having an operator platform and two laterally spaced apart handrail assemblies connected to the operator platform. The height adjustable platform assembly is connected to an upper end of a movable portion of each lift cylinder device and is slidably coupled to the columns, wherein the height adjustable platform assembly is movable between at least a lowered position and a raised position.
US10723603B1

A jack has a lifting post, a pair of side legs, adjustable leg extensions, and leg locking mechanisms for locking the leg extensions with respect to the side legs. The lifting post has a bottom element and a top element that slide with respect to each other, and a vehicle engaging hook mounted on the top element. A lifting mechanism lifts the top element with respect to the bottom element, once the side legs have been adjusted.
US10723595B2

A method and assembly for operating at least two lifting gears in a group operation, where each lifting gear has a hoist via which a respective cable or chain can be raised or lowered. The hoists are first operated in a synchronous operating mode to perform a common lifting procedure to move a load supported by the hoists. At least one of the hoists involved in the common lifting procedure is then deactivated to switch from the synchronous operation into an individual operation or a multi-operation, with at least one of the hoists remaining activated to carry out a lifting or lowering process relative to each deactivated hoist. A load value is then determined for the at least one deactivated hoist and compared to a predetermined threshold value of the at least one deactivated hoist.
US10723593B2

The disclosure relates to a method for detecting an impact on an elevator door. The method is characterized in that it comprises detecting a break in an elevator door safety circuit; comparing characteristics of the break to a set of parameters; and performing an action when the characteristics of the break fulfil the conditions determined by the set of parameters. The disclosure further relates to an apparatus, to an elevator safety system and to an elevator.
US10723586B2

A method for driving an elevator car brake device, an elevator system for executing the method, and a computer program implementing the method involve the brake device including at least one automatically releasable pressure element effecting a braking action and an electromagnet automatically releasing the pressure element, wherein a respectively required braking torque of the car is ascertained using a model of the elevator system, a direction of car travel, a state of load of the car and a desired car deceleration. A drive signal for driving the electromagnet is generated based on the braking torque and is supplied to the electromagnet, wherein, when the car is braked, an actual car deceleration is ascertained and calibration is performed based on the ascertained actual car deceleration, specifically calibration of the ascertained required braking torque or calibration of the drive signal that is generated based on the ascertained required braking torque.
US10723584B2

The present invention relates to a method and a device for aligning prefabricated cable ends (111, 121) of a cable strand (100), twisted in particular, with at least two cables (110, 120) in the correct rotational position, wherein the entire cable strand (100) is rotated by means of a rotary gripping device (30) on a section (101) which is connected to the cable ends and is rotated by means of a rotary gripping device (30) in particular, and each cable (110) that has already been aligned remains secured in its ideal rotational position in a section (112) of its free cable end (111), in particular untwisted, by means of a respective cable grip (10, 20).
US10723567B2

A rolling member includes a rolling shaft; rolling wheels fixed to two ends of the rolling shaft, rolling surfaces of the rolling wheels being sleeved with flexible loops respectively; at least one first engagement structure provided on a rolling surface of each rolling wheel; at least one second engagement structure provided on a surface of each flexible loop facing toward the rolling surface of the rolling wheel; wherein the at least one first engagement structure engages with the at least one second engagement structure.
US10723564B2

A method for moving a rotor onto a segment, a linear drive, a production machine, a machine tool, and a packaging machine comprising such a linear drive, wherein the actual speed of the rotor is ascertained using a sensor paired with the segment when the rotor is moved onto the segment, where the actual speed is selected by a control unit as the first target speed for the rotor, and after the target speed has been determined for the rotor, the regulation of the actual speed is activated for the rotor, and where the actual speed of the rotor is then regulated in accordance with a conventional rule, wherein a rule variable is the ascertained actual speed and/or the position of the rotor such that jerking or an undesired acceleration is prevented during transition of the rotor onto the segment.
US10723562B2

A conveyor belt drive system comprises an axial flux motor. The axial flux motor comprises a stator and rotor bearing mounted on a stationary shaft. The stator drives a toothed rotor mounted on the rotor bearing. The rotor has a tubular shaft extension that mates with a drive shaft that can accommodate standard sprockets. Rotation of the rotor causes rotation of the drive shaft and sprockets to drive a conveyor belt.
US10723559B2

A transport mechanism and a method for transporting objects are disclosed. The transport mechanism includes a transport unit, a vacuum belt conveyor unit, and a push-type transport unit. The vacuum belt conveyor unit receives objects from the transport unit and conveys the received objects to the push-type transport unit. The vacuum belt conveyor unit can generate a vacuum force to adhere the plurality of objects thereon. When the vacuum belt conveyor unit stops conveying the objects carried thereon, the objects adhered to the vacuum belt conveyor unit would block the objects being transported by the transport unit, and when the vacuum belt conveyor unit starts to convey the objects carried thereon to the push-type transport unit, the transport unit would immediately transport more objects to the vacuum belt conveyor unit. Thus, with the vacuum belt conveyor unit, the objects are conveyed to the push-type transport unit and the position of objects is also accurately controlled.
US10723554B2

Described in detail herein are methods and systems for an intake and transport system. A computing system can identify a physical object based on an attribute associated with the physical object. The computing system can determine a storage location of the physical object in the facility based on the attribute. In response identification of the physical object computing system can transmit an identifier to an autonomously controlled cart. The identifier corresponds to at least one of the attribute or the storage location. In response to receipt of the identifier activating an autonomously controlled cart can generate an indicator to indicate that the physical object is to be placed in the autonomously controlled cart. The autonomously controlled cart can autonomously navigate to the storage location in response to determining that the threshold capacity has been satisfied.
US10723550B2

A lifting device on a heavy goods vehicle is described, for lifting and emptying waste collection containers, having a telescopically extensible boom, which has a coupling tool for coupling to a waste collection container. An extensible support is attached on a rotating platform and has at least one interleaved, telescopically extensible profile, wherein the boom is provided at the upper end of the support with a pivot element between boom and support, so that the boom is pivotable in a vertical plane about a pivot axis. The extensible profile is designed as an internal runner having a fixed tube and runners having a polygonal footprint, and a carrier head is provided at the end of the support, which is formed as L-shaped having an overhanging carrier plate in relation to the support, which carrier plate has the pivot axis of the boom and a support for the pivot element.
US10723545B2

The present invention corresponds to materials storage devices; specifically to a specialized container for the storing of granulated raw materials and its operations support base; which has been created in response to the need of storing granulated raw materials, preferably silica meant to be used in, preferably but not limited to, petroleum wells; and which is fitted with specific modifications that facilitate both the loading and discharge of said raw materials in a shorter time lapse than that displayed by conventional technologies. The invention's preferred configuration contemplates the setting up of three containers on top of the operations support base.
US10723541B2

A system enables dispensing, tracking, storage, processing, analysis, management, fulfillment and/or commerce relating to dispensables, such as consumables. The system may include packages that hold consumables and function either independently or in concert with numerous smart configuration devices, such as tabletop machines or mobile machines, as well as remote servers, databases, and other cloud-based resources. A distributed software layer ties all devices and packages together and adds advanced interactivity, communication, analysis, and self-regulation functionality.
US10723538B2

The present disclosure provides vacuum insulated articles having two—or more—insulated volumes at reduced pressure. An article may include a first vent communicating with a first insulating space, a second vent communicating with a second insulating space, a first circular insulation seal sealing the first insulating space at the first vent; and a second circular insulation seal sealing the second insulating space at the second vent. Also provided are methods of fabricating vacuum insulated articles.
US10723536B2

Food packaging material comprising a polymeric material and a natural antioxidant. The natural antioxidant may be extracted, isolated and/or derived from plant material. A method for forming a food packaging material is also provided, comprising forming a mixture comprising a natural antioxidant and a polymeric resin and processing the mixture to form a food packaging material.
US10723533B2

A method of sorting a first subset of items in an order handling center, wherein at least a majority of the items of the first subset are sized below a predetermined size limit. The method includes directing the first subset of the items through an opening into a bag having a plurality of panels of flexible material coupled together at a plurality of seams. The method includes causing the bag to assume a substantially cuboid shape as the bag is filled to capacity with the first subset of items and stacking the bag on a pallet at a staging destination within the order handling center. The staging destination is associated with a delivery route from the order handling center.
US10723527B2

A dispensing closure for dispensing fluid product from a squeeze container consists of an outer cap element (3) and an inner element or valve disc (4) fitting inside the cap element. Each is moulded from thermoplastics; no elastomer is used. The cap element includes an outwardly-deflectable diaphragm wall (35) around a central outlet opening (361). The inner element (4) has a peripheral mounting ring (41), a central blocking portion (48) and a set of support spokes (46) providing flow clearance between them. In a closed position the blocking portion closes the outlet opening. In an outflow condition the diaphragm wall (35) deflects outwardly to allow flow. In a recovery mode the blocking portion (48) deflects inwardly for compensation air or residual liquid product to enter the container.
US10723525B2

A wafer container with a latch mechanism that provides sealing for large wafer containers, such as for 450 mm wafers, accomplishes secure door closing and latching with reduced torque requirements for rotating the central rotatable cam plate. In various embodiments, a camming slot formed in the rotatable cammed plate is arcuate and defined by opposing cam surfaces which are selectively engaged by a cam follower, such as a roller, attached to a proximal end of a latch arm. The roller can include unitary axle portions that snap into the proximal end of the latch arm and is supported at both axial ends of the roller. The proximal end of the latch arm can include parallel extensions separated by a gap, and have guide in surfaces to deflect the extensions as the axle portions of the roller are forced into position thereby seating the roller at both axial ends.
US10723520B2

A lid for a beverage cup includes a mouth opening, an aroma opening, and a concentrator member. The mouth opening is positioned closer to a rim of the lid than the aroma opening. An area of the aroma opening is greater than an area of the mouth opening. The concentrator member surrounds the aroma opening and extends from a plane formed by the aroma opening to a height above the aroma opening. A cross sectional area of the concentrator decreases in a direction from a base to an upper end of the concentrator, creating a concentration of beverage aromas in the space surrounding a user's nose. The concentrator channels a concentrated amount of aroma to the nose, providing an enhanced drinking and tasting experience.
US10723517B2

A blending system is shown and described herein. A blending system may include a base An injection molded plastic closure, stackable with similar closures in a known manner to prevent warping during cooling and to increase box storage capacity, is formed with a lead-in taper at the bottom of the closure skirt, maintaining and enhancing the stacking function while greatly reducing and nearly eliminating problems of cross-threading when the closure is screwed onto a container by machinery during a capping operation.
US10723511B2

A multiple beverage container assembly for containing a plurality of beverages includes a first sleeve. A disk is removably coupled to the first sleeve such that the first sleeve and the disk forms a first container for containing a first beverage. A first cap threadably engages the first sleeve to close the first sleeve. The first cap has an aperture extending therethrough and a drinking straw can be extended through the aperture. A second sleeve is removably coupled to the disk such that the second sleeve and the disk forms a second container for discretely containing a second beverage with respect to the first beverage. A second cap threadably engages the second sleeve to close the second sleeve.
US10723506B2

A simple paper food-beverage box comprises a box-body and a box-bottom-body combined in the box-body; wherein the box-body is provided for placing the food, which the box-body and the box-bottom-body respectively set a plurality of first folding-lines to provide folding storage; wherein the box-bottom-body has a predetermined distance from the bottom surface of the periphery of the box-body, and the bottom of each of the first folding-line is set with a first incision; wherein the box-bottom-body is set with a first through-hole, thereby providing for sticking and engaging a beverage cup on the bottom surface of the box-bottom-body; wherein the periphery of the cup-mouth of the beverage cup is stuck and engaged by the periphery of the box-body, and the straw of the beverage cup can extend out through the first through-hole.
US10723505B2

A storage and shipping box includes first closing flaps of the exterior of the box that extend from a pair of opposing sides of the upper face of the box and that are capable of being sealed, stapled or glued in order to carry out one or several shipments. The box further includes second closing flaps of the exterior of the box that extend from the other opposing sides of the upper face of the box. The second flaps include a closing element to open and close the box as many times as needed and are capable of being used for the storage of products or for preparing orders before or after carrying out a shipment.
US10723503B2

A shipping container for containing hydraulic loads, said container having a first pair of opposing walls having an convex inner surface and a second pair of opposing walls having a concave inner surface.
US10723498B2

A patch applicator arrangement for securing a patch over a hole in a vehicle part. The arrangement provides a robotic arm having at least one movable joint that allows the robotic arm to move about several axes. At the end of the robotic arm is a spindle that has several spring loaded patch applicators connected. The arrangement also includes a patch dispensing apparatus that the arrangements uses along with the robotic arm to place patches over holes in a vehicle part. The arrangement also provides a verification method to make sure the holes have been properly covered.
US10723484B2

A compound contour vacuum track, and an automated fastening machine using the track, for automation of final assembly inside an aircraft fuselage. The track is mounted at an angle to a surface, such as an inside surface of the fuselage, wherein the surface has one or more holes through which fasteners are inserted. The automated fastening machine is mounted on the track to traverse the track while performing fastening functions and steps. The automated fastening machine includes a carriage, arm, and end effector, wherein the arm is mounted on the carriage and the end effector is mounted on the arm. The carriage is attached to the track for positioning the arm and end effector, the arm is attached to the carriage for positioning the end effector, and the end effector is attached to the arm for installing the fasteners into the holes of the surface.
US10723483B2

Systems and methods using a lift tube with an Unmanned Aerial Vehicle (UAV) air traffic control system include staging one or more UAVs and associated cargo for takeoff; moving the staged one or more UAVs to a lift tube; and controlling the lift tube by the UAV air traffic control system to provide the one or more UAVs for takeoff, wherein the lift tube is a vertical structure disposed in a facility to raise the one or more UAVs from an interior position in the facility for takeoff outside of the facility.
US10723479B2

In one example, a method includes receiving, over an aircraft data communications bus, a plurality of non-pneumatic inputs corresponding to aircraft operational parameters. The method further includes processing the plurality of non-pneumatic inputs through an artificial intelligence network to generate an air data output value, and outputting the air data output value to a consuming system for use when a pneumatic-based air data output value is determined to be unreliable.
US10723466B2

A device for determining the water content in the atmosphere comprising: a laser transmitter suitable for transmitting a laser beam for illuminating particles of water and/or ice present in the atmosphere, a first out-of-focus imager having a first collection angle suitable for capturing at least one first representative image of the particles, and processing unit in communication connection with the first image. The device further comprises a second out-of-focus imager having a second collection angle suitable for capturing at least one second image. The processing unit is in communication connection with the second imager, the processing unit being suitable for processing the first and second images in order to determine the water content in the atmosphere.
US10723465B2

A system and method for controlling power includes a power source, a plurality of primary control circuits, a load, at least one secondary control circuit, a switch circuit, and a control channel. The plurality of primary control circuits are connected to control load power from the power source to respective ones of a plurality of load power inputs. The load is configured to receive power from the plurality of load power inputs. The at least one secondary control circuit is connected to the power source, and the switch circuit is connected between the at least one secondary control circuit and the plurality of load power inputs. The control channel is configured to control the switch circuit to connect the at least one secondary control circuit to a selected one of the plurality of load power inputs.
US10723464B2

An anti-icing system for annular turbofan engine housings what include a substantially closed annular housing at a leading edge of the turbofan engine housing, the annular housing containing a quantity of air and a conduit extending from a source of high pressure hot gas to the annular housing. The system also includes an injector connected to the end of the conduit and extending into the annular housing; one or more nozzles extending outwardly from the injector in a direction that the quantity of air circulates in the annular housing while the turbofan engine is operating. The nozzles have an entrance in fluid contact with the injector and an exit, wherein a cross-sectional area of the entrance is less than a cross-sectional area of the exit such that gas leaving the nozzles is travelling slower than gas entering the nozzles.
US10723458B2

An expandable cargo storage for a transportation means, comprising a first storage wall and a second storage wall opposite of the first storage wall, and a plurality of foldable walls arranged between the first and the second storage wall, each of the plurality of foldable walls being foldable between a first position in which the respective foldable wall is arranged essentially in parallel with the second storage wall, and a second position in which the foldable wall is arranged essentially perpendicularly to the second storage wall, wherein, when each of the foldable walls is arranged in its first position, the cargo storage is in a first operational state enclosing a first volume, and when each of the foldable walls is in its second position, the cargo storage is in a second operational state enclosing a second volume which is larger than the first volume.
US10723457B2

In an example, a power source for an electric propulsion system of an aerial vehicle includes a body having an electrical energy storage device configured to store electrical energy. The power source also includes a plurality of terminals coupled to the electrical energy storage device for supplying the electrical energy from the electrical energy storage device to the electric propulsion system of the aerial vehicle. The power source further includes a plurality of flight control surfaces extending outwardly from the body. The flight control surfaces are actuatable to adjust a flight attitude of the power source. Additionally, the power source includes a flight control system including a processor and configured to actuate the plurality of flight control surfaces to fly the power source to a target location when the power source is jettisoned from the aerial vehicle.
US10723446B2

An apparatus for determining a movement direction of a component of a mechanism. The apparatus includes an acoustic emission sensor arranged to detect acoustic emission from the mechanism, and a processor arranged to determine a Doppler shift in a frequency characteristic of the measured acoustic emission and to determine a movement direction of a component of the mechanism on the basis of the determined Doppler shift. A method of determining a movement direction of a component of a mechanism including detecting acoustic emission from the mechanism and determining a Doppler shift in a frequency characteristic of the measured acoustic emission and, determining, based on the Doppler shift in the frequency characteristic, a movement direction of the component of the mechanism.
US10723444B2

A configuration and system for rendering an aircraft spin resistant is disclosed. Resistance of the aircraft to spinning is accomplished by constraining a stall cell to a wing region adjacent to the fuselage and distant from the wing tip. Wing features that facilitate this constraint include but are not limited to one or more cuffs, stall strips, vortex generators, wing twists, wing sweeps and horizontal stabilizers. Alone or in combination, aircraft configuration features embodied by the present invention render the aircraft spin resistant by constraining the stall cell, which allows control surfaces of the aircraft to remain operational to control the aircraft.
US10723435B2

An acoustic abatement apparatus for an aircraft includes a layer of material disposed exterior to a fuselage of the aircraft, where the layer of material connects to the fuselage to establish a gap between the layer of material and the fuselage, a flexible container disposed in the gap, and at least one acoustic resonator connected to the flexible container. The at least one acoustic resonator is tuned to a predetermined resonator frequency.
US10723432B2

The present invention relates to a method for controlling the fuel consumption of a ship, the ship comprising an engine and a controllable pitch propeller, wherein torque and engine speed are adjusted to correspond to an output set point value. The adjustment is such that the engine is operated in an operating condition with an engine speed and a propeller pitch of the controllable pitch propeller such that the fuel consumption of the ship is brought and/or held within a desired fuel consumption range.
US10723429B1

A tiller system has a tiller adapted for steering at least one of a bracket assembly and a motor assembly of a marine outboard motor having a power steering system, a throttle control mounted to the tiller, an electronic torque sensor, and a tiller system control module (TSCM) in electronic communication with the electronic torque sensor. The electronic torque sensor senses torque applied to the tiller and outputs an electronic steering signal as a function of the torque. The TSCM receives the electronic steering signal and controls an operation of the power steering system in response to the electronic steering signal. A method for steering a marine outboard motor, and a marine outboard motor having a tiller system are also described.
US10723414B1

A universal fit accessory platform mount uses a pair of coextensive base legs with extensions slidably disposed within either end of the base legs. The extensions have tube clamps on a distal end thereof, the clamps attached to the t-top of a boat. Each extension is slid within the base legs so that its tube clamps align with a leg of the boat's t-top and each extension is attached to the t-top via the tube clamps. Once the extensions are attached and the accessory platform that is attached to the base legs is centered, the base legs are locked to the extensions to prevent sliding movement of the extensions with respect to the base legs.
US10723403B2

A scooter front end and a scooter device incorporating the front end. The front end may be releasably coupled to an auto-balancing drive wheel unit such as a Solowheel or Iota device. The scooter front end may serve as a training aid, or allow faster speeds or the carrying of goods, etc. The front end may include an ascending control structure that is used to steer the device. A support frame may extend rearwardly from a steerable wheel and provide a mechanism for releasable coupling to the auto-balancing drive wheel unit. Various embodiments for the scooter front end and drive wheel units are disclosed.
US10723401B2

This vehicle body structure of a saddle type vehicle includes a rear vehicle body mono-frame (22) having a merging portion (22a) configured to merge a pair of right and left front vehicle body frames (21) provided with at least a part of a fuel tank (8) interposed therebetween behind the fuel tank (8) and below a seat (9), and also configured to extend continuously to the front vehicle body frames (21).
US10723400B2

A bicycle stand including a frame, a flexible cable or chain for securing a bicycle to the frame, and a lockable container which is attached to the frame, the flexible cable or chain having at least one end secured within the container.
US10723399B2

An object management system and locking mechanism and method, such as may be used in a bicycle rental station. The system comprises a plurality of docking stations and a terminal connected to the docking stations by a network. At least one of the docking stations includes the locking mechanism for locking a connecting member secured to a bicycle or other object. The locking mechanism comprises a locking receptacle configured to receive the connecting member; a movable member positioned in the locking receptacle, the movable member having a lockable position and an unlockable position; and a locking member having a locked position and an unlocked position. The locking member is configured to secure the movable member, the movable member is configured to secure the connecting member, and the locking member is configured to rotate to switch between the locked position and unlocked position.
US10723395B2

A split chassis system includes a first chassis base portion that is configured to house a first component and a second chassis base portion that is configured to house a second component. The second chassis base portion is positioned adjacent the first chassis base portion such that a first chassis coupling member included on the first chassis base portion is coupled to a second chassis coupling member included on the second chassis base portion. The split chassis system further includes a leveling subsystem that is coupled to the first chassis base portion and the second chassis base portion. The leveling subsystem aligns the first chassis base portion and the second chassis base portion such that the first chassis base portion and the second chassis base portion substantially maintain coplanarity when the first chassis coupling member is coupled to the second chassis coupling member.
US10723393B2

A vehicle lower portion structure includes a resinous floor panel constituting a vehicle cabin floor surface, and a metallic reinforcing member. The reinforcing member is disposed to be bridged between vehicle skeleton members on a lower side of the floor panel and is configured to support a vehicle-mounted object disposed on the lower side of the floor panel.
US10723392B2

A vehicle member join structure includes a sheet-shaped first member made of a lightweight metal, a sheet-shaped second member made of a ferrous metal, a rivet made of a ferrous metal and including a shaft that penetrates the first member and a head that remains at an outer surface of the first member, the shaft being welded to the second member so as to connect the first member and the second member together, and a waterproof section that prevents water ingress by covering a region where the rivet and the first member contact each other.
US10723384B2

A vehicle body rear part structure includes a rear side frame. The rear side frame includes a general part and a slope part. The general part extends substantially horizontally in at least one of an upper surface and a lower surface. The slope part extends so as to slope downward from the general part. A curved part is formed at a boundary between the general part and the slope part. The rear side frame includes two components which are a front side member and a rear side member. The curved part is provided on a joint part between the front side member and the rear side member.
US10723381B2

The present invention is a hybrid crossover between an automobile and a motorcycle that is able to take tight corners almost like a motorcycle but is driven and handled like an automobile by optionally leaning into turns with one wheel in the front and two wheels in the rear of the vehicle and passenger compartment having an accelerator and brake pedals and steered with a steering wheel and gears that can be selected via a toggle switch gear selector located in the vicinity of the steering or by a floor and/or dash mounted unit.
US10723375B2

A mobile platform comprising: (a) one or more platforms to support one or more cartridges, (b) one or more compartments within the one or more platforms, (c) one or more vertical supports connected to the one or more platforms, (d) a plurality of wheels connected to a bottom of the one or more platforms, and (e) one or more recesses located in the one or more platforms to receive one or more support accessories, wherein the one or more compartments are shaped to receive the one or more cartridges so that the one or more cartridges are secured to the one or more platforms during movement.
US10723373B2

A broken wheel detection system for detecting broken wheels on rail vehicles even when such vehicles are moving at a high rate of speed.
US10723369B2

A bogie assembly for a rail vehicle comprises a bogie frame, two wheel axles supporting the bogie frame, a primary of a linear induction motor and two motor mounts. The two motor mounts are located proximate a different extremity of the primary and support the linear induction motor underneath the bogie frame. Each one of the two motor mounts has a bogie interface, a motor interface, a first spring, a conical spring, a core pin and a nut. The first spring is connected to the bogie interface on the bogie side while the conical spring is connected to the same bogie interface on the motor side. The core pin extends sequentially from the motor interface through the conical spring, then through the bogie interface and finally through the first spring where it is held in place by the nut on the other side of the first spring.
US10723368B2

A clamp for a cable-drawn transport device includes clamp jaws having a clamp spine and clamping tongues adjoining the clamp spine. The clamp spine and the clamping tongues form running surfaces for rollers. In the longitudinal direction, the clamping tongues have a substantially S-shaped curved running surface, which merges continuously into the running surface of the clamp spine.
US10723364B2

An information providing system includes a plurality of vehicles, and a server configured to communicate with the plurality of vehicles. A vehicle-side controller of each of a plurality of first vehicles of the plurality of vehicles determines whether or not an act detected by an act detector is an abnormal act that meets a predetermined condition, and, when the vehicle-side controller determines that the act is the abnormal act, the vehicle-side controller transmits, to the server, abnormal act occurrence information including a position of each first vehicle detected by a position detector. A server-side controller collects the occurrence information transmitted from the first vehicles as collected information, and transmits the collected information to a second vehicle of the plurality of vehicles to notify a user of the second vehicle of the collected information.
US10723360B2

Disclosed is an apparatus and method for estimating a radius of curvature of a vehicle. An apparatus for estimating a radius of curvature of a vehicle includes a processor, a memory for storing a program to be executed in the processor. The program includes instructions for estimating a first radius of curvature of the vehicle based on a yaw rate of the vehicle, estimating a second radius of curvature of the vehicle based on a lateral acceleration of the vehicle, and determining a final radius of curvature of the vehicle by combining the first radius of curvature and the second radius of curvature.
US10723359B2

Methods, systems, and media for controlling access to vehicle features are provided. In some embodiments, the method comprises: determining identifying information of a driver of a vehicle; receiving an indication that the driver wants to activate a feature of the vehicle; determining whether the driver is qualified to activate the feature based on the identifying information; in response to determining that the driver is not qualified to activate the feature, inhibiting activation of the feature and causing a user interface to be presented that indicates that the feature cannot be used; and in response to determining that the driver is qualified to activate the feature, activating the feature.
US10723358B2

The present teaching relates to method, system, and medium, for operating a vehicle. Real-time data related to the vehicle are received. A current mode of operation of the vehicle and a state of the driver present in the vehicle are determined. A first risk associated with the current mode of operation of the vehicle is evaluated based on the real-time data and the state of the driver in accordance with a risk model. In response to the first risk satisfying a first criterion, a second risk associated with switching the current mode to a different mode of operation of the vehicle is determined based on the state of the driver. The vehicle is switched from the current mode to the different mode when the second risk satisfies a second criterion.
US10723346B2

A vehicle control apparatus calculates a position at which a distance between a pedestrian and the own vehicle becomes zero in a travelling direction of the own vehicle as a predicted collision position. The vehicle control apparatus determines whether the pedestrian is crossing a course of the own vehicle. The vehicle control apparatus sets a limit value indicating a width of a determination region in a lateral direction perpendicular to the travelling direction of the own vehicle, and determines whether the pedestrian is present within the course of the own vehicle based on the predicted collision position and the limit value. The vehicle control apparatus sets one of a left and right limit values of a determination region in which the predicted collision position is present in the travelling direction of the own vehicle to be greater than the limit value of the other.
US10723334B2

An all-terrain vehicle is disclosed having a braking system with an anti-lock braking control module and a first brake master cylinder hydraulically coupled to the anti-lock braking control module. A first brake actuator is coupled to the first brake master cylinder and a brake caliper is coupled to at least some of the ground engaging members. The first brake master cylinder upon actuation provides anti-lock braking to either the first or second ground engaging members. A second brake master cylinder is hydraulically coupled to the anti-lock braking control module. A second brake actuator is coupled to the second brake master cylinder and a brake caliper is coupled to at least some of the ground engaging members. The second brake master cylinder upon actuation provides anti-lock braking to either the first or second ground engaging members. The vehicle also has a speed monitor with a gear ring positioned on an exterior surface of a stub shaft and a speed pickup positioned adjacent to the gear ring.
US10723330B2

The present disclosure relates to a support braking apparatus and method for a vehicle capable of detecting braking target candidates for a vehicle, matching a braking amount required for the detected braking target candidates with a braking amount of a driver to select a specific braking target, and braking a subject vehicle by following up braking required for the selected braking target even if the driver does not maintain a braking control for the selected braking target. A support braking apparatus for a vehicle according to an embodiment of the present disclosure includes: a braking amount measurer configured to measure a first braking amount based on signals input from an acceleration sensor and a wheel sensor; a braking target detector configured to detect braking target candidates on a driving route by a camera and a radar; a braking target selector configured to match a first braking amount with a second braking amount to stop a subject vehicle within a braking range for the braking target candidates to select the braking target, and a braking controller configured to control an automatic braking to stop the subject vehicle within the braking range for the selected braking target.
US10723325B2

Systems and methods for cleaning sensors of a vehicle using a spray pattern are provided. A sensor cleaning system can include a fluid source that supplies a fluid and a nozzle configured to provide a spray of the fluid to a sensor of an autonomous vehicle to remove debris from the sensor. The sensor cleaning system can further include a controller comprising one or more processors and one or more non-transitory computer-readable media that collectively store instructions that, when executed by the one or more processors, cause the controller to perform operations. The operations can include obtaining sensor data from the sensor, determining a spray pattern based at least in part on the sensor data; and controlling a flow of the fluid from the fluid source to the nozzle based at least in part on the spray pattern.
US10723312B1

In system and methods for theft prevention or mitigation, driver-related data associated with one or more authorized drivers of an insured vehicle may be collected over time. The authorized drivers and the insured vehicle may be covered by an insurance policy issued by an insurance provider. Based upon the collected driver-related data, a database associated with the authorized drivers may be built. Current driver-related data associated with an individual currently driving, attempting to start, or sitting in a seat of the insured vehicle may be collected. It may be determined, using both the database and the current driver-related data, that the individual is not among the authorized drivers. A disablement of an operation of the insured vehicle may be caused, and/or the individual may be caused to be prevented from starting or otherwise operating the insured vehicle, to facilitate preventing or mitigating theft of the insured vehicle.
US10723295B2

Methods and systems for bi-directional converter based battery module control for a vehicle electrical system are provided. The method includes monitoring a plurality of Smart Charging Modules (SCMs). Each of the plurality of SCMs can include a bi-directional converter and a plurality of electric switches. Each of the plurality of electric switches can connect to and control a battery module. The method also includes monitoring a load from the vehicle electrical system. The method further includes determining an operational mode for each of the plurality of SCMs. Also the method includes determining a synchronization pattern for the plurality of SCMs. The synchronization pattern is a pattern for phasing current draws such that a current draw for each of the plurality of SCMs does not overlap with each other. Further the method includes the plurality of SCMs directing power to the load based on the synchronization pattern.
US10723285B2

A dashboard of a vehicle has a structure that includes at least one first element and at least one second element, and a skin covering at least part of the first element and the second element. The structure and the skin together define an outer surface of the dashboard. The first element and the second element are able to be moved relative to one another, with the movement causing a deformation of the outer surface of the dashboard.
US10723273B1

An apparatus for enabling a user to access a roof of the vehicle. The apparatus may be positioned within a cavity that is located on a front surface of a B-pillar or a C-pillar of a vehicle. The apparatus including a plate having a distal end and a proximal end, the plate movable between a stored position where the plate is positioned within the cavity and the plate is configured to be substantially flush with the front surface of the B-pillar or the C-pillar, and an extended position where a majority of the plate is positioned outside the cavity and the plate is configured to be substantially perpendicular to the front surface of the B-pillar or the C-pillar to allow the user to place his or her foot on the plate for accessing the roof of the vehicle.
US10723267B2

An automotive audio visual system includes a display screen on the vehicle, such as the central display screen on the vehicle's dashboard, and one or more rear cameras facing a rear passenger seat of the vehicle. The image or video feed from one or more rear cameras is displayed on the display screen in the vehicle, so that the front passengers can view the rear passenger area on the vehicle's display screen.
US10723245B2

A support base for a child safety seat includes a shell, a belt clamp, a latching mechanism and a belt retaining structure. The shell is adapted to receive a child seat thereon, and has a panel at an end thereof. The belt clamp is pivotally connected with the shell and is disposed adjacent to the panel, the panel rising above the belt clamp, the belt clamp being operable to clamp a lap belt portion of a vehicle safety belt adjacent to a surface of the shell. The latching mechanism is operable to lock the belt clamp in a clamping state. The belt retaining structure is provided on the panel, and is configured to hold a shoulder belt portion of a vehicle safety belt adjacent to the panel.
US10723238B2

Approaches for charging a battery for an electric vehicle involve obtaining battery usage metrics of the battery of the electric vehicle based upon past usage of the battery and past charging of the battery. The metrics are analyzed to determine a target state of charge (SOC) for a first type of vehicle usage and determine a charging scheme as a function of time to achieve the target SOC at a first predetermined time. The charging scheme includes a first time period and a subsequent second time period, wherein an average rate of delivering charge to the battery during the second time period is greater than an average rate of delivering charge to the battery during the first time period. The battery is charged according to the charging scheme until the battery reaches the target SOC, which is less than a maximum state of charge for the battery.
US10723233B2

A controller of an electrically powered vehicle includes an electronic control unit. The electronic control unit performs a switching control by a square wave control in a first switching mode when a rotation speed of the motor is equal to or higher than a first predetermined rotation speed. The electronic control unit performs the switching control by the square wave control in a second switching mode when the rotation speed of the motor is lower than the first predetermined rotation speed. The first predetermined rotation speed is a rotation speed lower than a first resonance region. The first switching mode is a mode of a switching pattern that suppresses LC resonance in the first resonance region. The second switching mode is a mode of a switching pattern that suppresses LC resonance in a second resonance region lower than the first predetermined rotation speed.
US10723230B2

Embodiments can provide a system to facilitate a network of electric vehicle (EV) charging stations. Information regarding individual EV stations can be gathered and stored in one or more databases. Such information may be used to facilitate routing and/or scheduling of individual EV charging to the EV charging stations. A request may be received over a network to charge an EV. In response to receiving the request, one or more charging stations in the network may be determined as being available for charging the EV. Information regarding the one or more charging stations may be “pushed” to the EV and/or a client computing device associated with the EV for selection. A selection of a particular EV charging station can be received and the selected EV charging station can be accordingly reserved for charging the EV.
US10723229B1

A vehicle includes an electric machine, friction brakes, and a controller. The electric machine is configured to recharge a battery during regenerative braking. The friction brakes are configured to apply torque to wheels of the vehicle to decelerate the vehicle. The controller is programmed to, responsive to an anti-lock braking event, adjust a regenerative braking torque of the electric machine based on a difference between a desired wheel slip ratio and an actual wheel slip ratio.
US10723227B2

A brake system (100) and a brake method for a four-wheel drive electric vehicle and a four-wheel drive electric vehicle, in the system, according to a brake mode of the electric vehicle, a state of charge of a battery pack (4) and a vehicle speed, a first brake control unit controls a motor (6) to brake a wheel (9) through a motor controller (2) and a second brake control unit controls a brake actuator (12) to brake the wheels (9). The first brake control unit further determines whether a brake torque of the brake actuator (12) on the wheels (9) fails. If yes, the first brake control unit controls the motor (6) to brake the corresponding wheel (9) through the motor controller (2).
US10723226B1

A pattern recognition system receives an image captured by an image capture device, of an operator and the operator is identified. Operator information is accessed, based upon the identified operator, and a control signal is generated to control a mobile machine, based upon the operator information.
US10723225B2

A PTO transmission includes a PTO control system, an input shaft, a first output shaft, a parallel intermediate shaft, a second output shaft coaxially disposed with respect to the first output shaft, four gear pairs disposed so that the input shaft comprises two gears, the first output shaft comprises three gears, the intermediate shaft comprises two gears, and the second output shaft comprises one gear. Two gear pairs are in engagement between the input shaft and the first output shaft, one gear pair is in engagement between the first output shaft and the intermediate shaft, and one gear pair is in engagement between the input shaft and the second output shaft. At least one gear of each gear pair is shiftable.
US10723223B2

A closure system including a filler neck, a guide socket arranged inside the filler neck, a closure cap to be introduced between the filler neck and the guide socket and which is fastenable to the filler neck and an annular seal to be received in an annular groove of the closure cap and which is secured to an inner face of the filler neck. The annular seal is arranged between the filler neck and the guide socket such that a nozzle placed between the filler neck and the guide socket does not reach thereto.
US10723211B2

A powertrain system including a first housing, a first electric motor that drives a first wheel, a first inverter coupled to the first electric motor, a first gear reducer coupled to the first electric motor. The first gear reducer couples to a first wheel. The powertrain system also includes a second electric motor that drives a second wheel, a second inverter coupled to the second electric motor, a second gear reducer coupled to the second electric motor. The second gear reducer couples to a second wheel. The housing houses the first electric motor, the first inverter, the first gear reducer, the second electric motor, second inverter, and the second gear reducer.
US10723206B2

A door module for a motor vehicle door having a module carrier which is formed substantially by organic sheet, a longitudinally extending channel which is formed integrally in the organic sheet of the module carrier, an insertion opening which extends along the direction of extent of the channel and via which a reinforcement element of the motor vehicle door is insertable into the channel, and at least one functional element which is fixed to the module carrier and which crosses the channel and thereby partially covers the longitudinally extending insertion opening thereof. In the organic sheet of the module carrier, there is formed an elastically deformable bending region which enables the channel to be bent open at least in sections, and/or enables the channel to be bent away from the functional element, in order to open up the insertion opening of the channel for the insertion of the reinforcement element.
US10723203B2

A refrigeration cycle device includes: a first expansion valve that decompresses a refrigerant flowing out of a high-pressure side heat exchanger; an exterior heat exchanger that exchanges heat between the refrigerant flowing out of the first expansion valve and outside air; a second expansion valve that decompresses the refrigerant flowing out of the exterior heat exchanger; a low-pressure side heat exchanger arranged in series with the exterior heat exchanger; a cooler core that exchanges heat between the heat medium cooled by the low-pressure side heat exchanger and air to be blown into a vehicle interior to cool the air; and a controller configured to switch between a heat absorption mode and a heat dissipation mode by adjusting an amount of decompression in each of the first expansion valve and the second expansion valve.
US10723200B2

A controller for an electric heating device comprising a support element and a busbar which is secured on the support element and which is connected to an SMD component in an electrically conductive manner. The busbar is part of an initially single-part stamped metal plate with a severed connecting piece, which separates the metal plate into a supply element and a discharge element, the elements being connected together in an electrically conductive manner solely via the SMD component. Also disclosed is a method of producing an electric heating device generally as described above such that the supply element and the discharge element are produced from the supply element region and the discharge element region on the stamped metal plate, respectively.
US10723188B2

A trailer coupler system can include one or more skid plates made from extruded aluminum, one or more support tubes attached to the skid plates, a plurality of struts having a first end attached to the one or more skid plates, a ball housing attached to a second end of at least two of the plurality of struts, a first towball positioned within the ball housing, an adapter sleeve attached to the ball housing, a support plate extending from a support tube or skid plate to the adapter sleeve, an adapter having a kingpin coupler for coupling to a kingpin of a trailer, and a towball coupler for directly coupling with the first towball.
US10723183B2

A method whereby a central unit carried on board a motor vehicle can identify the wheels of a motor vehicle, by locating a radiofrequency black spot for transmissions between a wheel unit with which a wheel of a motor vehicle is equipped and a wheel-monitoring central control unit carried on board the vehicle, a wheel angle encoding independent of the transmission being in any case performed in order to measure the true rotation of the wheel at a given instant. A string of successive frames providing full angular coverage of the wheel is transmitted from the wheel unit, a receive rate for the frames being established and analyzed in order to detect at least one spot of poorer reception corresponding to the at least one black spot, the angle encoding providing an angle of rotation of the wheel at the instant of detection of the at least one black spot.
US10723173B2

A coupling system for a sealing assembly with a rotating annular member. In particular, a bearing ring provided with a flange. The sealing assembly provides at least one first annular shield having a sleeve portion integrally coupled with the rotating annular member and a flange portion that radially and overhangingly protrudes from the sleeve portion and is arranged close to the flange. The sleeve portion is defined by a solid tubular body of rotation delimited by a mounting surface facing towards the rotating annular member and having cylindrical geometry, In combination, the sleeve portion couples with an assembly seat of the rotating annular member, formed by an annular shallow recess delimited by a cylindrical bottom surface and by an axial shoulder arranged on the side opposite to the flange; the first annular shield being placed, at the same time, in axial contact with the flange portion and the axial shoulder.
US10723172B2

A non-metallic rim for a wheel which may be used for motorised vehicles. The rim has a barrel, a first flange, a second flange, a first bead seat, a second beat seat and a primary structural component. The primary structural component extends into at least the first flange and the barrel, and the primary structural component is capable of bearing the majority of the radial and/or lateral load that is borne by the rim during usage. Additionally, the rim has at least a portion of the first bead seat spaced apart from the primary structural component and/or has a protective insert in between the outer face of the first flange and the primary structural component.
US10723169B2

Platform movement systems and methods of using the same. A system for moving a platform of the present disclosure can include a first actuator pivotally attached to a base, the first actuator having a first rod positioned therethrough and configured to move the first rod in a first direction and an opposing second direction along a first rod axis; a second actuator pivotally attached to the base, the second actuator having a second rod positioned therethrough and configured to move the second rod in a first direction and an opposing second direction along a second rod axis; an arm attached to the base using an arm connector; and a platform coupled to the first rod, the second rod, and the arm, the platform configured to move about the base upon operation of the first actuator and/or the second actuator.
US10723165B2

Methods of personal and article identification and licensing are disclosed. Methods and constructions of cards and plates include driver's license fabrication and production for the purpose of regulating or identifying a driver and assuring their identity and compliance with jurisdictional regulations and license plate fabrication and production for the purpose of regulating or identifying a vehicle and assuring its identity and compliance with jurisdictional regulations. Driver's licenses and license plates are described herein as exemplary embodiments of identification cards and licensing devices that are produced according to certain processes of manufacturing and issuing.
US10723162B2

The invention relates to an adhesive binder with a machine frame, a plurality of processing stations that are attached to the machine frame, at least two transport clamps for transporting book blocks, at least one closed guide track for the transport clamps, and at least one device for changing the overhang of the book blocks. To realize a technology-required change in the overhang in an easy and secure manner, the at least one device for changing the overhang of the book blocks is arranged in such a way as to operate jointly with a lower edge of at least one of the transport clamps, so that the lower edge can be positioned in several first planes of the adhesive binder, which extend parallel to the at least one closed guide track.
US10723160B2

A universal or all-purpose laser marking composition for forming satisfactorily dark laser marks on a wide variety of substrates is provided. The marking composition comprises an enhancer of nitrides, carbides, silicides, and combinations thereof. The enhancer may be selected one or more of ferromanganese, ferrosilicon, FexSi(1-x) where X can range from about 0.005 to 0.995, Fe5Si2, MgFeSi, SiC, CaSi, (Co)Mo, MoSi2, TiSi2, ZrSi2, WSi2, MnSi2, YSi, Cu5Si, Ni2Si, Fe3C, Fe7C3 and Fe2C, MoC, Mo2C, Mo3C2, YC2, WC, Al4C3, Mg2C, Mg2C3, CaC2, LaC2, Ta4C3, Fe2N, Fe3N, Fe4N, Fe7N3, Fe16N2, MoN, Mo2N, W2N, WN, WN2, and combinations thereof and combinations thereof. Upon disposing the marking composition on a substrate and exposing the marking composition to laser radiation, the marking composition absorbs the laser radiation, increases in temperature, chemically bonds with the substrate, and when formed on each of a metal, glass, ceramic, stone, and plastic substrates, the mark has a negative ΔL dark contrast value of at least −1 compared to a mark formed by the marking composition without the enhancer.
US10723155B2

An inkjet recording apparatus includes a conveying unit, a recording unit, a heat source, a heat source moving unit and a heat source moving control unit. The conveying unit performs a conveying operation to move a conveying member thereby conveying a recording medium placed on a conveying surface of the conveying member. The recording unit records an image by ejecting ink to the recording medium conveyed by the conveying unit. The heat source moving unit moves the heat source. The heat source moving control unit moves the heat source by the heat source moving unit such that a distance between the heat source and the conveying surface increases when the conveying operation which is performed by the conveying unit stops in a manner in which the conveying operation can be resumed in a state where the heat source is positioned in proximity of the conveying surface.
US10723147B2

A method of forming a digital print on a surface by applying powder of dry ink including colourants on the surface, bonding a part of the dry ink powder to the surface by a digital heating print head such that the digital print is formed by the bonded dry ink colourants and removing non-bonded dry ink from the surface.
US10723142B2

An image forming method is provided. The method includes the steps of (a) applying an ink to a recording medium to form an image and (b) applying a pressure to the recording medium to which the ink has been applied. The ink comprises water, an organic solvent, and a colorant. When the ink is formed into an ink film, a maximum value of logarithmic damping ratio of the ink film is 1.50 or less and a time elapsed until the logarithmic damping ratio reaches the maximum value is 3,800 seconds or less, when measured by a rigid-body pendulum test at 60° C.
US10723140B2

In one example, method includes displaying an estimate of the number of pages that can be printed from a total amount of printing fluid including a printing fluid supply and a printing fluid reserve. The estimate is decremented in amounts of a first interval, in response to a first sensor signal indicating that the printing fluid supply is not empty. The estimate is decremented in amounts of a second interval that is smaller than the first interval, in response to a second sensor signal indicating that the printing fluid supply is empty.
US10723135B2

The ink jet recording method, which uses an ink jet recording apparatus, including: a first ink and a second ink containing a pigment; and a recording head having an ejection orifice surface in which a first ejection orifice array for ejecting the first ink and a second ejection orifice array for ejecting the second ink are formed, wherein the first ejection orifice array and the second ejection orifice array are sequentially arranged from the bottom in the direction of gravity to be adjacent to each other and arranged to at least partially overlap each other, includes: a recording step, wherein a true specific gravity of the pigment in the first ink is smaller than a true specific gravity of the pigment in the second ink.
US10723133B2

A system is disclosed. The system at least one physical memory device to store ink estimation logic and one or more processors coupled with the at least one physical memory device, to execute the ink estimation logic to receive one or more gray level histograms, receive one or more halftone designs and generate estimated ink usage data for each of one or more color planes based on the gray level histograms and the halftone designs, wherein each gray level histogram corresponds to one of the one or more color planes, and each halftone design corresponds to one of the one or more color planes.
US10723131B2

A liquid discharging device includes a liquid discharging head including a nozzle surface and multiple nozzles, the liquid discharging head to discharge liquid through the nozzles, a wiping member to wipe the nozzle surface of the liquid discharging head, and a pressing member to press the wiping member against the nozzle surface when the wiping member wipes the nozzle surface, wherein the wiping member satisfies the following conditions 1 and 2 when the wiping member is pressed against the nozzle surface by the pressing member during wiping: the contact ratio of the wiping member with the nozzle surface is from 60 to 95 percent Condition 1, the porous volume per unit area represented by V×T/100 is from 0.1 to 0.7 (mm3/mm2), where V (percent) represents a porosity and T (mm) represents a thickness of the wiping member Condition 2.
US10723127B2

A liquid ejection head including first and second recording element substrates adjacent in a direction intersecting a relative movement direction include ejection opening rows that include ejection openings arranged in the intersecting direction. A straight line connecting the ejection openings in end portions on a second recording element substrate side in the first recording element substrate and a straight line connecting the ejection openings in end portions on a first recording element substrate side in the second recording element substrate are inclined towards a middle area side of the first recording element substrate, and arrangement intervals of the ejection openings in an end portion area on the second recording element substrate side of a first ejection opening row is larger than arrangement intervals of the ejection openings in an end portion area on the first recording element substrate side of a second ejection opening row.
US10723126B2

An inkjet recording apparatus includes a sheet conveying unit, a storage unit, a line head, and a control unit. The line head includes an upstream-side head and a downstream-side head. The upstream-side and downstream-side heads are fitted to have overlapping portions in which a plurality of nozzles arranged in respective end portions of the heads overlap as seen from the sub scanning direction. When an adjustment chart is printed, the control unit makes the nozzles in the overlapping portion of the upstream-side head print a first line. The control unit makes the nozzles in the overlapping portion of the downstream-side head print a second line.
US10723125B2

A printing apparatus, which uses a printhead including a circuit configured to inspect an ink discharge status of a selected nozzle using a temperature detection element, causes the printhead to inspect the ink discharge status by changing a threshold value for judging a detection result of the temperature detection element, in order to judge the ink discharge status in a state in which a heater in the selected nozzle is driven by each of a first pulse and a second pulse whose waveform is different from that of the first pulse, obtains first information about a change point where a judgment result obtained by the first pulse changes, and second information about a change point where a judgment result obtained by the second pulse changes, and sets the threshold value based on the first and second information.
US10723123B2

The present disclosure is drawn to an ink composition including an aqueous liquid vehicle, from 2 wt % to 7 wt % self-dispersed pigment dispersed in the aqueous liquid vehicle, and from 0.5 wt % to 5 wt % acidic polymeric binder particles having an acid number from 30 to 200 and a particle size from 1 nm to 100 nm dispersed in the aqueous liquid vehicle. The ink composition can also include from 0.1 wt % to 0.75 wt % monovalent salt solubilized in the aqueous liquid vehicle. The self-dispersed pigment to monovalent salt weight ratio in the ink composition can be from 3:1 to 50:1, for example.
US10723118B2

A system and method for the overprint on flexible supports are described. In particular, the overprint system 1 comprises a printing unit 2 comprising a rotatable printing cylinder 3, having printing zones at the surface thereof, and first actuating means 14, configured to drive in a controllable manner the printing cylinder 3 rotation. The system further comprises a first reel 5 for unwinding a flexible support 4 to be printed, which has preset zones to be overprinted, and a second reel 8 for rewinding the flexible support 4, once it has been printed. A plurality of winding rolls 7 arranges an unwinding path, for the flexible support 4, comprised between the first 5 and the second 8 reels, and passing through the printing unit 2. The system then comprises second actuation means 20, configured to drive in a controllable manner the flexible support 4 advancement along the unwinding path (upstream of the printing unit 2 in the unwinding direction), and control means 10, configured to control in a coordinated manner both the first actuating means 14 and the second actuation means 20, so as to determine at every moment a correspondence of the preset zones to be overprinted of the flexible support 4 with respective printing zones of the printing cylinder 3.
US10723108B2

Embodiments disclosed herein include multilayer films having at least an outer layer that includes 1) polyethylene elastomer and 2) ULDPE or VLDPE and that has a purge fraction greater than 20 percent as determined by Crystallization Elution Fractionation (CEF) test method. Embodiments disclosed herein also include related compositions to make such films and methods of making such films. The ULDPE or VLDPE can be made via Ziegler-Natta catalyst reaction techniques to provide the desired purge fraction.
US10723104B2

Embodiments of this disclosure pertain to a laminate including a first substrate, an interlayer and a light responsive material disposed on the first substrate, and a second substrate disposed on the interlayer. The laminate may be complexly curved. The light responsive material may include any one or more of an electrochromic material, a photochromic material, a suspended particle material, a micro-blind material and a liquid crystal material. In one or more embodiments, the laminate comprises a display unit disposed between the first and second substrate. Methods for forming the laminate are also disclosed.
US10723102B2

In certain embodiments, the present disclosure relates to low emissivity films and articles comprising them. Other embodiments are directed to methods of reducing emissivity in an article comprising the use of low emissivity films. In some embodiments, the low emissivity films comprise a metal layer and one or more zirconium nitride layers adjacent the metal layer. This type of assembly may serve various purposes, including being used as a sun control film. These constructions may be used, for example, on glazing units for reducing transmission of infrared radiation across the film in both directions.
US10723099B2

Provided is a vinyl chloride resin composition that can provide a molded product having superior flexibility at low temperatures. The vinyl chloride resin composition includes (a) a vinyl chloride resin, (b) a diester plasticizer formed from a compound represented by formula (1) shown below, and (c) a trimellitate plasticizer. Furthermore, (a) the vinyl chloride resin includes (x) a base vinyl chloride resin in an amount of from 70 mass % to 100 mass % and (y) vinyl chloride resin fine particles in an amount of from 0 mass % to 30 mass %. In formula (1), R1 and R3 are monovalent hydrocarbon groups having an unsaturated carbon-carbon bond that may be the same or different, and R2 is a divalent hydrocarbon group.
US10723097B2

A laminate according to an embodiment includes a base material layer, an adhesive layer provided on the base material layer and having a thickness of 0.1 μm to 1.0 μm, and the first sealant layer provided on the adhesive layer and made of a cyclic polyolefin resin having a glass transition temperature of 60° C. to 85° C. One main surface of the first sealant layer constitutes an outermost surface of the laminate. The other main surface of the first sealant layer is in contact with the adhesive layer or is adjacent to the adhesive layer with only the second sealant layer made of a low density polyethylene resin interposed therebetween. An adhesion strength between the base material layer and the first sealant layer is 0.8 N/15 mm or more.
US10723080B1

A plastic tank is comprised of two parts, a base and a top, that are permanently joined to each other by welding at a circumferential joint formed by two mating flanges of the parts. Fusion weld elements are captured on the faying surfaces of the flanges of the assembled parts, and the elements melted by internal heating of metal portions of the elements. Before heating of the elements, the flanges are gripped by a clamp which applies a resilient force which, during welding, causes the flanges to move toward each other and thereby a good weld joint is formed.
US10723079B2

The apparatus generates slices of slender member structures for additive manufacturing of object using a processor having associated non-transitory memory. The memory is programmed to define a graph data structure for storing data representing a plurality of elongated struts each having a predefined spatial position and orientation relative to a three-dimensional reference frame. The memory is further programmed to define a slice data structure for storing data representing spaced apart and parallel two-dimensional slices each passing through the three-dimensional reference frame, the slice data structure storing for each slice a grid comprising a plurality of pixels, each pixel representing a binary state indicating whether material is or is not added in performing additive manufacturing of an object.
US10723069B2

A layer-by layer method for additive manufacturing that includes: photocuring a first volume of resin to form a layer of a build at an upper surface of a separation membrane laminated over a build window; injecting a fluid into an interstitial region between the separation membrane and the build window; retracting the build from the build window; evacuating the fluid from the interstitial region; and photocuring a second volume of liquid resin to form a subsequent layer of the build between an upper surface of a separation membrane and the previous layer of the build.
US10723058B2

A construction that prevents liquid from dripping from a nozzle and adhering to a product when the nozzle is separated from a mouth of the product after liquid-blow molding. A preform includes a mouth, a body, and a neck support portion, and is provided with a step surface on an inner peripheral face adjacent to the neck support part. A liquid blow molding apparatus includes a nozzle that is inserted in the mouth of the preform, a pressurized liquid-supply unit that supplies pressurized liquid to the nozzle, and a sealing member that is formed in a cylinder and fits on an outer peripheral face of the nozzle abuts the step surface, in an axial direction, when the nozzle is inserted in the mouth of the preform to seal the gap between the nozzle and the inner peripheral face of the preform.
US10723050B2

A method of manufacturing a seal assembly for attachment to a vehicle having a securing point spaced from a vehicle point at a distance with an apparatus having first and second receptacles defining a cavity, and a bracket apparatus defining a bracket cavity, including: forming a first strip having a first body with first ends; forming a second strip having a second body with second ends; positioning one first end into the first receptacle with the first body adjacent to the bracket cavity; positioning one second end into the second receptacle; forming a molding bonding the strips together to define a mold point; forming a bracket with a receiver at a receiver point, and an interface bonded to the first body spaced such that a distance between the receiver point of the bonded bracket and the mold point is equal to the distance between the securing and vehicle points.
US10723040B2

A formliner, sheet, system, and methods of use and manufacture are provided in order to provide a product that can minimize and/or eliminate visible seaming between interconnected formliners during fabrication of a pattern on a curable material. In some embodiments, the formliner can comprise raised sections that define interrelated inner and outer dimensions. Thus, a plurality of formliners can be interconnected by overlaying raised sections thereof. Further, the formliner can comprise one or more detents and one or more protrusions to enable engagement between interconnected formliners without requiring adhesives. In this manner, formliners can be interconnected in a nested manner such that visible seaming between the interconnected formliners is reduced and/or eliminated.
US10723030B2

A scraping tool includes a first holding member having a first through-groove between a first holding portion and a first connecting portion. A second holding member includes a second through-groove between a second holding portion and a second connecting portion. The second connecting portion is connected to the first connecting portion to permit the second holding member to sway relative to the first holding member between a holding position and an extended position. A locking device includes first and second abutting portion respectively abutting against the first and second holding member and a sliding portion slideably extending through the first and second through-groove. The locking device is movable relative to the first and second holding member between a locking position in which the second holding member is in the holding position and a release position in which the second holding member is movable to the extended position.
US10723024B2

Specialized robot motion planning hardware and methods of making and using same are provided. A robot-specific hardware can be designed using a tool that receives a robot description comprising a collision geometry of a robot, degrees of freedom for each joint of the robot, and joint limits of the robot; receives a scenario description; generates a probabilistic roadmap (PRM) using the robot description and the scenario description; and for each edge of PRM, produces a collision detection unit comprising a circuit indicating all parts of obstacles that collide with that edge. The hardware is implemented as parallel collision detection units that provide collision detection results used to remove edges from the PRM that is searched to find a path to a goal position.
US10723023B2

This control device is able to prevent the position displacement of a workpiece supported by a workpiece moving device. The control device includes a workpiece moving device controller configured to control the workpiece moving device wherein a time constant corresponding to a time period from a commencement to an termination of acceleration and deceleration of the workpiece moving device is longer for causing the robot and the workpiece moving device to perform an operation other than the workpiece processing operation, compared with the time constant for performing a workpiece processing operation in which the robot and the workpiece moving device perform work on the workpiece in cooperation with each other.
US10723018B2

Systems and methods for remote operating and/or monitoring of a robot are disclosed. In some exemplary implementations, a robot can be communicatively coupled to a remote network. The remote network can send and receive signals with the robot. In some exemplary implementations, the remote network can receive sensor data from the robot, allowing the remote network to determine the context of the robot. In this way, the remote network can respond to assistance requests and also provide operating commands to the robot.
US10723017B1

Aspects of present disclosure relates to a robotic eye system. In certain embodiments, robotic eye driving system includes: a robotic eye body, a first eyeball and a second eyeball, a lower eyelid, an upper eyelid, an eyeball driving system, an eyelid driving system, and a robotic eye controller. Robotic eye body includes a front panel and a rear panel. Front panel includes a first eye socket and a second eye socket. First eyeball and second eyeball are positioned in first eye socket and second eye socket, respectively. First eye socket and second eye socket limit first eyeball and second eyeball to rotate around a first eyeball center and a second eyeball center, respectively. The eyeball driving system includes an eyeball vertical driving mechanism and an eyeball horizontal driving mechanism to drive the first eyeball and the second eyeball, and the eyelid driving system drives the upper eyelid, concurrently and independently.
US10723011B2

The invention relates to a power tool including a support arm and a tool member supported at a first end of the support arm, where a drive motor at a second end of the support arm is arranged to power a drive belt that drives the tool member. The support arm comprises a frame member and a cover attached to the frame member, wherein the first end of the support arm further supporting a shield at least partially enclosing the tool member. A distance member is arranged between the frame member and the shield and extends radially at right angles to the drive shaft, wherein a radially outer portion of the distance member is spaced a predetermined distance(s) from the shield.
US10723009B2

A powered tool is depicted which includes a transmission that permits an input shaft to rotate in a single rotational direction during operation of the powered tool, but otherwise allowing the rotation of an output shaft to change direction depending on the arrangement of the transmission. In one form a first shaft is coupled with a planetary gearing arrangement which includes planetary gears and a ring gear. A second shaft is coupled with a moveable clutch. When the clutch is moved to a first position it is coupled to bypass the ring gear which provides rotation of the second shaft in the same direction as the first shaft. When the clutch is moved to a second position to engage the ring gear the direction of rotation of the second shaft is opposite the first shaft.
US10723005B2

An electric fastener driving tool assembly can include a driver designed to drive a fastener into a workpiece. The driver can reciprocate along an axial driver path between an extended position and a home position. A home position sensor can be located laterally adjacent the axial driver path. The home position sensor can be located to sense the presence of the driver in the home position when a lateral distance between the driver and the sensor changes.
US10722997B2

A method for making a multilayer polishing pad includes rotating a cylinder about a central axis. The cylinder encloses in an interior space a single polymer mixture that phase separates under centrifugal force. The method also includes forming the polishing pad from at least some of a polymer formed after the polymer mixture has reacted. The method includes forming at least two distinct layers in the polishing pad by casting and gelling sequentially at least two different polymers.
US10722995B2

A method of manufacturing a window for a display apparatus according to the present invention includes: providing, on a stage, a substrate including a foldable part bending around a folding axis extending in a first direction, and forming a groove on the foldable part. The forming the groove includes: grinding the foldable part by using a first machining wheel; grinding the foldable part by using a second machining wheel; and machining the foldable part by using a polishing wheel. The groove has at least one radius of curvature. The first machining wheel includes first abrasive grains, and the second machining wheel includes second abrasive grains less in size than the first abrasive grains.
US10722994B2

The application relates to a method for the automatic determination of the geometrical dimensions of a tool having a machining region in worm thread form, in particular of a grinding worm, in a gear cutting machine, wherein at least one parameter of the tool is automatically detected and/or determined by means of at least one sensor.
US10722992B2

A workpiece placement system includes a robot for placing a workpiece in a containment area or on a jig; a sensor for measuring a three-dimensional shape of the containment area or jig; a processor for performing a process to determine a workpiece placement position and a workpiece placement posture based on the three-dimensional shape; and a robot controller for controlling the robot based on the workpiece placement position and the workpiece placement posture. The processor obtains a workpiece shape of the workpiece to be placed; retrieves workpiece placement postures chosen by a user; calculates a vacant area of the containment area or jig based on the three-dimensional shape; calculates workpiece placeable areas that satisfy the workpiece shape and the workpiece placement posture in the vacant area; and determines the workpiece placement position and the workpiece placement posture suitable for placement of the workpiece in the workpiece placeable areas.
US10722982B2

Methods for forming a hole in a coated component are provided. The method may include forming a sacrificial layer over a ceramic barrier coating of a substrate, drilling a hole into the coated component such that any spatter formed during drilling deposits onto the sacrificial layer, and removing the sacrificial layer along with the spatter deposited thereon. The sacrificial layer may include a rare earth oxide (e.g., rare earth oxide particles). Intermediate ceramic matrix composite (CMC) component are also provided. The intermediate CMC may include a CMC body, an environmental barrier coating on the bond coating, and a sacrificial layer on the environmental barrier coating, with the sacrificial layer including particles of a rare earth oxide dispersed in a polymeric matrix.
US10722980B2

Disclosed herein is a laser processing apparatus including first and second laser mechanisms, a laser oscillator for oscillating an original laser beam, an optical system for branching the original laser beam into first and second laser beams, and first and second operation panels for respectively setting first and second processing conditions for the first and second laser mechanisms. The first and second laser mechanisms include first and second chuck tables for holding first and second workpieces, first and second X moving units for moving the first and second chuck tables in an X direction, first and second Y moving units for moving the first and second chuck tables in a Y direction perpendicular to the X direction, and first and second focusing units for focusing the first and second laser beams to the first and second workpieces held on the first and second chuck tables, respectively.
US10722979B2

A bonding method includes: an oxide-film forming step, on an irradiated surface, an oxide film having a film thickness corresponding to a first output and an irradiation time of an oxide-film-forming laser beam; a first reflected-laser-beam detection step of detecting a second output; a first absorptance computing step of computing a first absorptance for the oxide-film-forming laser beam; laser-beam switching step of switching the oxide-film-forming laser beam radiated onto the irradiated surface to a heat-bonding laser beam; and a heat bonding step of heating a first bonding surface until the temperature thereof reaches a predetermined bonding temperature, and bonding the first bonding surface to a second bonding surface.
US10722973B2

An ultrasonic welder includes dynamic adjustment of a weld parameter used to control welds of weld cycles during serial operation of the ultrasonic welder. The ultrasonic welder includes a power supply controlled by a controller and the controller sets a value of the weld parameter for a next weld cycle based on a value of a stack heat energy parameter indicative of heat energy in the ultrasonic stack prior to beginning the next weld cycle. The controller controls the power supply based on the value set for the weld parameter to control a weld in the next weld cycle.
US10722966B2

A support ring supports a welding ring to guide welding bugs around a coated pipe section. The support ring has a tubular body to support the welding ring, the body having substantially circular curvature around a longitudinal axis. At least one grounding extension connected to the body is offset longitudinally and radially outwardly with respect to the body and the longitudinal axis. This allows the grounding extension to lie radially outboard of a parent coating of the pipe section while the body encircles a cut-back end zone where the parent coating has been cut back. Pipe sections abutting end-to-end for welding can each be fitted with these support rings. This enables welding rings to encircle both of the cut-back end zones and allows effective grounding connections to be made without enlarging the cut-back end zones.
US10722956B2

An end mill includes an end mill body having a bar-shape extending along a rotation axis and including a first end and a second end, a side surface, a first end cutting edge, a second end cutting edge, a first peripheral cutting edge extending from the first end cutting edge, and a second peripheral cutting edge extending from the second end cutting edge. In which, L2 is smaller than L1, where L1 is a distance from the rotation axis to the first peripheral cutting edge, and L2 is a distance from the rotation axis to the second peripheral cutting edge in a cross section orthogonal to the rotation axis. And α2 is greater than α1, where α1 is a rake angle of the first peripheral cutting edge, and α2 is a rake angle of the second peripheral cutting edge.
US10722952B2

A container assembly for retaining a drill byproduct produced when drilling into a wall, the container assembly includes a container disposed on an internal side of the wall having an internal surface and an external surface. The container assembly also includes a sleeve that is disposed about the external surface of the container, the sleeve includes one or more magnets that couple the sleeve and container to the wall and retain the drill byproduct along the internal surface.
US10722938B2

The invention relates to a molding mixture for producing casting molds for metalworking, a process for producing casting molds, casting molds obtained by the process and also their use. To produce the casting molds, a refractory mold raw material and a binder based on water glass are used. A proportion of a particulate metal oxide selected from the group consisting of silicon dioxide, aluminum oxide, titanium oxide and zinc oxide is added to the binder, particular preference being given to using synthetic amorphous silicon dioxide. The molding mixture contains a phosphate as essential constituent. The use of phosphate can improve the mechanical strength of casting molds at high thermal load.
US10722937B2

Apparatus and methods for making a sand core in a core box are provided. According to one embodiment, the method includes introducing into a cavity of the core box a sand-binder mixture, the sand-binder mixture being introduced into the cavity through an inlet conduit of the core box. Pressurized air is then introduced into the cavity while a flow rate of the pressurized air is measured in a first air flow path upstream the core box. A control unit automatically alters the degree of opening of an electronically controlled flow regulator located in a second air flow path located downstream an outlet conduit of the core box depending on the measured flow rate to regulate the flow of pressurized air into the cavity of the core box.
US10722926B2

Disclosed is a supercritical-state cleaning system, comprising a cleaning chamber, a gas booster apparatus, a first heating apparatus, and a carbon dioxide supply apparatus. The cleaning chamber is separately connected to the first heating apparatus and the carbon dioxide supply apparatus. A vacuum pump set is connected to the cleaning chamber. Compared with the prior art, in the Invention, air introduced when a workpiece enters a cleaning chamber is completely removed, so as to prevent mixing of CO2 and air, thereby improving a cleaning effect.
US10722920B2

A delivery point sorting device with two feeders for receiving and forwarding mail in streams, where a diverging apparatus divert module is configured to process the mail from the two feeders and a merge module converges the streams of mail from the two feeders and distributes the mail to respective endpoints. Sorting endpoints are used for loading the mail received from this converging apparatus. A method where items of mail are sorted through sorting passes including a first, second, and third sorting pass. Sorting passes are; processing mail through two feeders by receiving the mail by the feeders and forwarding the mail articles in streams of mail, converging the streams of mail from the feeders to a conveyor apparatus, loading the mail at sorting endpoints by the conveyor apparatus, and sequentially passing the mail through the first, second, and third sorting pass.
US10722918B2

Methods, systems, computer-readable media, and apparatuses for high density Micro-Electro-Mechanical Systems (MEMS) are presented. In some embodiments, a method for manufacturing a micro-electro-mechanical device on a substrate can comprise etching a release via through a layer of the device. The method can further comprise creating a cavity in the layer of the device using the release via as a conduit to access the desired location of the cavity, the cavity enabling movement of a transducer of the device. The method can then comprise depositing low impedance, electrically conductive material into the release via to form an electrically conductive path through the layer. Finally, the method can comprise electrically coupling the electrically conductive material to an electrode of the transducer.
US10722914B1

A dispense tip constructed and arranged to communicate with a material dispensing pump comprises an elongated neck and a molded base having a first portion and a second portion opposite the first portion. The neck extends from the first portion of the base. The second portion is constructed and arranged to abut an outlet surface of the pump. An outermost region of the second portion of the base includes a compressible fluid-tight surface that compliantly conforms to the outlet surface when the dispense tip is mounted to the pump.
US10722912B2

A grit boot mask tool including an enclosure to receive at least a portion of a blade and a door. A lock assembly that retains the door to the enclosure. The lock assembly provides for rotating a latch to retain the door to the enclosure.
US10722906B2

A push-button switching shower head structure includes a shower head body, a water inlet seat, a button, a push rod, a push block, a return spring, a ratchet wheel, a water distribution disc, and an outlet disc. The button pushes the push rod to move, and the push rod drives the push block to move and drive the ratchet wheel to rotate, and then the ratchet wheel drives the water distribution disc to rotate synchronously to cooperate with the outlet disc to perform waterway switching. The shower head has the advantages of long service life and stable and reliable switching function by providing a guiding groove on the water inlet seat.
US10722905B2

A paint roller cover cleaner including an enclosure for a roller cover, a high pressure pump and a nozzle supplied with pressurised fluid which directs a jet of fluid at the nap of the roller cover to rotate the roller cover and facilitate cleaning. In one embodiment a carriage moves the nozzle along the length of the roller cover to effect cleaning along the length of the roller cover. In another embodiment a plurality of controllable nozzles are provided at intervals along the length of the roller cover. In another embodiment the nozzle includes an inner sleeve and an outer sleeve which relatively rotate to align apertures in the respective sleeves to produce jets sequentially along the nozzle.
US10722902B2

An apparatus, composition and method for recycling of a material, such as, for example, unhardened concrete. The apparatus includes a storage tank for storing a recycling composition to be applied to the material to be recycled and a control unit configured to control release of the recycling composition from the storage tank.
US10722901B2

The invention relates to a shredding device (1) used for picking apart compressed blocks (2) of loose-fill cellulose thermal insulation material. It comprises a chute (3) with a chute inlet (3a) configured to receive the insulation block (2). Further, it comprises a shredder (4) rotatable around a substantially horizontal axis (A), mounted at an outlet (3b) of the chute (3). The device (1) is characterized in that the rotatable shredder (4) is a cylinder with protruding grating pins (5) arranged on its mantel surface (4′), where the pins (5) have a length shorter than the radius of the cylinder and are adapted to grate, pick apart and fluff the insulation from the compressed block format (2) into a fluff material with an even density. Further, the invention relates to a method for picking apart loose-fill cellulose thermal insulation material compressed into a block (2).
US10722894B2

A tooth shroud for a demolition tool is disclosed wherein forces produced during demolition operations may be dissipated so as to avoid excessive forces at stress points. A tooth block for a demolition tool comprises a first tooth shroud and a second tooth shroud. The first and second tooth shroud each comprising a body having a front wall and an end wall wherein a cavity is enclosed by the front wall and the end wall; an impact member extending longitudinally from the body; and a cut-out disposed on the end wall, wherein the first tooth shroud is connected to the second tooth shroud.
US10722891B2

The present invention relates to a storage container for liquids, comprising a liquid-tight tank with an upwardly directed opening, wherein the opening is closed in a leaktight fashion by a protective film comprising an outer layer and an inner layer, wherein the outer layer is an aluminium foil and the inner layer is a plastic film, wherein the outer layer can be removed from the storage container separately from the inner layer, and wherein the inner layer can be pierced by a hollow needle; an assembly comprising at least two storage containers according to the invention; and a method for producing the assembly according to the invention, comprising the steps of providing at least two storage containers according to the invention, and applying a continuous layer of an adhesive film on the outer layers of the protective films of the at least two storage containers.
US10722889B2

A microfluidic apparatus, systems and methods for microfluidic crystallization based on gradient mixing. In one embodiment, the apparatus includes (a) a first layer, (b) a plurality of first channels and a plurality of vacuum chambers both arranged in the first layer, where the plurality of vacuum chambers are each coupled to at least one of the first channels, (c) a membrane having first and second surfaces, where the first surface of the membrane is coupled to the first layer, (d) a second layer coupled to the second surface of the membrane, (e) a plurality of wells and a plurality of second channels both arranged in the second layer, where the wells are each coupled to at least one of the plurality of second channels and (f) a plurality of barrier walls each disposed in the plurality of second channels and arranged opposite to one of the plurality of vacuum chambers.
US10722881B2

The present invention relates to a centrifugation device, a centrifugation method, and a separation container. More particularly, the present invention relates to a centrifugation device for separating substances from a body fluid and tissue using centrifugal force, the centrifugation device including: a separation container configured to receive, centrifuge, and clean a body fluid and tissue therein and rotate around a central rotation axis; a supply part connected to the separation container and configured to supply a cleaning solution to the separation container; a discharge part connected to the separation container and configured to receive substances separated by centrifugation; valves configured to control flows between the supply part, the discharge part, and the separation container; a driving device configured to rotate the separation container, the supply part, and the discharge part around the central rotation axis, the driving device being installed in a direction perpendicular to the separation container, the supply part, and the discharge part; and a controller configured to control an operation of the driving unit, wherein the separation container includes: a piston located outside in a radial direction based on the central rotation axis; and an elastic part placed on an outer side of the piston in the radial direction to push the piston in a direction opposite a centrifugal force direction.
US10722862B2

The present invention relates to zeolitic adsorbents based on small agglomerated crystals of zeolite X comprising barium, combining optimum properties in terms of selectivity and of mechanical strength.These adsorbents have applications in the separation of fractions of aromatic C8 isomers and in particular xylenes, in the separation of substituted toluene isomers, such as nitrotoluene, diethyltoluene or toluenediamine, in the separation of cresols and in the separation of polyhydric alcohols, such as sugars.
US10722861B2

Reactor systems for use with ionic liquid catalyst. The reactor systems include one or more stages, which include a reactor and a heat exchanger, and a separation zone. The reactor and the heat exchanger may have a vertical orientation. Additionally, a separation vessel may also include a vertical orientation. The heat exchanger may allow for linear flow of process fluid to control residence time.
US10722854B2

A sink is configured to attach to a bottom surface of a flowline that is configured to flow a mixture of at least two immiscible fluids. One of the immiscible fluids is water. The water is more dense than the other of the at least two immiscible fluids. An outlet formed at a bottom portion of the sink. A valve system is connected to the opening. The valve system is configured to open the outlet in response to the water occupying at least a portion of the sink.
US10722853B2

A static mixer for mixing a flow of two or more fluids is disclosed. The static mixer includes a mixing conduit that defines a mixing passage, and a mixing element configured to be received by the mixing passage that includes at least two mixing baffles. Each of the at least two mixing baffles comprises a plurality panels that are configured to divide and mix the fluid as the fluid flows through the mixing passage. No continuous sidewalls extend between the at least two mixing baffles, and the mixing element is tapered along a longitudinal direction.
US10722852B1

A method of using magnetic influence on flow streams of liquids and gases to over excite their atoms, break existing molecular bonds, and from two oppositely charged flow streams cause immediate and permanent bonding of oppositely charged ions to create a new molecular composition. While magnetic influence is predominately responsible for the molecular reorganization produced, induced turbulence disrupts a tendency for laminar flow in the flow streams, creating more chaotic movement and molecule collisions in liquids/gases used and a more complete result. Mixing of the two oppositely charged flow streams is preferred via a venturi. Magnetic influence on flow streams can be applied more than once. Using this method with water having a molecular composition of H2O in a primary flow stream and ozone gas in a secondary flow stream, and mixing of the oppositely charged flow streams using a venturi, a new molecular composition of H2O5 can be created.
US10722840B2

Methods and apparatus for treating an exhaust gas in a foreline of a substrate processing system are provided herein. In some embodiments, a method for treating an exhaust gas in an exhaust conduit of a substrate processing system includes: flowing an exhaust gas and a reagent gas into an exhaust conduit of a substrate processing system; injecting a non-reactive gas into the exhaust conduit to maintain a desired pressure in the exhaust conduit for conversion of the exhaust gas; and forming a plasma from the exhaust gas and reagent gas, subsequent to injecting the non-reactive gas, to convert the exhaust gas to abatable byproduct gases.
US10722838B2

A carbon dioxide absorbent of an embodiment includes a solid resin compound containing a structural unit expressed by the following formula (1). X in the formula (1) is a halogen element.
US10722834B2

The present application relates to a functional fiber for adsorbing heavy metal and a method for producing the same, and the functional fiber for adsorbing heavy metal of the present application may have a structure in which thiolated metal nanoparticles are attached to a porous fiber, thereby minimizing the pore clogging of the porous fiber to remarkably improve the adsorption capacity of heavy metal materials, may be prepared by applying the dry technology without liquid impregnation, thereby minimizing the pore clogging of the porous fiber and fundamentally blocking the process wastewater generation, and is easy to implement the roll-to-roll system, so that continuous production is possible and thus productivity may be improved.
US10722833B2

A process is described for removing halogen compounds, particularly chlorine compounds, from a process fluid, comprising the steps of (i) passing a process fluid containing hydrogen halide over a first sorbent to remove hydrogen halide and generate a hydrogen halide depleted process fluid and then, (ii) passing the hydrogen halide depleted process fluid over a second different sorbent to remove organic halide compounds therefrom. A purification system suitable for removing hydrogen halide and organic halide compounds from process fluids is also described.
US10722828B2

A portable drinking water filter system, such as a pitcher, having a sleeve and a floatable body including a filter opening configured to receive a water filter, the floatable body having a seal extending outward from an outer surface of the floatable body. The floatable body is disposed in a sleeve cavity such that a body seal engages the sidewall and restricts water from passing between the floatable body and the sidewall. The seal is configured to create friction with the sidewall, wherein the friction created when the floatable body rises in the sleeve is different than when the floatable body lowers in the sleeve. The friction created when the floatable body rises in the sleeve is greater than when the floatable body lowers in the sleeve, allowing the floatable body to auto-retract toward a cavity base without burping.
US10722826B2

A filter assembly may include a canister and a filter element received in the canister. The filter element may include filter media configured to promote separation of a first fluid from a second fluid having different characteristics than the first fluid as fluid passes through the filter media. The filter element may further include a first end cap, a second end cap, and a tubular member extending between the first and second end caps. The filter assembly may further include a flow cap associated with the first end cap of the filter element. The flow cap may include an inlet portion configured to provide flow communication between an inlet port of a filter base and the tubular member of the filter element, and an outlet portion configured to provide flow communication between an outlet port of the filter base and an exterior portion of the filter element.
US10722823B2

A vented baffle system is formed of a plurality of individual panel members, for use in a clarifier tank. The vented baffle system includes a plurality of inter-engaged individual panel members with each baffle having a unitarily integrated design. The panel members each may have one or more relief conduits directed to the center of the tank away from the vertical side wall.
US10722821B2

A transportable separation apparatus for separating spent materials from oil and gas operations into a primarily solid component, a primarily liquid component and a primarily gas component. The transportable separation apparatus includes a first separation unit disposed on the transportable separation apparatus for receiving spent materials and beginning separation of the spent materials. The transportable separation apparatus connectable to a vehicle to be pulled on commercial roadways when the transportable separation apparatus is in a transportation configuration. The transportable separation apparatus further includes a second separation unit in fluid communication with the first separation unit for further separation of the spent materials. A method of using the transportable separation apparatus to separate spent materials.
US10722820B2

The present invention relates to a gas/liquid separator. According to an aspect of the present invention, provided is a gas/liquid separator, including a housing including a first supply part and a second supply part; a rotary shaft rotatably provided to the housing; a drive unit configured to rotate the rotary shaft; fixed cones disposed in an interior of the housing and each including a tilted area, diameters of which are decreased in a direction from the first supply part to the second supply part, a first through-hole, which passes the rotary shaft, and at least one second through-hole, through which a second fluid introduced via the second supply part passes; and rotary cones disposed in an interior of the housing so as to be spaced apart from the fixed cones and installed at the rotary shaft so as to rotate about the rotary shaft.
US10722816B2

The invention relates to a method for setting a gradient delay volume GDV of a liquid chromatography system for a chromatography run in liquid chromatography, in particular a high-performance liquid chromatography system, in which a desired value GDVtarget of a gradient delay volume of the liquid chromatography system is ascertained or predefined and, if the value GDVtarget deviates from a specific fixed value GDVactual of a liquid chromatography system, this value GDVtarget is set in a range 0≤ΔGDV=GDVtarget−GDVactual≤Vmax of a volume of a volume adjustment device 5. Furthermore, the invention relates to an automatic sampler for carrying out such a method.
US10722815B2

A system and method for extraction of cannabis oil from cannabis plant materials by further reducing the temperature of the extraction system effluent, which may be a mixture of solvent, the desired cannabinoids, and/or the undesired non-polar extracted waste from the plant material. This invention improves the extraction process by: 1) enhancing the rapid filtering of the waste material from the process stream, speeding up the overall process, and 2) improving the quality of the product, yielding a purer extract as evidenced, in part, by its lighter (yellow/gold) color as compared to less-pure green/brown extracts.
US10722814B2

Continuous extraction units (CEUs) are constructed that allow switching of extraction chambers (ECs) that contain extractable material (EM) and extract solution. Extraction chambers can be removable and replaceable, where the CEU has a fluid flow portion and a liquid transfer portion. Quick-connect valves allow exchange of ECs in the CEU while under flow without solvent loss. Alternatively, the CEU employs pairs of ECs where a first EC at equilibrium partitioning of an extract solution drains to an expansion chamber (EXC) with an expansion valve (EV) and a heat transfer tube situated proximal to or shared with a solvent condenser (SC) to form of a double phase change heat exchanger (HE). Solvent from the SC fills a paired EC containing EM. A second pair of ECs has a first EC with EM and solvent establishing equilibrium and a second EC that is emptied of spent EM, filled with fresh EM, and readied to receive solvent.
US10722806B2

A ride system includes a tunnel, a vehicle ride path, a ride vehicle, and a projection system. The tunnel includes a first end and a second end and is curved between the first and second ends. The vehicle ride path extends within the tunnel from an entrance at the first end of the tunnel to an intermediate position within the tunnel. The second end of the tunnel is not visible from the intermediate position. The ride vehicle travels along the vehicle ride path and decelerates as the ride vehicle approaches the intermediate position. The projection system projects images onto one or more walls of the tunnel, such that the images are synchronized with the deceleration of the ride vehicle and a perceived speed of the ride vehicle, as perceived by a guest in the ride vehicle, exceeds an actual speed of the ride vehicle.
US10722805B1

Embodiments disclosed herein include an amusement park ride. The amusement park ride include a ride vehicle that can transition from a first configuration to a second configuration during the duration of the ride. The amusement park ride can include a loading area for loading passengers into the ride vehicle and a separate unloading area for disembarking passengers from the ride vehicle. After disembarking passengers from the ride vehicle the ride vehicle travels to a transition area concealed from the public where the ride transitions from the second configuration to the first configuration. In the transition area, maintenance can be performed on the ride vehicle and calibration can be performed on one or more of the ride vehicle systems (e.g., projector or audio systems).
US10722795B2

A non-limiting example game apparatus includes a display device, and a game screen is displayed on the display device. A play image including a player character, an enemy character, a ground object, a block object and a clay pipe object, for example is displayed as a game screen. If a capture instruction is input during a game play, image data corresponding to a play image at a time of input is acquired as captured image data. In the game apparatus, a reduced image of a captured image is generated and displayed in a manner superimposed on the play image. During game control processing is performed, processing that generates and displays the reduced image is performed.
US10722790B2

A command server outputs information related to a screen rendering command and transmission destination information to a rendering server, in which at least some of rendering resources required when performing rendering of a screen in accordance with the information related to the rendering command are loaded, among a plurality of rendering servers associated with the command server. Then, the rendering server reads the rendering resources from the required rendering resources that are still not loaded to load them into the loading region to hold them, performs the rendering of the screen based on the information related to the rendering command, and transmits it to a target client terminal.
US10722787B2

A hand operated game controller for controlling a game console. Multiple push buttons are arranged on the surface of the game controller. The push buttons are placed in an arrangement that approximately matches the natural position of the fingers of the user's hands. As the user presses the buttons, control signals are sent from the buttons to the game console via wiring.
US10722782B2

A multiple rhombic dodecahedron puzzle includes a plurality of wooden puzzles arranged in a multiple rhombic dodecahedron. The multiple rhombic dodecahedron is equivalent to a cube formed by a plurality of rhombic dodecahedrons connecting to each other. Each of the wooden puzzles includes two unit elements. The two unit elements are connected to each other and are the same others. Each of the two unit elements has a plurality of surfaces. Each of the surfaces has a diamond shape or a triangular shape. Two of the surfaces which in the triangular shape are connected to each other in order to form a concave shape, and the surfaces are surrounded to form a closed space.
US10722778B1

A self-balancing vehicle includes a vehicle body having a housing with a top cover and a bottom cover. It includes a unitary support bar disposed between the top and bottom covers, about which the top and bottom covers are mounted, and which extends entirely along the top and bottom covers between opposed left and right ends of the unitary support bar. The vehicle includes a left drive wheel and an opposed right drive wheel, each indirectly coupled to the unitary support bar. The vehicle further includes a battery electrically coupled to the left and right drive wheels, wherein the battery includes a central depression receiving the unitary support bar and spacing apart two opposed lobes of the battery about the unitary support bar.
US10722774B2

A youth football sled assembly for training youth in American football tackling and blocking includes a sled that is positioned on a training field. The sled is comprised of tubular members such that the sled has no sharp edges to enhance safety for youth employing the sled for training American football tackling and blocking. A cushion is removably positioned on the sled and the cushion is pushed against by the youth during training. A plurality of weights is each selectively positioned on the sled for increasing a weight of the sled.
US10722770B1

A precision real-time laser measurement and marking apparatus is provided. the disclosure also relates to the multiple components of the precision real-time laser measurement and marking apparatus in accordance with an embodiment of the present disclosure. The multiple components of precision real-time laser measurement and marking apparatus are as follows: the main housing; the foam spray can; the universal clip; and the fully assembled precision real-time laser measurement and marking apparatus. A method of using a precision real-time laser measurement and marking apparatus is provided. The method comprising pressing a distance measurement button while aiming an apparatus at a target; displaying an exact distance measurement on a LED screen wherein the exact distance measurement is the distance between the target and the apparatus; determining the exact distance measurement matches a desired distance; and marking a distance boundary using a spray nozzle of the apparatus.
US10722768B1

The disclosure relates to a golf putter head and a golf putter including the putter head. The golf putter head comprises a putter head having a hitting face on which a hitting unit is distributed. The rigidity of the hitting unit is increased from the middle to both sides in the width direction of the hitting face. The golf putter comprises a putter shaft and a putter head coupled to putter shaft.
US10722767B2

A forged golf club face has a continuous outer layer of a first material encasing at least one inner layer made of second material. The materials may have differing properties, such as Young's Modulus, density, and strength properties, among others. By incorporating the different materials into the outer layer and the inner layer, the coefficient of restitution (COR) of the golf club face is improved without sacrificing durability. The club face is forged from a pre-formed billet having at least one monolithically encased inner layer.
US10722766B1

A multiple-material golf club head with a resilient crown structure and an improved, graphene-infused coating is disclosed herein. The crown comprises a metal support structure that is attached to the body of the golf club head and supports a composite outer layer. The golf club head is also at least partially coated with a paint film that is infused with graphene particles.
US10722763B2

It is an object of the present invention to provide a golf club head being lightweight and having a high strength. A head 2 includes a face 4, a sole 8, and a crown 6. The face 4 includes a face surface fs and a face back surface fr. A plurality of projections (A) are provided on the face back surface fr. The projections (A) are point-like in a planar view. An optional first direction and a second direction orthogonal to the first direction are defined in the planar view. Preferably, arrangement regularity of the projections (A) in the second direction is higher than arrangement regularity of the projections (A) in the first direction. Preferably, the first direction is a longitudinal direction; and the second direction is a lateral direction.
US10722762B2

Embodiments of a golf club head having a body comprising a first material and a strike face comprising a second material, wherein the density of the first material is greater than the density of the second material, and the ratio of the density of the first material to the density of the second material is greater than or equal to approximately 1.7 are described herein.
US10722753B2

The present invention provides a method for arranging dimples on a golf ball surface in which the dimples are arranged in a pattern derived from at least one irregular domain generated from a regular or non-regular polyhedron. The method includes choosing control points of a polyhedron, generating an irregular domain based on those control points, packing the irregular domain with dimples, and tessellating the irregular domain to cover the surface of the golf ball. The control points include the center of a polyhedral face, a vertex of the polyhedron, a midpoint or other point on an edge of the polyhedron and others. The method ensures that the symmetry of the underlying polyhedron is preserved while minimizing or eliminating great circles due to parting lines.
US10722745B2

Systems and methods for a muscle signal-driven cycling system for persons with disability for rehabilitation are provided. A system comprises integrating both motor power and muscle power to facilitate rehabilitation cycling-based exercises. By using the intensity of real-time muscle activity signals as inputs, a motor applies either assistive or resistive force to rotate a gear at different speeds to facilitate or impede the cycling motion, and the electrical pulses from an electrical stimulation device can be provided to stimulate target muscles to generate muscle contraction to support the continuous cycling movement.
US10722738B2

An improved safety system in accordance with the disclosed and claimed concept connects directly with the rail and advantageously provides both a fall resistance apparatus as well as a fall protection apparatus. The fall resistance apparatus provides a support that is movably situated on the rail and that can be manually grasped by the worker during the maintenance operation and which provides physical support in all directions to the worker. The fall resistance apparatus thus resists the likelihood that a fall will occur. In the unlikely event of a fall, the fall protection apparatus connects the worker directly to the rail and supports the worker from the rail at a location spaced above the floor, thus protecting the worker from injury in the event of a fall.
US10722736B2

A proton beam therapy system with a cantilever gantry. The cantilever gantry has one end portion (the fixed end portion) affixed to an external structure that supports the weight of the gantry. The remainder of the gantry is suspended and the free end portion is coupled to a beam nozzle. A main bearing is coupled to the fixed end portion and enables the gantry to rotate in a full range of 360° around the iso-center. A large counterweight can be disposed in the fixed end portion to keep the system center of mass close to the bearing. The gantry may have a monocoque housing, including a cantilever section enclosing the magnets and other components of the gantry beamline and a drum section on which the bearing is placed.
US10722732B2

A multi level multileaf collimator employs leaves with leaf tips having a non-square shape in a beam's eye view to improve beam shaping effect and penumbra performance. The multi level multileaf collimator includes a first multileaf collimator in a first level comprising beam blocking leaves longitudinally movable in a first direction, and a second multileaf collimator in a second level comprising beam blocking leaves longitudinally movable in a second direction. The first direction may be generally parallel with the second direction and the leaves of the first multileaf collimator may laterally offset the leaves of the second multileaf collimator. The beam blocking leaves of the first multileaf collimator may comprise an end portion having a non-square shape in a beam's eye view.
US10722716B2

The present disclosure provides for a method for treating a patient in which a catheter having an electrode array is moved through the pulmonary trunk of the patient towards a branch point that helps to define the beginning of a left pulmonary artery and a right pulmonary artery of the heart. The electrode array is positioned in the right pulmonary artery where the electrodes contact a posterior surface, a superior surface and/or an inferior surface of the right pulmonary artery. The one or more electrodes can be positioned to contact the posterior surface, the superior surface and/or the inferior surface of the right pulmonary artery at a position superior to the branch point. The electrode array can also be positioned in the right pulmonary artery no more than three times the diameter of the pulmonary trunk to the right of the branch point.
US10722711B2

A device is provided for the stimulation of neurons that includes a non-invasive stimulation unit to generate stimuli in multiple stimulation channels, where the stimulation unit stimulates a neuron population in the brain and/or spinal cord of a patient in different locations for each of the stimulation channels. Moreover, the device includes a control unit that controls the stimulation unit to generate repetitive bursts in each of the stimulation channels, where each of the bursts includes multiple stimuli and is designed so that they do not reset the phase of the neuronal activity of the respective stimulated neurons.
US10722710B2

A device operates for secretion clearance and cough assistance by means of transdermal stimulation of muscle groups including the pectoralis majoris, the serratus anterior, and the abdominal muscles. The various muscle groups may be stimulated in different ways: not just different pulse trains but in addition, different stimulations to accomplish different phases of clearance or cough assistance. In a first phase a vibration action provided by the muscles (for example the pectoralis and serratus) is used to encourage the motion of mucus and other secretions within airways. In a second phase, the abdominal muscles for example might be stimulated differently so as to cause not a vibration but instead a coughing action, especially to detect and assist a natural cough. The invention further teaches a zone stimulator large enough to span and stimulate major muscles or groups of large muscles effectively.
US10722709B2

A method to treat a patient having a pelvic floor dysfunction or overactive bladder disorder by establishing a neurostimulator having a processor and an electrical signal generator to generate a stimulation signal. The processor is set to one or more parameters effective in the treating of the patient's pelvic disorder or dysfunction including overactive bladder disorder when the stimulation signal is applied to a saphenous nerve of the patient. The neurostimulator is configured to provide the stimulation signal to a stimulator in accordance with a stimulation protocol. At least one stimulator is positioned next to a portion of the saphenous nerve of at least one lower limb of a patient. The processor is operationally activated to provide the stimulation signal to the stimulator for treatment of the patient.
US10722706B2

An EMI/energy dissipating filter for an active implantable medical device (AIMD) is described. The filter comprises a first gold braze hermetically sealing the insulator to a ferrule that is configured to be mounted in an opening in a housing for the AIMD. A lead wire is hermetically sealed in a passageway through the insulator by a second gold braze. A circuit board substrate is disposed adjacent the insulator. A two-terminal chip capacitor disposed adjacent to the circuit board has an active end metallization that is electrically connected to the active electrode plates and a ground end metallization that is electrically connected to the at least one ground electrode plates of the chip capacitor. There is a ground path electrically extending between the ground end metallization of the chip capacitor and the ferrule. The ground path comprises at least a first electrical connection material connected directly to the first gold braze, and at least an internal ground plate disposed within the circuit board substrate with the internal ground plate being electrically connected to both the first electrical connection material and the ground end metallization of the chip capacitor. An active path electrically extends between the active end metallization of the chip capacitor and the lead wire.
US10722703B2

Systems and methods for deploying a paddle neurostimulation lead configured to provide DRG stimulation within a patient. A DRG therapy system includes a delivery tool includes a delivery tube including a first linear segment, a second linear segment, and an arcuate segment coupled between the first and second linear segments, the first and second linear segments having an angle therebetween and the second linear segment defining an elongated opening. The delivery tool further includes a stylet positioned within an interior of the delivery tube, and a handle coupled to the delivery tube and including a stylet actuation mechanism configured to selectively advance and retract the stylet between a deployed position and a retracted position, wherein the stylet extends across the elongated opening in the deployed position to engage an engagement member of the paddle neurostimulation lead.
US10722697B2

The disclosure relates to a skin piercing tool for locally puncturing a human or an animal skin, comprising a piercing needle, which is embodied as solid needle, in the case of which a needle body has a proximal needle section and a distal needle section, in which a piercing tip is arranged, wherein the needle body has a needle section, which is resilient against the piercing tip in response to a compressive stress, wherein the resilient needle section is arranged on the needle body in the area of an angled needle section, in which adjacent needle sections assume an angle of less than 180° with one another. Further, a hand-held device for repeated local puncturing of a human or an animal skin is provided.
US10722681B2

A dialysis catheter includes an entirely subcutaneous first section, with an exterior interface via penetration of the overlying subcutaneous skin layer. In addition the first section of the dialysis catheter includes a detachable portion that enables insertion via a guidewire instead of a peel-away sheath. The dialysis catheter has a layered design that minimizes risk of infection.
US10722666B2

A nebulizer includes a replaceable container with fluid to be nebulized. The container includes an inseparable indicator device. The container and the indicator device are axially moved during nebulization and tensioning of the nebulizer. The indicator device controls locking of the nebulizer against further use if a predetermined number of uses has been reached or exceeded.
US10722661B2

A medical remote controller device is disclosed. The device includes a display and at least one input switch dedicated to bolus delivery wherein a bolus delivery is programmed when the input switch receives an input and wherein the number of inputs received by the input switch determines the amount of bolus to be delivered.
US10722658B2

A reusable medication delivery device that can determine medication remaining in a simple fashion. The device includes a first sensor (200) for sensing when a cartridge is mounted in the device, and at least one second sensor for sensing a retraction of a drive member (160) that engages a cartridge plunger (132). The device includes a controller that determines, based on inputs from the first sensor and the at least one second sensor, that a newly installed cartridge is to be considered full or not full of medication. The controller calculates, after a medication delivery and based on an input from a means for determining an amount of medication delivered by operation of a dose delivery mechanism, and if the cartridge was considered full when newly installed, a quantity of medication remaining in the installed cartridge after the medication delivery.
US10722656B2

The invention relates to a piston rod drive arrangement for an injection device used for self-administration of a plurality of individually set doses. The drive arrangement is made from a first element (10) mating the non-circular cross-section (3) of a piston rod (1) and a second element (20) having an inner thread (21) mating the outer thread of the piston rod. Whenever the first element (10) and the second element (20) are rotated in relation to each other the piston rod (1) is moved in an axial direction. In order to minimise the play in the threaded connection a resilient element (23) is proved to apply a force to the piston rod (1) in a longitudinal direction.
US10722641B2

An IV line identification system to enable ready identification of an IV line and its associated fluid source and output and to enable distinguishing the IV line from other IV lines and their fluid sources and outputs. The IV line identification system includes a first light source and a second light source communicatively coupled to one another via a wireless connection. The light sources are configured such that when one is activated so as to generate a light signal, the other is automatically activated to generate a corresponding light signal. Each light source may be placed on opposite ends of an IV line to enable ready identification of each end of the same IV line.
US10722639B2

The present invention relates to a method of removing blood from an extracorporeal blood circuit following termination of a blood treatment session, wherein blood is concurrently removed both from an arterial conduit portion and from a venous conduit portion of the extracorporeal blood circuit. It further relates to a method for recognizing and/or eliminating air inclusions in or from an extracorporeal blood circuit and a treatment apparatus as well as a tube system.
US10722638B1

The invention relates to a method to prevent contrast-induced nephropathy during an imaging procedure. The method includes steps of positioning balloon catheters in a patient's renal arteries and renal veins and inflating the balloons of each catheter to block the flow of contrast media into the patient's kidneys.
US10722636B2

Systems and methods for the performance of kidney replacement therapy having or using a dialyzer, control components, sorbent cartridge and fluid reservoirs configured to be of a weight and size suitable to be worn or carried by an individual requiring treatment are disclosed. The system for performing kidney replacement therapy has a controlled compliance dialysis circuit, where a control pump controls the bi-directional movement of fluid across a dialysis membrane. The dialysis circuit and an extracorporeal circuit for circulating blood are in fluid communication through the dialysis membrane. The flux of fluid moving between the extracorporeal circuit and the dialysis circuit is modified by the rate at which the control pump is operating such that a rate of ultrafiltration and convective clearance can be controlled. The system provides for the monitoring of an inlet and outlet conductivity of the sorbent cartridge to provide a facility to quantify or monitor the removal of urea by the sorbent cartridge.
US10722633B2

Systems and related methods for supplying power to a medical device employ self-charging serially-connectable portable batteries. A system includes a base module and external battery modules. The base module is operatively coupled with the medical device and includes a base module input connector. Each of the external battery modules includes one or more battery cells, an output connector, an input connector, and a controller. The output connector is configured to output electrical power from the external battery module. The input connector is configured to receive electrical power from another of the plurality of external battery modules. The controller is operatively coupled with the one or more battery cells, the output connector, and the input connector. The controller is configured to control distribution of electrical power received via the input connector to charge the one or more battery cells and/or to be output via the output connector.
US10722632B2

Methods, systems, and devices for a mechanical circulatory support system are disclosed herein. An implantable power supply can be part of a mechanical circulatory support system. The implantable power supply can include one or several energy storage components, a power source, a voltage converter, and an output bus. Power can be provided to the voltage converter from one or both of the power source and the first energy storage component. The voltage converter can convert the voltage of the power from a first voltage to a second voltage and can power the output bus.
US10722622B2

A device for intrauterine vacuum therapy includes a pear-shaped fluid-collecting element and a fluid-communicating element. The fluid-collecting element defines an inlet opening at the proximal end and a tubular cavity for receiving a removable guide-rod during transvaginal insertion into a uterine cavity. The fluid-communicating element has a perforated distal end fixed within the fluid-collecting element outside the tubular cavity and has a proximal end adapted for connection to a vacuum-generating system. A method of treating an intrauterine wound or infection includes transvaginally inserting a drain into a uterine cavity and applying a negative pressure to the drain such that the uterus collapses and the inner wall is aspirated against the drain.
US10722621B2

An exemplary embodiment comprises an illuminated suction device having a distal end with a suction tip; a proximal end with a connector for a suction tube; and an illumination assembly comprising at least one light source, at least one battery and an activation device for energizing the light source, the illumination assembly being permanently attached to the suction device.
US10722611B2

Adhesive compositions and patches, and associated systems, kits, and methods, are generally described. Certain of the adhesive compositions and patches can be used to treat tissues (e.g., in hemostatic or other tissue treatment applications), according to certain embodiments.
US10722608B2

The present disclosure is directed to blood dotting compositions comprising platelet microparticles, method of using said compositions, and methods of preparing the same.
US10722601B2

A compound having the formula of tetragadolinium [4,10-bis(carboxylatomethyl)-7-{-3,6,12,15-tetraoxo-16-[4,7,10-tris(carboxylatomethyl)-1,4,7,10-tetraazacyclododecan-1-yl]-9,9-bis({[{2-[4,7,10-tris(carboxylatomethyl)-1,4,7,10-tetraazacyclododecan-1-yl]propanoyl} amino)acetyl]amino}methyl)-4,7,11,14-tetraazaheptadecan-2-yl}-1,4,7,10-tetraazacyclo dodecan-1-yl]acetate wherein the stereochemistry at the chiral carbon of the four alanine substituents is selected from the group consisting of RRRR, SSSS, RSSS, RRSS, and RRRS stereoisomers, and racemic and diastereomeric mixtures of any thereof, or a tautomer, a hydrate, a solvate, or a salt thereof, or a mixture of same is described. The compounds may be used as an MRI contrast imaging agent.
US10722600B2

The present invention relates to the use of NS1/2 region of murine norovirus MNV or a corresponding region from a member of the Caliciviridae family or a protein encoded by any one of those regions, for treating dysbiosis, immune system dysregulation and various disorders, as well as for enhancing mucosal integrity and stimulating IFN-induced genes.
US10722589B2

The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amino acid sequence of (c), wherein the identity determination excludes amino acid position (X6) and provided that the amino acid sequences EVMSTTA (SEQ ID NO: 20) in amino acid positions 12 to 18 of SEQ ID NO: 19 and SQSPH (SEQ ID NO: 21) in amino acid positions 31 to 35 of SEQ ID NO: 19 are conserved and the amino acids Q and Yin amino acid positions 37 and 38 of SEQ ID NO: 19 are conserved.
US10722584B2

The present invention relates generally to the field of flavan-3-ols. In particular, the present invention provides a way to increase the bioavailability of flavan-3-ols. Embodiments of the present invention relate to the use of at least one polyphenolic compound in a composition comprising at least one flavan-3-ol for increasing the bioavailability of said flavan-3-ol, wherein the at least one polyphenolic compound is selected from a group consisting of flavonols, flavones, isoflavones, flavanones, or combinations thereof.
US10722582B2

The present application relates generally to a method and a composition matter that provides a rapid and potent antimicrobial photodynamic inactivation (aPDI) of pathogenic bacteria that express high-affinity cell-surface hemin receptors (CSHRs) using Ga(III)-protoporphyrins IX (GaPpIX or Ga-PpIX). The invention provides an effective treatment option for infections of skin or body cavities that are accessible to visible-light irradiation, such as a handheld LED array emitting visible light (405 nm), especially for infections caused by Staphylococcus aureus, Methicillin-resistant Staphylococcus aureus (MRSA), pathogenic staphylococci, Streptococcus mutans, S. pneumoniae, S. pyogenes, streptococci, corynebacteria, mycobacteria, and Bacillus anthracis.
US10722574B2

The present invention relates to beta-glycolipid derivatives, their preparation and use as adjuvants in vaccines, as being suitable for being co-administered with antigens for vaccine prophylaxis and therapy. In certain embodiments, the beta-glycolipid derivatives of the invention also in their salified or complex form, are suitable for being co-administered with antigens for both therapeutic and prophylactic purposes or for vaccine prophylaxis and therapy.
US10722564B2

The present application relates to arenaviruses with rearrangements of their open reading frames (“ORF”) in their genomes. In particular, described herein is a modified arenavirus genomic segment, wherein the arenavirus genomic segment is engineered to carry a viral ORF in a position other than the wild-type position of the ORF. Also described herein are trisegmented arenavirus particles comprising one L segment and two S segments or two L segments and one S segment. The arenavirus, described herein may be suitable for vaccines and/or treatment of diseases and/or for the use in immunotherapies.
US10722552B1

A method of treating ASD (autism) in a patient in need thereof comprises administering a botulinum toxin to the patient. The botulinum toxin may be administered by subcutaneous/intradermal injection. The subcutaneous/intradermal injection may be administered to and/or around the vicinity of a trigeminal nerve, a cervical nerve, a thoracic nerve, a lumbar nerve, and a sacral nerve of the patient. In infants or toddlers—from about 1 to 5 year olds, it is used to prevent or minimize damage to the developing brain; in older children and adult Autism Spectrum Disorder (ASD) patients, it will be used to reduce or eliminate their symptoms.
US10722551B2

The invention relates to polypeptides that comprise a portion of filamentous bacteriophage gene 3 protein (g3p) sufficient to bind to and/or disaggregate amyloid, e.g., the N1-N2 portion of g3p and mutants and fragments thereof, wherein that g3p amino acid sequence has been modified through amino acid deletion, insertion or substitution to remove a putative glycosylation signal. The invention further relates to such polypeptides that are also modified through additional amino acid substitution to be substantially less immunogenic than the corresponding wild-type g3p amino acid sequence when used in vivo. The polypeptides of the invention retain their ability to bind and/or disaggregate amyloid. The invention further relates to the use of these g3p-modified polypeptides in the treatment and/or prevention of diseases associated with misfolding or aggregation of amyloid.
US10722537B2

Provided herein are methods of treating cancer by activating resident memory T cells using one or more antigenic peptides.
US10722532B2

One aspect of the invention provides polymer conjugated MetAP2 inhibitors. While not being bound by any particular theory, it is believed that coupling the MetAP2 inhibitory core via the linkers described herein provides compounds with superior efficacy to the parent small molecules and superior pharmacokinetic profiles. In one aspect of the invention, the polymer conjugated MetAP2 inhibitors are useful in methods of treating disease, comprising administering to a subject in need thereof a therapeutically effective amount of a polymer conjugated MetAP2 inhibitor.
US10722531B2

Improved methods for treating cancer are provided herein by determining if a cancer patient, particularly a colon cancer patient or a gastric cancer patient, will clinically respond in a favorable manner to a therapeutic strategy comprising the FOLFOX regimen (fluorouracil, leucovorin, and oxaliplatin) or a combination of capecitabine and cisplatin. Diagnostic methods for measuring the OPRT, TYMP, and/or UCK2 proteins in a tissue sample, such as a tumor sample, from the patient are provided.
US10722528B2

Calprotectin inhibitors and derivatives thereof, and methods of using them for inhibiting or reducing metastatis and treating cancer are provided. The pharmaceutical formulations prepared from the compounds can be used in the treatment of cancer either as a single agent or in combination with at least one other cancer therapeutic, chemotherapeutic or anti-cancer agent.
US10722523B2

The invention provides a method for treating cancer in a subject in need thereof, wherein said subject comprises cancer tissue that ‘contains epithelial cancer cells and immunosuppressive 8 cells, and wherein said method comprises administering to said subject a therapeutically effective amount of a) one or more first composition that pauses—immunogenic eel’ death and/or of said epithelial cancer cells, and b) one or more second composition that reduces one or both of the number and function of said immunosuppressive B cells in said cancer.
US10722511B2

An extended release composition for an analgesic active pharmaceutical ingredient which may be an opioid, preferably hydrocodone as the only active ingredient. The extended release composition preferably comprises a extended release composition which may be in the form of beads contained in an oral dosage form such as gelatin capsules. The composition is designed to release hydroccodone in a way such that the increase in hydrocodone exposure in hepatically impaired patients is not clinically significant. The oral dosage units are supplied as part of a kit, which also includes a primary package and a package insert all sold as a commercially marketed product. The primary package and package insert are contained in an optional secondary package and the package insert does not contain a warning, a dosing instruction, or a dosing table specifically directed to patients suffering from mild, moderate or severe hepatic impairment, and preferably explicitly states that dosing adjustment is not required for mild or moderate hepatic impairment.
US10722506B2

In one aspect, a method of treating a disorder associated with chronic inflammation includes administering to an individual in need thereof a therapeutically effective amount of isomyosmine or a pharmaceutically acceptable salt thereof. In some aspects, the disorder is a cancer, an autoimmune disorder, hypertension, or autism. In other aspects, isomyosmine is administered to treat viral infections or disorders associated with elevated levels of hydrogen peroxide and/or other Reactive Oxygen Species (ROS).
US10722501B2

The present application relates to novel substituted 5,6,7,8-tetrahydro[1,2,4]triazolo[4,3-a]pyridin-3(2H)-ones and 2,5,6,7-tetrahydro-3H-pyrrolo[2,1-c][1,2,4]triazol-3-ones of formula (I), to processes for preparation thereof, to the use thereof, alone or in combinations, for treatment and/or prophylaxis of diseases, and to the use thereof for production of medicaments for treatment and/or prophylaxis of diseases, especially for treatment and/or prophylaxis of lung inflammation disorders.
US10722500B2

A gossypol 7-N-isatin Schiff base compounds compound with antitumor activities represented by formula I: is disclosed. In formula I, R is hydrogen, alkyl, cycloalkyl, alkoxy, unsubstituted or substituted phenyl, or substituted or substituted benzyl. A method of preparing the compound of formula I is also disclosed.
US10722498B2

The present invention provides a stable, ophthalmic aqueous composition for topical administration comprising acetazolamide and an aqueous liquid capable of forming a pharmaceutically acceptable gel in situ when applied topically to a patient, said composition has the pH of less than 4.5.
US10722495B2

Disclosed are compounds of Formula (I), methods of using the compounds for inhibiting HPK1 activity and pharmaceutical compositions comprising such compounds. The compounds are useful in treating, preventing or ameliorating diseases or disorders associated with HPK1 activity such as cancer.
US10722491B2

The present invention relates to Chemistry, Pharmaceutical and in particular to the preparation of formulations from derivatives of phenolic or polyphenolic compounds and from derivatives of phenolic or polyphenolic compounds combined with tricyclic systems of the benzodiazepine type fused to derivatives of 1,4-dihydropyridines with action on the Central Nervous and Vascular Systems.These pharmaceutical compositions exhibit GABAergic, antiglutamatergic, calcium channel modulating, mitoprotective, anti-oxidant, anti-inflammatory, and antiapoptotic action, usable in the treatment of cardiovascular, cerebrovascular, neurodegenerative, neuropsychiatric and neurological diseases.
US10722485B2

In various embodiments, the present invention provides compositions and methods for treating and/or preventing cardiovascular-related diseases in subject in need thereof.
US10722468B2

Compositions for stabilizing and delivering proteins and/or other bioactive agents are disclosed. The bioactive agents are embedded or encapsulated in a crystalline matrix. Typically the bioactive agents are in the form of micro- or nanoparticles. The crystalline matrix confers enhanced stability to the agents embedded therein relative to other microparticulate or nanoparticulate bioactive agents. The carriers are especially useful for stabilizing bioactive macromolecules, such as proteins.
US10722461B2

The present disclosure is broadly concerned with petrolatum-based compositions as a suspension matrix for the active ingredients. The disclosure is also concerned with processes for forming stable emulsions of active ingredients in petrolatum.
US10722453B1

Pre-filled syringes, pharmaceutical compositions, and kits and methods relating to same allow for emergency administration of one or more drugs from prefilled glass syringes to a patient via a needleless connector. In preferred embodiments, the prefilled glass syringe has a drug volume of at least 5 mL, has a Luer-lock, and has a syringe tip with an internal channel that has a diameter of about 1.7 mm. Such syringes advantageously allow storage of emergency drugs without leaching of plastic materials and degradation, and substantially improve the safety profile where the syringe is attached to an IV line via a needleless connector.
US10722451B2

The present invention provides a crude extract from the bark of an Acer rubrum (AR) tree and/or Picea mariana (PM), method of preparation and its use for inhibiting the signs of skin aging (such as wrinkles and/or dehydration) caused by at least one of: increased elastase activity, increased collagenase activity, decreased elastin synthesis, decreased collagen synthesis or decreased involucrin synthesis, in skin fibroblast cells, particularly those of a human subject.
US10722450B2

The present invention relates to a process for treating the hair, which comprises: a) the application to the hair of a composition comprising one or more polymers containing a silicone unit bearing alkoxy-(aminomethyl)-silyl functional groups, b) the application to the hair of steam by means of a device that is capable of generating steam, step b) possibly preceding, following or being simultaneous with step a).
US10722446B2

Described herein are aqueous oral care compositions comprising (a) an effective amount of a basic amino acid in free or orally acceptable salt form; and (b) a polymer system comprising (i) a cellulosic polymer, (ii) a gum polymer, and (iii) a polyacrylate polymer or co-polymer; and methods of making and using the same.
US10722443B2

Embodiments herein are directed to moisturizing compositions comprising interpenetrating polymer networks, methods of making moisturizing compositions and methods of using moisturizing compositions.
US10722430B1

A system comprising one or more of a programmable encapsulation for containing and regulating the release of a medicament, an encapsulating device used by a manufacturer which encloses the medicament within a programmable encapsulation, a programming device used by a pharmacy or dispensary which programs the encapsulation with an intended patient's health data and prescription data, a consumer encapsulation storage device configured to store one or more programmable encapsulations for one or more of a patient, authenticate the identity of a patient, and dispense medicaments to the patient in accordance with the patient's prescription, and a portable reader configured to scan a programmable encapsulation and display the details of the medicament and instructions for its consumption.
US10722428B2

A sterile container including at least one hollow fiber filter module, especially dialyzer, which is accommodated in a hermetically sealed holding volume of a primary package and includes a blood compartment delimited by a blood inlet opening and a blood outlet opening, wherein a plurality of hollow fiber filter modules is arranged in the primary package and the sterile barrier of the blood compartment of each hollow fiber filter module inside the primary package is implemented by caps which close the blood inlet opening and the blood outlet opening of each hollow fiber filter module. A method of manufacturing such sterile container is also disclosed.
US10722423B2

The disclosure provides an applicator for applying a cosmetic treatment product to the skin or the lips, the applicator comprising at least:an application portion comprising a bundle of needles for applying the cosmetic treatment product and extending along a longitudinal axis, the bundle of needles comprising at least one first set of needles having a distribution that is square in cross-section relative to the longitudinal axis; anda linear drive device connected to the application portion and configured to constrain the bundle of needles to perform reciprocating motion along the longitudinal axis.
US10722422B2

A visual acuity (VA) training device includes a guiding unit, an eye-movement sensor, and a controller. The guiding unit is configured to guide an eyeball to move towards multiple predetermined positions. The eye-movement sensor is configured to obtain multiple eye-movement signals according to movement of the eyeball. The controller obtains multiple eyeball muscle parameters according to the eye-movement signals, and the controller controls the guiding unit according to the eyeball muscle parameters, so as to adjust the predetermined positions.
US10722419B2

Medical devices used to assist walking by helping to support a user's weight comprise a series of elements angled with respect to each other at angles selected to honor certain normal anatomical relationships so as to provide a stable platform for supporting a user's weight while reducing injury. Optional additional elements provide cushioning and stability.
US10722417B2

A vertebra recovery apparatus has a main frame body, a swing assembly, and a driving module. The swing assembly is pivotally disposed on the main frame body, and is provided with two cantilevers. Each of the two cantilevers is provided with a support piece used for providing support under an armpit of each of the two arms of a human body, so that the human body stands in the swing assembly in a manner of suspending the feet. The driving module is disposed between the main frame body and the swing assembly, and may drive the swing assembly to perform motion of swinging forwards and backwards. The vertebra recovery apparatus performs stretching by using the weight of a user, and achieves the effects of enabling a vertebra to be fully stretched and to be in a normal location.
US10722409B2

A conveyance to carry humans, such as a wheelchair, is described having levers on each side of the wheelchair that are manually moved forward and backward to propel the conveyance. The user is able to shift into forward, reverse or neutral, brake, and change mechanical advantage (gear ratio), all this without removing the user's hands from the drive levers.
US10722406B1

Among other things a male urinary protective device for mild and moderate stress and urge incontinence providing extended protection, discreet appearance for active users, single-step reusable adjustment while maintaining skin integrity.
US10722402B2

A buckling module of a goggle device includes a buckling structure, a flexible belt body and an inserting member fixed on the belt body. The buckling structure has an accommodating space and an entrance in spatial communication with the accommodating space. The buckling structure includes a front positioning portion and a rear positioning portion both arranged at two opposite sides of the entrance. When a front end portion of the inserting member is inserted into the accommodating space by passing through the entrance, the front end portion moves toward an inner surface of the front positioning portion, and a first portion of the belt body adjacent to the front end portion is resiliently squeezed by the front positioning portion, so that the squeezed portion of the belt body drives a rear end portion of the inserting member to move toward an inner surface of the rear positioning portion.
US10722398B2

A laser surgery system includes: a gantry configured to be attached to a structural frame; a docking receptacle configured to be removably attached to an eye docking assembly which is attached to an eye; an adjustable table attached to the gantry; a lens assembly attached to the adjustable table, wherein the adjustable table is configured to move the lens assembly relative to the eye; one or more connectors configured to attach the docking receptacle to the gantry, at least one of the connectors being configured to dynamically adjust the distance between a surface of the gantry and a surface of the docking receptacle; and a controller configured to maintain a target distance between the lens assembly and a reference area of the eye docking assembly.
US10722397B2

An ophthalmic device including a cannula having a cannula distal end, a lumen, and one or more orifices coupled to the lumen is provided. The cannula is configured to deliver a fluid. A sleeve is disposed around the cannula and has a sleeve distal end. A handle is coupled to the sleeve and the cannula, the handle having an actuator. An internal mechanism is coupled to the actuator and configured to retract the sleeve relative to the cannula. The internal mechanism includes a follower fixedly coupled to the sleeve and moveable between distal and proximal positions, and a release member movable between an activated position and a release position. The release member is coupled to the actuator and configured to release a force that urges the follower from the distal position to the proximal position when the release member moves from the activated position to the release position.
US10722388B2

A solid-state drawing method for preparing a surgical suture or a biodegradable stent having improved flexibility and mechanical strength. The method for preparing a biodegradable stent includes (a) providing a biodegradable filament that comprises a material which is biodegradable; (b) solid-state drawing the biodegradable filament to provide a drawn biodegradable filament; (c) shaping the drawn biodegradable filament to provide a shaped biodegradable filament; and (d) annealing the shaped biodegradable filament to provide the biodegradable stent, wherein the biodegradable filament has a draw ratio that ranges from 1.1 to 5.0; and wherein the draw ratio is calculated by Equation 1 below: Draw ratio=(LSSD/LO)2, where LO is length of the biodegradable filament before the solid-state drawing, and LSSD is the length of the biodegradable filament after the solid-state drawing.
US10722387B2

The present invention relates to a stent graft and to an insertion system for the stent graft according to the invention. The stent graft comprises a stent graft portion with a self-expanding stent having successive rings of meandering supports and a first prosthesis material secured on the rings. On at least one of its rings, the stent graft portion has two loop-shaped fixing elements which are attached via a common fixing area and which are attached to the supports of the rings in such a way that, due to the fact that they are guided in opposite directions around the hollow cylindrical body, the latter is compressible. Furthermore, the insertion system according to the invention also has a pin element with which the loop-shaped fixing elements can be threaded on.
US10722380B1

Apparatus and associated methods relate to a laterally expandable spinal implant configured with pivoting wings adapted to secure the implant when inserted between vertebrae with stabilizing force applied to the vertebrae by shaft-driven wedges coupled with the wings. In an illustrative example, the wings may pivot along a hinge axis to swing outward from the implant central body until they press against vertebral endplates superior and inferior. The hinge may be, for example, disposed longitudinally to the implant central body. In some examples, four wings may be mounted axially in the implant central body. Some embodiments may include shaft-driven wedges coupled with the wings and adapted to force the wedges out laterally from the central body. Various examples may advantageously provide improved post-implant spinal stability, enhanced post-implant bone growth, and increased implant contact area with bone, based on the implant pressing the wings against the endplates as the shaft rotates.
US10722378B2

A surgical implant includes a body portion, a first tier, and a second tier. The first tier is attached to an upper surface of the body portion, and the second tier is attached to a lower surface of the body portion. Each of the upper surface and the lower surface of the body portion includes channels formed therein. The first tier includes a first layer including a plurality of first slats and a second layer including a plurality of second slats, where the plurality of first slats and the plurality of second slats intersect one another to form openings therebetween. The second tier includes a third layer including a plurality of third slats and a fourth layer including a plurality of fourth slats, where the plurality of third slats and the plurality of fourth slats intersect one another to form openings therebetween. When the first tier and the second tier are attached to the body portion, a passageway is formed through the openings formed in the first tier to the channels in the upper surface of the body portion, and a passageway is formed through the openings formed in the second tier to the channels in the lower surface of the body portion.
US10722366B2

A method of surgically providing a person with a neopenis is described and includes forming a neophallus from an inverted vagina of the person.
US10722359B2

Docking devices for docking a prosthetic valve at a native valve of a heart can include a coiled docking anchor and a retrieval suture. The docking device and retrieval suture can be configured for improved retention and retrieval of the docking device after deployment. The docking devices can have an end portion with a central axis. The retrieval suture can be connected to the end portion such that a line of force applied by applying tension to the retrieval suture is substantially aligned with the central axis.
US10722352B2

Devices, systems and methods to position a prosthetic heart valve such that the prosthetic valve does not compress conduction tissue and thereby produce heart block. Guide devices promote positioning the prosthetic valve within a native aortic valve to avoid the conduction tissue and, optionally, to center the prosthetic valve within the native heart valve. Prosthetic valves include one or more cut-outs, openings or recesses configured to align with the conduction tissue so that the conduction tissue is not contacted in a way that would lead to higher incidents of complete heart block.
US10722351B2

A transcatheter prosthesis with radially compressed and expanded configurations. An elongate member encircling at least a portion of the prosthesis, and configured to provide a seal between the prosthesis and a native anatomy when the prosthesis is deployed in the radially expanded configuration. The elongate member may be a resilient elongate member having a radially contracted state, when in tension, to hold at least the portion of the prosthesis in the radially compressed configuration, and having a radially expanded state, when relaxed, to provide the seal between at least the portion of the prosthesis and a native anatomy when the prosthesis is deployed. A system for delivering the transcatheter prosthesis may include a delivery catheter having an elongate cinching member encircling at least a second portion of the prosthesis, wherein the elongate cinching member is configured to hold the second portion of the prosthesis in the radially compressed configuration.
US10722345B2

Absorbable implants for breast surgery that conform to the breast parenchyma and surrounding chest wall have been developed. These implants support newly lifted breast parenchyma, and/or a breast implant. The implants have mechanical properties sufficient to support a reconstructed breast, and allow the in-growth of tissue into the implant as it degrades. The implants have a strength retention profile allowing the support of the breast to be transitioned from the implant to regenerated host tissue, without significant loss of support. Three-dimensional implants for use in minimally invasive mastopexy/breast reconstruction procedures are also described, that confer shape to a patient's breast. These implants are self-reinforced, can be temporarily deformed, implanted in a suitably dissected tissue plane, and resume their preformed three-dimensional shape. The implants are preferably made from poly-4-hydroxybutyrate (P4HB) and copolymers thereof. The implants have suture pullout strengths that can resist the mechanical loads exerted on the reconstructed breast.
US10722343B2

In one embodiment of the present disclosure, an implant system for securing tissue to bone, including a first fixation member releasably engaged to a first inserter, the first fixation member having a throughbore adapted to accept a filament therethrough and a cannulation extending from a proximal end of the first fixation member to a distal end of the first fixation member, the first inserter positioned through the cannulation and having a distal tip extending distally beyond the distal end of the first fixation member, and a second fixation member releasably engaged to a second inserter different from the first inserter, the second fixation member having a size capable of being positioned within the bonehole.
US10722340B2

An apparatus is configured to be implanted within a biological lumen. The apparatus includes a plurality of magnetic elements and a coupling body. The magnetic elements are arranged in an annular array extending form an axis. The annular array defines an occludable opening configured to transition between an occluded state and an opened state. The magnetic elements include a first magnetic element and a second magnetic element. The second magnetic element is located adjacent to the first magnetic element. The second magnetic element includes a polymer magnetic material formed in a shape designed to geometrically interlock with the first magnetic element in the occluded state. The second magnetic element is configured to elastically deform to transition the occludable opening from the occluded state to the opened state. The coupling body is configured to affix to a portion of the first magnetic element and a portion of the second magnetic element.
US10722334B2

A device for measuring the length of a root canal of a subject is provided. The device includes a flexible sheath slidable over a dental handpiece head. The sheath includes electrically conducting wires for connecting to an apex locator. Also provided is a device for measuring root canal length that includes an endodontic file having a metallic element at the file end far from the end inserted into a root canal. The modified file provides a region in the metallic element for electronic attachment to an apex locator such that the rubber stopper may be moved along the entire file surface without interference.
US10722330B2

The present invention provides a dental implant including: a fixture and an abutment including a coupling leg, and the fixture and the abutment are elastically coupled with each other, the dental implant including: a fixture axial hole inner inclined surface in which an inner diameter of an axial hole is gradually and downwardly reduced from a predetermined position of an inner inclined surface of the fixture; a first coupling part formed with a coupling hole at a predetermined position of the fixture; and a first associated coupling part formed with a coupling protrusion complementarily coupled with the first coupling part, wherein when the first associated coupling part is separated from the first coupling part by rotating the abutment, the coupling protrusion upwardly pushes the abutment from the fixture by elastic repulsion with the axial hole inner inclined surface of the fixture, thus the abutment becomes separated from the fixture.
US10722321B2

A washer machine for medical instruments comprises a washing chamber, at least a sliding loader trolley at least to load the medical instruments into the washing chamber and a washing device to wash the medical instruments, comprising a multiple connection unit and a plurality of flexible washing pipes connectable to the aperture of the medical instrument to be washed. The multiple connection unit comprises a free multiple connector, autonomous and unconstrained from the sliding loader trolley and connectable to said flexible washing pipes, and a static and fixed multiple counter-connector disposed in the washing chamber. A releasable manual mechanical clamping device is provided for the selective connection of the free multiple connector to the static and fixed multiple counter-connector.
US10722316B2

A packaged bioprosthetic heart valve comprising a bioprosthetic heart valve, an adaptive seal and a package. The bioprosthetic heart valve comprises an at least partially dehydrated biological tissue leaflet structure coupled to a supporting frame. The bioprosthetic heart valve has a periphery, an inflow portion, and an outflow portion. The adaptive seal is coupled to the bioprosthetic heart valve around at least a portion of the periphery. The adaptive seal comprises an expandable material that expands after exposure to an initiating condition. The bioprosthetic heart valve and the adaptive seal is stored and contained within the package, which does not contain a liquid storage solution in contact with the bioprosthetic heart valve and the adaptive seal.
US10722308B2

One described aspect is an optical fiber comprising: a fiber core that extends along a fiber axis, is configured to transmit a laser energy along the fiber axis, and terminates at a distal end with an angled distal face; a jacket that surrounds a proximal portion of the fiber core along the fiber axis, and terminates at a distal end located proximal of the angled distal face; a fiber tip including a proximal end with an angled distal face; and a reflector including a proximal face attached to the angled distal face of the fiber core, a distal face attached to the angled proximal face of the fiber tip, and at least one layer configured to direct the laser energy out of the fiber core along a laser axis generally transverse with the fiber axis, wherein the optical fiber tapers along the fiber axis. Associated laser systems are also disclosed.
US10722304B2

Methods and devices described herein facilitate improved treatment of body organs.
US10722289B2

A thermal accelerant is delivered to a tissue site and localized to modulate the shape, extent or other characteristic of RF or microwave-induced hyperthermic tissue ablation. The accelerant may be provided via an image-guided hand piece or via a lumen added to a microwave antenna, and promotes faster heating, more complete ablation and/or a more extensive treatment region to reduce recurrence of treated cancers, overcoming natural limitations, variations in tissue response and drop-off or thermal loss away from the antenna. The accelerant is delivered as a low-viscosity but heat sensitive fluid, and is fixed in place to provide regions of preferential absorption or heating. Shorter exposure times to heat the far field may allow survival of vulnerable tissue such as vessels, and multiple antennae may be used for effective treatment of irregular or large tumors.
US10722286B2

High-voltage pulses ablation systems and methods are used to ablate tissue and form lesions. A variety of different electrophysiology devices, such as catheters, surgical probes, and clamps, may be used to position one or more electrodes at a target location. Electrodes can be connected to power supply lines and, in some instances, the power to the electrodes can be controlled on an electrode-by-electrode basis. High-voltage pulse sequences provide a total amount of heating that is typically less than that which is observed with thermally-based radiofrequency energy ablation protocols.
US10722277B2

Devices and methods for positioning and immobilizing at least two adjacent vertebrae using adjacent spinous processes. The method includes positioning a spinous process fusion device in an interspinous space between adjacent spinous processes including a rod and a first wing, and attaching a second wing to the rod, for example, using a ratcheting mechanism.
US10722261B2

A surgical instrument is disclosed comprising a housing, a transducer supported within the housing, an end-effector engaged with the transducer, and a clamp including a jaw member movably supported relative to the end-effector between an open position and a closed position. The transducer is configured to produce vibrations. The end-effector defines an axis and a distal tip. The distal tip is movable relative to the axis by vibrations produced by the transducer. The end-effector is configured to be detached from the transducer. The transducer is configured to receive a different end-effector.
US10722259B2

Disclosed herein is a tool for removing an implanted item from beneath the skin, the tool comprising: a clamping device configured to engage with the skin to retain the implanted item in a known position relative to the tool; a cutting device for cutting an opening in the skin; and a gripping device configured to move through an opening in the skin and grip an implanted item; such that, in use, the implanted item is retained by the clamping device substantially in the known position and the cutting device creates an opening in the skin through which the gripping device then passes to grip an implanted item. Advantageously, the tool reduces the complexity of an implant removal process and does not require significant operator skill to use. It further reduces the time required and the variation in the outcome of such a procedure.
US10722256B2

Disclosed is a medical device comprising an outer elongate member having a proximal end, a distal end, and a lumen extending therethrough; an inner elongate member disposed within the lumen of the outer elongate member and configured to be axially movable inside the lumen of the outer elongate member, the inner elongate member having a proximal end portion, a distal end portion, and a lumen extending therethrough; an expandable cage-like scaffold having a proximal end secured to the distal end of the outer elongate member and a distal end having an inwardly everted tapering framework, the cage-like scaffold composed of a plurality of wires that cross each other at points, and capable of being actuated between a substantially folded configuration and a substantially open configuration. Also disclosed is a method of employing the above disclosed device or variations thereof to capture and remove stones or stone fragments from the body's lumen of a subject.
US10722255B2

A catheter system can be used to remove obstructions, deliver implantable devices or substances, and/or restore flow through body lumens. The system can include an outer shaft having a lumen, sidewall, and a longitudinal window in the sidewall, an inner shaft disposed within the lumen, and an expandable member having a first end coupled to the outer shaft and a second end coupled to the inner shaft through the window. The expandable member can be positioned adjacent to a target region while in the collapsed configuration. The expandable member can be expanded to an expanded configuration by relative movement of the outer shaft and the inner shaft.
US10722247B2

An apparatus and method for introducing portals into bone is described herein. An example apparatus for introducing portals into bone includes a handle, a base, and a driving member. The driving member can be made to project past the base by operating the handle. The base is detachable from the handle. The apparatus also includes a guide coupled at a first end to the handle and at a second end to the base. The base is detachably coupled to the guide. A base coupling detachably coupling the base to the guide includes an actuating member movable between a coupled configuration wherein the base is coupled to the guide and an uncoupled configuration wherein the base is released from the guide. The actuating member is arranged so that motion of the handle toward the base moves the actuating member from the coupled configuration to the uncoupled configuration.
US10722246B2

Disclosed are methods and devices for obtaining patent hemostasis of the radial artery by compressing the uninstrumented ulnar artery to increase radial artery flow. The device comprises a band having an inflatable bladder for applying blunt pressure to the ulnar artery. The method comprises applying a pressure to the homolateral ulnar artery and applying a pressure to the radial artery at the access site to obtain hemostasis at the access site. The method further comprises administering an anticoagulant to a patient at a dose ranging from about 20 units per kg of body weight to about 30 units per kg of body weight.
US10722245B2

Disclosed is a method of reducing a dosage of an anticoagulant when performing a catheterization procedure at an access site of an artery. The method comprises administering the anticoagulant at a dose less than a conventional dose, reducing a contact time of blood at the access site of the artery, and maintaining the contact time of blood at a reduced level for a period of time during the catheterization procedure.
US10722244B2

A method mitigates pocket bleeding and hematoma formation in a patient by providing a pliable wrap having a solid block coupled with the wrap, and then securing the pliable wrap around the torso of the patient to align the solid block with the located localized torso area. The solid block at least in part covers the localized torso area. The wrap is secured to cause the wrap to apply a force, to the solid block, that produces a corresponding pressure on the localized torso area. The force applied to the solid block is high enough to cause the pressure to hinder blood flow to the localized torso area to promote clotting at the localized torso area. At the same time, the force applied to the solid block is low enough to cause the pressure to permit blood flow to the localized torso area to promote healing.
US10722238B2

The invention being disclosed describes a medical device for removal of a thrombus or clot in a vascular setting by using a rotational, expandable basket structure in combination with drug infusion, blood/particle aspiration and clot isolation by distal and proximal occlusion.
US10722227B2

A medical device for use in the creation of a temporary pneumoperitoneum includes a substantially dome-shaped body having a vacuum port providing a fluid passageway between an underside of the dome-shaped body and an upside of the dome-shaped body. A frustoconical port is provide in the domed-shaped body for reception and through passage of one or more pieces of associated medical apparatus therethrough.
US10722213B2

An ultrasonic device includes a plurality of ultrasonic wave transmitting sections adapted to transmit an ultrasonic wave as a fundamental wave, and a plurality of ultrasonic wave receiving sections capable of receiving a second-order harmonic wave with respect to the fundamental wave, the plurality of ultrasonic wave transmitting sections and the plurality of ultrasonic wave receiving sections are arranged along an X direction, the plurality of ultrasonic wave receiving sections are arranged at first intervals corresponding to the order of the second-order harmonic wave, the N ultrasonic wave transmitting sections constitute a single transmission channel, and are wired with each other, and the transmission channels are arranged at second intervals each twice as long as the first interval. N is a natural number.
US10722201B2

Novel and advantageous systems and methods for performing X-ray imaging by using an X-ray source with source grating functionality incorporated therein are provided. An electron beam can be electromagnetically manipulated such that the X-ray source emits radiation in a pattern that is the same as if the radiation had already passed through a source grating.
US10722198B2

A portable radiological cassette comprises a housing, and a digital detector of incident ionizing radiation, taking the form of a flat panel, the detector being positioned in the housing and comprising a memory space, and being intended to generate a digital image of a patient exposed to the ionizing radiation and with whom an identification code is associated, the digital image being stored in the memory space. The cassette comprises a device for selecting the identification code of the patient, which is intended to write the identification code of the patient in the memory space. The invention also relates to a method for identifying a patient.
US10722197B2

An arrangement includes a stationary part of a gantry of a computed tomography scanner and a first rotating part of the gantry of the computed tomography scanner. The first rotating part and the stationary part are connectable to one another via a bearing assembly such that the first rotating part is arranged in a bearing position relative to the stationary part and is mounted via the bearing assembly such that it is rotatable about a system axis. The first rotating part and the stationary part are connectable to one another via a holding apparatus such that the first rotating part is arranged in a holding position relative to the stationary part independently of the bearing assembly. In both the bearing position and the holding position, a central opening of the first rotating part and a central opening of the stationary part are arranged about the system axis.
US10722195B2

A radiographic apparatus includes a radiation detector, a heat generating member, a lower housing including a recess disposed at a position facing the heat generating member, and a heat transfer portion for transferring heat from the heat generating member to the lower housing. The heat transfer portion is disposed between the heat generating member and the recess, and is continuously disposed along the inner surface of the lower housing in a region other than the recess.
US10722191B2

A method for diagnosis and evaluation of tooth decay comprises: locating in an x-ray image the contour of the dento-enamel junction (DEJ); measuring optical density along contours substantially parallel to and on either side of the DEJ contour; and calculating at least one decay value from the measured optical densities. A method for diagnosis and evaluation of periodontal disease comprises: measuring in an x-ray image a bone depth (BD) relative to the position of the cemento-enamel junctions (CEJs) of adjacent teeth;measuring bone density along a contour between the adjacent teeth; and calculating a crestal density (CD) value from the measured bone density. Calibration standards may be employed for facilitating calculation of the values. A dental digital x-ray imaging calibration method for at least partly correcting for variations of the optical densities of images acquired from the dental digital x-ray imaging system.
US10722185B2

A user, such as an elderly person, may be assisted by an assistance device in his or her caregiving environment that operates in conjunction with one or more server computers. The assistance device may execute a schedule of assistance actions where each assistance action is associated with a time and is executed at that time to assist the user. An assistance action may present an input request to a user, process a voice input of the user, and analyze the voice input to determine that the voice input corresponds to a negative response event, a positive response event, or a non-response event. Based on the categorization of one or more voice inputs as negative response events, positive response events, or non-response events, it may be determined to notify a caregiver of the user, for example where the user has not responded to a number of assistance actions.
US10722183B2

A method and device are provided for conditioning a sleep signal from a sleep sensor for a sleep monitor. A sleep sensor is configured to sense a physiological signal, such as a cardiac or respiratory signal from a sleeping mammal, such as a human, e.g. an infant or a baby. If the mammal exhibits also (gross) body movement during his sleep, the sensor signal may be clipped. The method and device provide a conditioning of the sleep signal by providing an estimation of the sleep signal instead of the conditioned sleep signal itself when the sensor signal is clipping.
US10722182B2

Provided is a system for measuring biological signals of a user, which includes a sensor module configured to acquire ballistocardiogram (BCG) signals of a user via a present channel, where the present channel is at least one channel of the sensor module, a decomposition module configured to decompose the BCG signals to decomposed signals, a reconstruction module configured to reconstruct at least a portion of the decomposed signals to reconstructed signals, a processing module configured to process the reconstructed signals to at least one of a heart rate, respiration rate, phases of respiration, and blood pressure, and a display module configured to display at least one output corresponding to the at least one of the heart rate, the respiration rate, phases of respiration, and the blood pressure on a display device.
US10722174B2

Various aspects as described herein are directed to skin-conformal sensor devices and methods of using the same. As consistent with one or more embodiments, a sensor device includes an upper portion and lower portion. The upper portion includes a plurality of layers including at least one sensor. The lower portion includes a layer of microstructures configured and arranged to interface with skin of a subject and to interlock the skin with the at least one sensor.
US10722168B2

A surgical pin positioning block comprising a top portion comprising a pin position dial including one or more pin hole guides, the pin position dial setting angular pin positions of the one or more pin hole guides, wherein the one or more pin hole guides includes an orifice for drilling of pin holes, one or more dial position notches that secures the pin position dial in a given angular pin position, one or more sliding members coupled with one or more receptacles of a bottom portion, the bottom portion comprising the one or more receptacles, an adapter including one or more prongs that attach to a prosthetic inlay device, and a locking mechanism for securing the one or more sliding members in the one or more receptacles.
US10722167B2

A method to inspect a solid organ in a subject includes introducing a needle in a predetermined area of the solid organ, inserting an optical probe through a lumen of the needle, and imaging the predetermined area using the optical probe. An optical probe to inspect a solid organ in a subject, the optical probe being intended to be positioned in the solid organ through a needle, the optical probe includes an optical fiber bundle, a ferule to protect the distal tip of the optical fiber bundle, the ferule comprising a shank and a head, and a sheath wrapping the fiber bundle and the shank, wherein the head of the ferule has a length adapted for the optical probe to image the solid organ while keeping the sheath inside the needle.
US10722163B2

Methods, devices, systems and kits for obtaining blood samples are provided. Devices include a cuff, a pressure source, and a timing mechanism. Devices may further include one or more of a: warming mechanism, lancing mechanism; automated sample collection device, automated sample analysis device, and communication unit. Systems include such a device, and may include sample collection, sample analysis, or communication devices.Methods include placing a cuff on a digit of a subject, inflating the cuff, and obtaining a small volume blood sample. Methods may further include warming a digit; lancing a digit; pulsing the cuff; and providing a signal indicating the end of the sample collection time period.Kits may include a device, a sample collection vessel, and may include a disposable for use in sample collection.These methods, devices, systems and kits for obtaining blood samples may be used to easily, reliably, and consistently obtain blood samples from subjects.
US10722161B2

Disclosed herein are devices, systems, and methods for a continuous analyte sensor, such as a continuous glucose sensor. In certain embodiments disclosed herein, various in vivo properties of the sensor's surroundings can be measured. In some embodiments, the measured properties can be used to identify a physiological response or condition in the body. This information can then be used by a patient, doctor, or system to respond appropriately to the identified condition.
US10722159B2

A non-invasive, optical-based physiological monitoring system is disclosed. One embodiment includes an emitter configured to emit light. A diffuser is configured to receive and spread the emitted light, and to emit the spread light at a tissue measurement site. The system further includes a concentrator configured to receive the spread light after it has been attenuated by or reflected from the tissue measurement site. The concentrator is also configured to collect and concentrate the received light and to emit the concentrated light to a detector. The detector is configured to detect the concentrated light and to transmit a signal representative of the detected light. A processor is configured to receive the transmitted signal and to determine a physiological parameter, such as, for example, arterial oxygen saturation, in the tissue measurement site.
US10722152B2

The present invention relates generally to systems and methods for measuring an analyte in a host. More particularly, the present invention relates to systems and methods for transcutaneous measurement of glucose in a host.
US10722148B2

Provided herein are systems and devices capable of detecting an event, such as the fall of a human. The devices may include a motion sensor, a heat sensor, and a vibration sensor. The devices and systems also may include an alarm and/or communication device configured to function when the event occurs.
US10722138B2

Electron paramagnetic resonance (EPR) systems and methods for transcutaneous oxygen monitoring (TCOM) and subcutaneous oxygen monitoring (SCOM) are provided herein. Optionally, the EPR systems provided herein can be portable and/or handheld to facilitate EPR oximetry in clinical environments.
US10722129B2

Embodiments described herein generally relate to devices, methods and systems for determining blood oxygenation. By applying near infrared radiation of an appropriate wavelength to the tissue and determining the absorbance at a plurality of points where the distance between the source of the near infrared radiation and the detector are known, the oxygenation state of the hemoglobin can be determined based on position in a three dimensional space.
US10722128B2

Computerized eyewear and corresponding methods measure a wearer's heart rate using a first optical sensor and a second optical sensor at least partially embedded in an eyewear temple. The first optical sensor transmits a first signal to a temple of the wearer and the second optical sensor transmits a second signal to the temple of the wearer. Reflections of the first signal are used to measure a raw heart rate delta and reflections of the second signal are used to measure a noise delta. The raw heart rate delta and the noise delta are used to determine a measured heart rate of the wearer of the computerized eyewear.
US10722126B2

A heart rate detection method includes a facial image data acquiring step, a feature points recognizing step, an effective displacement signal generating step and a heart rate determining step. The feature points recognizing step is for recognizing a plurality of feature points, wherein a number range of the feature points is from three to twenty, and the feature points include a center point between two medial canthi, a point of a pronasale and a point of a subnasale of the face. The effective displacement signal generating step is for calculating an original displacement signal, wherein the original displacement signal is converted to an effective displacement signal. The heart rate determining step is for transforming the effective displacement signals of each of the feature points to an effective spectrum, wherein a heart rate is determined from one of the effective spectrums corresponding to the feature points, respectively.
US10722122B2

A detection device, for placement under or on a mattress, configured for the movements of a person lying on the mattress, includes a sensing portion having an inflatable chamber intended to be positioned under the individual, an electronic unit arranged at a distance from the sensing portion and having a pressure sensor, intended to be positioned outside of the bedding, a transmitting portion interposed between the sensing portion and the electronic unit, including a channel establishing a fluid connection between the inflatable chamber and the sensor, the channel having a transverse dimension (T) that is much smaller than the width (L1) of the chamber.
US10722090B2

The present invention relates to an autonomously operable vacuum cleaner that has a modular design. The vacuum cleaner in this respect comprises a cleaning head module as well as a separate canister module. The cleaning head module and the canister module are in this respect connected to one another via a hose so that dust sucked in via the cleaning head module can be conveyed into the canister module.
US10722085B2

The present invention relates to a blowing-suction device, selectively operating in a blowing mode or a suction mode, comprising: a main body; a motor located inside the main body, the motor having a motor shaft providing rotational motion; a fan assembly driven by the motor to rotate; and a blowing assembly and a suction assembly connected to the main body; wherein the fan assembly includes an axial fan that, while in the blowing mode, the blowing assembly is connected to the main body, and wherein the axial fan rotates around a first rotary shaft, and, while in the suction mode, the suction assembly is connected to the main body.
US10722083B2

A forced-air hand dryer having means and apparatus for decontaminating air passing through the forced-air hand dryer. In general, the embodiments described comprise at least one or a plurality of airflow generators, at least one conduit for passing air through the conduits and to at least one decontamination system where the air undergoes filtration and decontamination. The air generated may be located upstream or downstream of a hand-receiving area where a user places his or her hands for drying.
US10722082B2

A diaphragm for a container assembly for dispensing products such as wipes or sheets, or collecting and/or storing products, including waste products. The container assembly has diaphragm with a central aperture and at least one petal. The diaphragm is a portion of the lid or the container. The aperture allows a user to insert one or more fingers (or hand) to pull the first sheet out or alternatively, deposit an item into the container. The diaphragm has one or more slits separating the outer periphery of the diaphragm from portions of the petals, thereby reducing the force required to deflect the diaphragm.
US10722075B2

Coffee grinder including a grinding assembly to grind coffee beans, a container or hopper to feed coffee beans to the grinding assembly, an electric motor connected to the grinding assembly, a feeding conduit connected to the grinding assembly to feed coffee into a filter supported by a filter-holder, an inverter connected to the electric motor to vary the speed of the electric motor, a control unit connected to the inverter to control the inverter, and a control panel connected to the inverter by the control unit so that the user can vary the speed of the electric motor.
US10722073B2

A portable grilling assembly for cooking outdoors includes a stake that can be driven into the ground. The stake is comprised of a plurality of connectable sections such that the stake has an adjustable length. A grill is provided and the grill is removably coupled to the stake. The grill is slidably positioned on the stake such that the grill is positionable at a selected point along the stake. In this way the grill can be spaced a selected distance from the ground. A basket is removably coupled to the stake and the basket is slidably positioned on the stake such that the basket is positionable at a selected point along the stake. Moreover, the basket is comprised of a fire resistant material to contain a heat source for cooking on the grill.
US10722069B2

The invention relates to a cooking utensil comprising a hollow bowl with a base and a side wall rising from the base, and including at least one fragile area. The bowl has a concave inner surface for receiving food, as well as a convex outer surface. The utensil is coated successively, from the bowl, with a hard base and a nonstick coating, which covers the hard base and includes at least one layer containing at least one fluorocarbon resin. The hard base has a layer that is at least broken at the fragile area. The invention also relates to a method for producing such a utensil.
US10722062B1

A curtain pull comprises inner and outer surfaces, and first and second leaves each rotatably connected to the other along an edge by a connector. The first leaf comprises a first portion of the inner surface and a first portion of the outer surface and the second leaf comprises a second portion of the inner surface and a second portion of the outer surface. The curtain pull transforms by folding at the connector from an open state wherein the first and second portions of the inner surface are relatively rotated on the connector at a non-zero angle to a closed state wherein the first and second portions of the inner surface are opposed.
US10722058B1

A pillow device providing comfort, support, and correct spinal alignment when lying in either the supine position or on one's side. The pillow comprises a bottom pillow, a top pillow, and side supports. Each side support is attached to both the bottom pillow and top pillow. The bottom pillow is arranged between the side supports and the top pillow is mounted above the bottom pillow and the side supports. The bottom pillow and top pillow each have a cavity configured to receive a user's head and a neck portion configured to support a user's neck when lying in the supine position. The side supports and sides of the top pillow are configured to receive a user's head when lying on his or her side.
US10722055B2

An adjustable pillow device and a pillow adjusting method are disclosed, the adjustable pillow device comprising: a headrest body (1), the height of a region thereof being self-adjustable according to the posture of a sleeper; an inflation/deflation mechanism (2) connected to the headrest body (1) for adjusting the height of a region of the headrest body (1); a sensor (3) for collecting information about the sleeper and providing feedback; a central information processor (4) connected to the sensor (3) and the control end of the inflation/deflation mechanism (2) respectively for receiving information from the sensor (3) and sending an adjustment direction to the control end of the inflation/deflation mechanism (2) according to the sleeping posture information and the body data figure of the sleeper. The adjustable pillow device and method ensure that a sleeper has the most natural and physiologic sleeping posture, and enable automatic adjustment of the head and neck of the sleeper in different sleeping postures to allow the head to be in a proper position relative to the neck, thus providing the sleeper with deeper and longer sleep, improving sleep quality, and meeting the needs of the public.
US10722053B2

A pillow cover is provided that includes a first panel and a second panel perimetrically joined with the first panel such that inner surfaces of the first and second panels define a cavity having a void volume. The first and second panels are each made from a first material. An opening extends through the inner surface of the first panel and an outer surface of the first panel. The pillow cover includes a patch covering the opening. The patch is made from a second material that is different than the first material.
US10722047B2

A baby crib may include: a frame including an upper portion and a lower portion connected together; a plurality of peripheral walls made of flexible material and secured to the frame; a bottom secured to the frame at the lower portion of the frame and surrounded by the peripheral walls; at least one of the peripheral walls having variable height; a support structure configured to support the frame and configured to increase and/or decrease a height of the bottom; and elastic return members, fixed to the lower portion of the frame, that are configured to be fixed to a bed to push or pull the frame against the bed. The upper portion, the lower portion, and the elastic return members may be rigidly movable jointly with each other and with the bottom when the height of the bottom is increased and/or decreased.
US10722045B2

A cover assembly for use with a piece of furniture comprising a seat portion and a support portion, where the seat portion and the support portion define a gap and a bottom space. The cover assembly comprises a protective sheet and at least one anchor assembly. At least a portion of the protective sheet is folded to define a sheet edge. The at least one anchor assembly comprises an anchor member and an anchor strap secured to the anchor member and to the sheet edge. The anchor member is adapted to be arranged in the bottom space. The anchor strap is adapted to extend from the anchor member to an upper portion of the gap. At least a portion of the protective sheet may be held in place relative to the piece of furniture by the anchor assembly.
US10722038B1

A multi-positional chair assembly comprises a frame portion defined by a pair of sinuously-shaped bars. The frame portion includes a back support section, a middle section, and a buttocks support section. The sections are joined at multiple junctions defined by a bowed shape. A resilient panel traverses the pair of sinuously-shaped bars, providing a supportive surface for a user. The panel may include a resilient metal sheet, apertures, or parallel strips of material. The frame portion can be positioned in multiple positions to provide a sitting surface, including a lounge chair position and a higher elevated stool position. The chair assembly reconfigures between the lounge chair position and the stool position through rotation. Rotating the buttocks support section and the legs to engage the ground surface achieves the lounge chair position. And rotating the back support section and the legs to engage the ground surface achieves the stool position.
US10722037B2

The present disclosure relates generally to a beverage holder designed to be mounted to the underside of an armrest and may be retracted under the armrest when not in use. Embodiments of the present disclosure include a retractable beverage holder (RBH) with a mounting bracket that provides support to the beverage holder when the beverage holder is retracted under the armrest, and when the beverage holder is extended out from under the armrest. Embodiments of the present disclosure include, for example, a dual option retractable beverage holder (DORBH) having both a wine glass holder, and a cup holder. Another example embodiment is a single option retractable beverage holder (SORBH) comprising a wine glass holder and a mounting bracket, or a cup holder and a mounting bracket.
US10722033B1

The present invention provides a bathing seat structure for use in a bathtub, wherein the legs frame enables fixed positioning of the base, and the base enables fixed positioning of the seat cushion. The base is provided with two freeing mechanisms, a lever, and a rolling device. After pulling open the lever, the rolling device enables the seat cushion to rotate. The two freeing mechanisms must be pressed to a predetermined depth and must be pressed simultaneously, only then can the seat cushion be shifted laterally, thus preventing inadvertent contact and causing displacement of the seat cushion. The rolling device uses a two-tier centrifugal configuration, thereby supporting equal distribution of a person's weight to achieve smooth rotation with no inclining of the seat cushion, and thus extending the serviceable life of the rolling device.
US10722027B2

A weapon security apparatus includes a base member and a gate member pivotably coupled to the base member configured to enclose a portion of a weapon. The apparatus further includes a retractable latch, the retractable latch locking the gate member in the closed position when in a non-retracted state and releasing the gate member when in a retracted state. The apparatus also includes a solenoid configured to retract the retractable latch when activated. The apparatus includes a controller configured to activate the solenoid with a first electrical current for a first period of time during which the retractable latch moves to the retracted position and with a second electrical current for a second period of time during which the retractable latch is held in the retracted position.
US10722025B2

Disclosed is a portable table assembly having a table top, a solid elongate cylindrical stem that receives and carries the table top. The portable table assembly is easily assembled and adaptable for a wide variety of uses including, but not limited to, outdoor/lawn gaming, parks and general recreation, outdoor sporting and concert events, tailgate parties, camping, gardening, and beach use (with or without a beach umbrella).
US10722022B2

A surface cleaning apparatus includes a rotatably mounted brush associated with a dirty air inlet. A plurality of bristles extend outwardly from a radial outer surface of the rotatably mounted brush. The brush roll is provided with at least one hard floor cleaning pad and at least one flexible protective pad member.
US10722016B2

A luggage towing apparatus, wherein the luggage has a wheel to move on a surface and an opposing handle. The luggage apparatus includes a bracket constructed of a beam having first, mid, and second end portions, the first end portion having an aperture, the second end portion having a flexible hook being removably engagable to the luggage handle. The mid portion has a finger channel constructed of a partial sidewall, wherein the partial sidewall terminates in an open gap that operationally allows a user's finger to pass therethrough wherein the sidewall acts as a finger rest to facilitate finger movement thus moving the bracket to engage and disengage the flexible hook from the luggage handle. The luggage towing apparatus further includes a strap that is affixed the aperture, wherein operationally the strap is looped around a torso of the user to enable pulling the luggage across the surface hands free.
US10722014B2

Various examples related to a protection cover for protecting an electronic device are disclosed. According to one example, the protection cover includes a first cover part located at a front surface of the electronic device; a second cover part connected to the first cover part such that a rear surface of the electronic device is located thereon; a holding part which is rotatably connected between the first and second cover parts, allows at least a portion of the rear surface of the electronic device to be loaded thereon, and, simultaneously, holds the electronic device at various angles by using frictional force during a rotation thereof; and a supporting part loaded on the second cover part so as to rotatably support the holding part. In addition, various other examples are possible.
US10722007B2

A scar covering jewelry device. The scar covering jewelry device includes a pendant having a front side, a rear side, a first end, and a second end. An ornament is disposed on the front side of the pendant. A chain includes a second end and an opposing first end, wherein the first end of the chain is secured to the first end of the pendant and the second end of the chain secured to the second end of the pendant. A removable adhesive is disposed on the rear side of the pendant. The removable adhesive is configured to adhere to a bandage or directly to the wearer's skin, such that the pendant may be utilized to obscure a scar, injury, or other area of the skin the wearer wishes to cover. The removable adhesive allows the device to be removed without leaving a residue behind.
US10722002B2

An illuminated belt buckle (1) for a seat belt device of a motor vehicle, having a housing (2), a push button (3) displaceable in the housing (2), an insertion slot (4) bounded by an edge section (21) of the housing (2). A light source (10) and the at least one light emission surface (12, 13, 38, 39) are connected via at least one optical waveguide (11), and wherein a deflecting element (14, 15, 16) is arranged or formed on at least one boundary surface (7) of the optical waveguide (11) and/or on at least one boundary surface (8, 9) of the light emission surface (12, 13, 38, 39). The deflecting element having a geometry that differs from the rest of the boundary surface (7, 8, 9).
US10722001B2

An athletic shoe assembly for inhibiting knee and ankle injuries during athletic activities includes a shoe that may be worn during athletic activities. A front cleat unit and a back cleat unit are each positioned on the sole for engaging ground during the athletic activities to enhance traction. Each of the front and back cleat units are rotatably coupled to the sole and the shoe is rotatable about a vertical axis extending through the sole and each of the front and back cleat units. Thus, the front cleat unit and back cleat units inhibit knee and ankle injuries during the athletic activities resulting from a stationary foot and a twisting leg.
US10721999B2

A device and method to facilitate the opening and closing and closing of a ski boot. The devices includes a buckle attachment section, a ski pole cooperation section and a securing member. The buckle attachment section has a cavity which is dimensioned to receive a free end of the buckle therein to prevent unwanted movement of the buckle attachment section relative to the buckle. The ski pole cooperation section has a ski pole receiving opening. The ski pole receiving opening extends through the ski pole cooperation section and is dimensioned to receive an end of a ski pole therein. The securing member secures the device to the buckle of the ski boot. The device allows the buckles of the ski boot to be latched and unlatched with minimal twisting of the skier's body.
US10721996B2

A shoe includes an upper part, an outer sole, an inner sole configured between the upper part and the outer sole and abutting the outer sole, and a pad having a tear drop shape. The pad is configured between the outer sole and the inner sole to prevent the foot from forwardly slipping. The pad includes a first longitudinal end part having a first width and a first height, and a second longitudinal end part having a second width and a second height. The second longitudinal end part is configured opposite to the first longitudinal end part. The first longitudinal end part is closer to the medial side than the second longitudinal end part. The pad includes a middle part connecting the first and second longitudinal end parts. The first width is larger than the second width, and the first height is larger than the second height.
US10721995B2

An ornamental structure that is constructed and arranged to be coupled to an end of a cord includes a body with a through-hole and a cord-end receiving cavity that has a width about equal to a diameter of the cord, where the through hole and cavity are proximate one another.
US10721989B2

A shoe includes a sole and upper secured to the sole. The upper has a knitted element formed of unitary one-piece construction on a knitting machine. The knitted element includes a Moc seam allowance within a toe region, lateral and medial metatarsal regions, and lateral and medial ball regions. The upper has a Moc seam formed in part by the knitted element. The Moc seam is in at least the toe region, the lateral metatarsal region, and the medial metatarsal region. The Moc seam includes a core around which the Moc seam allowance is wrapped and stitched to itself to contain the core at least partially within a cavity formed by the Moc seam allowance.
US10721988B2

Woven hats and methods for manufacturing woven hats by using an ultrasonic sewing technology without a sewing thread are disclosed. One illustrative method comprises steps such as: cutting a raw material of a hat crown into a plurality of pieces, then bonding such material in pairs using an ultrasonic sewing machine, applying to seam areas a hot-pressing bonding technology of heat-seal adhesive tape, and/or otherwise completing the manufacturing of the hat crown; manufacturing a visor by using a high-frequency hot-pressing technology; manufacturing a sweatband by using a one-time hot-pressing technology; bonding the hat crown, the visor, and the sweatband with an ultrasonic sewing machine; and fixing a rear fastener or a tail belt through rivets. The disclosed technology makes it easier to realize intelligent and automatic reformation of the manufacturing line.
US10721985B2

A head cover that can be worn by health care professionals is provided. The head cover includes an anterior portion with a height h, a posterior portion with a height h2, at least one side portion or panel which may be shaped and sized so as to connect the anterior portion of the head cover and the posterior portion of the head cover, and where the at least one side portion has a contoured section t that forms all or a portion of a bottom edge of the side portion and that is shaped and sized so as to cover the ears, scalp, and sideburns of a user as required by AORN guidelines while also remaining clear of a user's eyes and field of vision.
US10721984B2

Clusters of artificial lashes are initially formed using, for example, a hot melt method in which artificial hairs secured to one another following exposure to a heat source. Multiple clusters can then be connected to one another to form a lash fusion. For example, a lash fusion could include three clusters that are connected together in a straight line. Multiple lash fusions can be arranged proximate to one another to form a set. In some embodiments, the multiple lash fusions are positioned such that the form of the set matches the curvature of the tightline of an eyelid. An adhesive can then be applied to the top of each lash fusion in the set, which enables an individual to easily apply the set directly to the underside of the individual's natural eyelashes (i.e., near the underside of the eyelid beneath the lash line).
US10721975B2

A therapeutic posture correcting bra and method of manufacture thereof in the posture re-balance, shoulder and spine muscle rebalance, posture correction, occupation risk prevention, anti-aging, and athletic enhancement space. A bra that is uniquely designed, manufactured and fabric woven for proprioceptive posture rebalance, correction and athletic enhancement that allows for breathability, functionality, range of motion, and fashionability. The therapeutic posture correcting bra is uniquely designed and narrows the distance between shoulder blades from proprioceptive muscle retraction at least 5 mm secondarily providing shoulder and spine muscle activation and relaxation for improved physical wellness.
US10721973B1

An electronic smoking device. A cartridge includes first and second heating elements arranged in parallel to respectively provide first and second vapors through an opening of a mouthpiece. The cartridge is configured to be removably coupled with a capital assembly including a power source, a controller, an indicator assembly, and a user input. The indicator assembly is configured to provide a first, second, or third visual output based on one of a first, second, or third user input. The indicator assembly may include first and second indicator lights. The third visual output may include illumination of both the first and second indicator lights, which may be indicative of a blend of first and second flavors. The outputted light may be shaped as chevrons oriented sideways and facing towards opposing sides of the capital assembly. The user input may include a button for toggling the device between first, second, and third states.
US10721972B2

A user-replaceable e-liquid reservoir for dispensing e-liquid, the reservoir being inserted into, or otherwise attached to, a portable, personal e-cigarette device and engaging with an electrical or electronic pump fluid transfer system in the device, the device including: an electrical or electronic pump, being configured to transfer e-liquid from the e-liquid reservoir to an atomizing unit in the device, the pump delivering a pre-defined or variable quantity of e-liquid from the reservoir; and in which the reservoir is not user-refillable.
US10721971B2

In some embodiments, a processor-implement method includes receiving a fill completion message including formulation and capsule identifiers from a fill station. The method also includes receiving a registration request including a vaporizer identifier and a compute device or user identifier from a compute device. The registration request is verified, and a registration confirmation message is sent to the compute device. The method also includes receiving a capsule attach event detection message including the capsule identifier, the vaporizer identifier, and at least one of the identifier of the compute device or the identifier of the user. A validity of the capsule attach event detection message is evaluated. If the capsule attach event detection message is valid, an unlock message is sent to the compute device or a vaporizer, and if the capsule attach event detection message is valid, an alert is sent to the compute device or the vaporizer.
US10721967B2

A method of treating disorders in a human or animal subject may include heating a material containing a compound to a first temperature to form a heated volume of the material. The method may additionally include heating the heated volume to a higher second temperature to form a dose of vapor including the compound. The method may also include administering the dose of vapor to the subject to treat disorders such as pain. The method may further include pre-heating the material to a preliminary temperature prior to the heating to the first temperature. The heating and pre-heating may be performed with a capsule including two covering layers, each including an electrically conductive material, configured to hold the material therebetween and to generate heat by resistive heating.
US10721961B2

Systems and devices for material reclaim of unutilized and underutilized inhalation products and to trap refuse, including an inlet, funnel member, reclaim bowl, and a housing. Additional components may include and upper and lower adapter.
US10721958B2

A portable package including an inhaling flavor product including a flavor base material configured by a non-tobacco material, a tobacco raw material that has undergone an alkali treatment and emits an inhaling flavor component as a vapor phase, and a container portion that contains the tobacco raw material and the flavor base material, wherein the container portion limits a movement of at least one of the tobacco raw material and the flavor base material so as to maintain the tobacco raw material and the flavor base material in a non-contacting state, and the tobacco raw material and the flavor base material are arranged within a same space constructed by the container portion.
US10721953B2

A thermal-reversible gelling agent derived from the modified starch of a waxy corn variant having an endosperm genotype with one or two doses of the recessive amylose-extender gene (ae). The starch may be modified enzymatically, physically, or by acid hydrolysis. Such gelling agents exhibit properties that may be useful in thickening or providing otherwise unique textures to foods.
US10721952B2

The present invention relates to a jam mix composition for microwave cooking, the composition comprising fats and oils; jam using the same; and a method for preparing the same. The jam mix composition of the present invention has advantages in that the convenience for jam cooking is enhanced, a jam production time is shortened, the freshness and texture of fruits or vegetables are maintained, and destruction of nutrients can be minimized.
US10721950B2

The present invention is directed to a process for the removal of mycotoxins from insoluble plant-derived protein using density-based particle separators. The end product contains a substantial portion of the proteins, including insoluble proteins, and a low concentration of mycotoxin. The process is particularly useful for removing aflatoxins from corn meal protein.
US10721947B2

The invention relates to an apparatus (10), designed and configured to acquire and analyse product-specific data for products (12) of the food processing industry, comprising a conveyor (11), which is gap-free in the transport plane, for transporting separated products (12) in transport direction T from an intake end to a discharge end, an X-ray unit (13) having at least one X-ray source (14) and at least one X-ray camera (15) for acquiring product-specific data, wherein X-ray source (14) and X-ray camera (15) are assigned to the conveyor (11) in such a manner that the products (12) can be guided along between the X-ray source (14) and the X-ray camera (15), as well as a control unit (16) which is connected to the X-ray unit (13) and is designed and configured to receive and analyse the product-specific data, forming a first data set, acquired by said X-ray unit (13), which is characterised in that at least one optical camera (17) is assigned to the same conveyor (11) between its intake end and discharge end, by means of which, in addition to the X-ray unit (13), product-specific data of the products (12) transported on said conveyor (11) can be acquired, wherein the optical camera (17) is connected to a control unit (18) which is designed and configured to receive and analyse the product-specific data, forming a second data set, acquired by the optical camera (17). The invention also relates to a system (29) comprising such an apparatus (10) as well as a method for processing products (12) of the food processing industry.
US10721940B2

Methods are provided for treating high solids concentrated milk products to delay gelation of the concentrated milk products by minimizing the rate at which the viscosity of the concentrates increases during cold storage. By another approach, the methods described herein are effective to substantially reduce the viscosity of the concentrated milk products. The methods described herein advantageously increase the length of time the high solids milk concentrates remain fluid and pumpable during refrigerated shelf-life. The high solids concentrated milk products treated with the methods provided herein include about 33 to about 43 percent total solids. By one approach, the high solids concentrated milk products have a pH of about 4.6 to about 6.7, and include salt at about 0.25 to about 6 percent by weight of the concentrate.
US10721935B2

A method for killing arthropods may include providing a mineral composition to a substrate that arthropods will contact, wherein the mineral composition is not a carrier for a chemical toxin. The mineral composition may include an aluminosilicate particulate, wherein contact between the mineral composition and an arthropod results in death of the arthropod. A composition for killing arthropods may include a mineral composition for associating with a substrate. The mineral composition may include at least one of an aluminosilicate particulate and a diatomaceous earth particulate, wherein the mineral composition is not a carrier for a chemical toxin. The mineral composition may have a median particle size d50 of 10 μm or less. A system for killing arthropods may include a mineral composition including at least one of an aluminosilicate particulate and a diatomaceous earth particulate. The system may further include a substrate, wherein the mineral composition is associated with the substrate.
US10721931B2

An aqueous dispersion containing BIT and IPBC prepared using nonionic and anionic surfactants exhibits both chemical and physical stability and is suitable for use as a single product which is capable of imparting to a coating composition a high level of resistance against attack by a broad spectrum of organisms, including bacteria, fungi and algae, in both the wet-state and dry film-state.
US10721928B2

The present invention relates to the use of a biopolymer for reducing the formation of a biofilm, preferably on a substrate, whereby the biopolymer is preferably a polypeptide, such as recombinant spider silk polypeptide. The present invention further relates to methods for producing a substrate which reduces the formation of a biofilm on a surface of said substrate.
US10721917B2

A pet waste disposal apparatus comprising a funnel shaped receptacle with a top open end for receiving pet waste and a bottom open end connectable to a sewage line via one or more plumbing adapters for discharging the pet waste. The apparatus further comprises a lid closure removably attached to the top open end of the receptacle and a water inlet on the exterior receptacle to receive from a hose supplying water from a water source and discharge pressurized water into the receptacle for flushing the pet waste.
US10721916B2

The disclosure provides a two-stage molded pet toy, which consists of a hard plastic liner which is primarily molded and a flexible material mantle which is secondarily molded and sleeves the liner, wherein the liner is a hollow shell formed by mutually butting half shells of upper and lower parts, openings are formed in its two opposite ends, multiple ribs are arranged perpendicular to a length direction of the liner in the liner, nicks are formed in all of the ribs, openings are also formed in two ends of the mantle respectively, and the openings in the two ends of the mantle correspond to the openings in the two ends of the liner respectively. The pet toy is multifunctional, and has both teething and food leakage functions; and in addition, the pet toy has advantages of the hard and flexible materials, and is multifunctional.
US10721915B1

A rollable pet toy is provided forming a skeletal ball that contains a simulated mouse, bird, or other small prey type animal. The skeletal ball provides a rollable form factor while still providing significant access area through which the pet may paw at or access the internal volume. The simulated mouse, bird or other small prey type animal, contained within, is visible and partially accessible. The simulated mouse, bird or other small prey animal is pivotally attached about an axle that is secured on each end, and is further motorized about the axle in a manner that the simulated animal can be made to move such as bobbing up and down. Additional movements, such as head bobbing for and back, or side to side, may further be incorporated. Sound emanation from a prerecorded sound chip may be further provided. Added olfactory stimulus, such as catnip or other herbaceous materials, may be further molded into the skeletal ball structure or contained within the simulated animal.
US10721908B2

Mat (12) for a floor (11) for livestock facilities, which floor (11) is formed with a defined longitudinal direction, the mat (12) comprising a liquid-impermeable support layer (121) onto which a wear layer (122) is applied and which support layer (121) can be imposed an intermittent bending to essentially be able to connect against a cylindrical object having the diameter of Ø=2Ro, and which mat (12) is provided with first slip-reducing means (502, 602, 702, 802, 902), wherein the bending primarily is located to straight and parallel lines, grooves, or bands extending transversely to the mat in or on the wear layer (122), and that the bending in these lines, grooves, or bands amounts to 1/r, wherein Ro≥r. Also concerns a floor having such a mat and a livestock facility having such a floor.
US10721906B2

The pet waste disposal device has a stabilization pillar mounted in a protection frame. The bottom part of the pillar is fitted with a pheromone reservoir and the top part of the protection frame is fitted with an absorption pad and then a filtration pad. At the bottom of the frame, permeable openings are located, which are used to drain the filtered urine and the rainwater in the surrounding areas. Underneath the filtration pad, a probe is located, which checks the level of filtration pad contamination and signals the need to replace the filtration pad. The pillar is fitted with a frame with a container, in which a poop bag is attached. The pillar is also fitted with a supply bin, a feature used to fasten the leash to the pillar, and a pet waste scooper.
US10721902B1

The invention provides seeds and plants of tomato line FDR-9Q16-0348. The invention thus relates to the plants, seeds, plant parts, and tissue cultures of tomato line FDR-9Q16-0348 and to methods for producing a tomato plant produced by crossing such plants with themselves or with another plant, such as a tomato plant of another genotype. The invention further relates to seeds and plants produced by such crossing. The invention further relates to plants, seeds, plant parts, and tissue cultures of tomato line FDR-9Q16-0348 comprising introduced beneficial or desirable traits.
US10721901B1

The invention provides seeds and plants of tomato line FDR9Q15-0298. The invention thus relates to the plants, seeds, plant parts, and tissue cultures of tomato line FDR9Q15-0298 and to methods for producing a tomato plant produced by crossing such plants with themselves or with another plant, such as a tomato plant of another genotype. The invention further relates to seeds and plants produced by such crossing. The invention further relates to plants, seeds, plant parts, and tissue cultures of tomato line FDR9Q15-0298 comprising introduced beneficial or desirable traits.
US10721893B1

A novel maize variety designated PH48H0 and seed, plants and plant parts thereof are provided. Methods for producing a maize plant comprise crossing maize variety PH48H0 with another maize plant are provided. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH48H0 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby are provided. Hybrid maize seed, plants or plant parts are produced by crossing the variety PH48H0 or a locus conversion of PH48H0 with another maize variety.
US10721888B1

According to the invention, there is provided seed and plants of the hybrid corn variety designated CH550817. The invention thus relates to the plants, seeds and tissue cultures of the variety CH550817, and to methods for producing a corn plant produced by crossing a corn plant of variety CH550817 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH550817.
US10721887B1

A novel maize variety designated PH42T9 and seed, plants and plant parts thereof are provided. Methods for producing a maize plant comprise crossing maize variety PH42T9 with another maize plant are provided. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH42T9 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby are provided. Hybrid maize seed, plants or plant parts are produced by crossing the variety PH42T9 or a locus conversion of PH42T9 with another maize variety.
US10721885B1

A novel maize variety designated PH47JV and seed, plants and plant parts thereof are provided. Methods for producing a maize plant comprise crossing maize variety PH47JV with another maize plant are provided. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH47JV through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby are provided. Hybrid maize seed, plants or plant parts are produced by crossing the variety PH47JV or a locus conversion of PH47JV with another maize variety.
US10721884B2

The invention provides seed and plants of tomato line FDSXJ11-6002. The invention thus relates to the plants, seeds, and tissue cultures of tomato line FDSXJ11-6002 and to methods for producing a tomato plant produced by crossing such plants with themselves or with another tomato plant, such as a plant of another genotype. The invention further relates to seeds and plants produced by such crossing. The invention further relates to parts of such plants, including the fruit and gametes of such plants.
US10721881B1

The present invention provides a system and method which combines field mapping and control software to effectively manage end gun parameters to adjust for changes in weather conditions and positional/terrain changes. According to a first preferred embodiment, the present invention preferably provides a system which monitors a mapped set of boundaries and preferably receives data regarding a variety of weather factors including wind monitoring (speed, direction, averages, and gusts) and preferably makes adjustments to the system to adjust and modify the shape of a desired distribution area based on the weather factors.
US10721880B2

A method of managing treatment of crop is disclosed. The method comprises: monitoring a first parameter describing a daily shrinkage of a plant part of the crop, and a second parameter describing daily growth rate of a plant part of the crop. The method further comprises calculating a plant status function based on a value of the first parameter and a value of the second parameter, and operating a crop treatment system responsively to the plant status function.
US10721876B1

A conversion is provided to adapt a salt truck spreading apparatus to a mulch blowing delivery system by replacing a centrifugal spreader with an air lock and blower while providing means to address clogs in the feeding of mulch.
US10721861B2

Embodiments for implementing a harvester method, system, and apparatus are provided. For example, a harvester for produce may include a fluid knife system at a front end of the harvester in a travel direction of the harvester, wherein the fluid knife system projects a fluid at a pressure and a direction that cuts produce, a roller bar including one or more fingers extending radially outward and configured to receive produce from the fluid knife system, wherein the roller bar rotates on its axis turning the one or more fingers at the front end lifting the produce cut by the fluid knife system, a plurality of conveyers that receive the produce from the roller bar and are configured to transport the produce through the harvester, and a bin system configured to receive the produce from the plurality of conveyers and package the produce into one or more bins.
US10721859B2

An example machinery includes an automated crop management motorized vehicle having an intelligent, modularized image sensor (e.g. camera or video) system that is portable to other crop management vehicles such as a combine, planter or a tillage machine. The image sensor system includes a framework having a bank of procedures for monitoring and control of navigation, spray application, weeding, seeding, machine configuration, in real time as the machines go through a crop field throughout a crop cycle. One example implementation includes electronic circuits, with more than one set mounted on a platform that facilitates moving the setup to other agricultural machines. The framework captures, preserves and corrects the captured images for real time analysis and response, and for spray management to improve crop yield that is correlated with the machine settings and crop management practices.
US10721857B2

A farming system includes a field engagement unit. The field engagement unit includes a support assembly. The support assembly includes one or more work tool rail assemblies. The field engagement unit additionally includes one or more propulsion units which provide omnidirectional control of the field engagement unit. The field engagement unit additionally includes one or more work tool assemblies. The one or more work tool assemblies are actuatable along the one or more work tool rail assemblies. The farming system additionally includes a local controller. The local controller includes one or more processors configured to execute a set of program instructions stored in memory. The program instructions are configured to cause the one or more processors to control one or more components of the field engagement unit.
US10721855B2

An agricultural system includes a frame configured for attachment to a leading tow bar of a towing vehicle, and at least one roller device attached to the frame and extending between two adjacent parallel strip positions. The roller device is configured to crush standing residual plant matter in the field. The system further includes a fertilizer opener disk attached to the frame and which is configured to prepare, at least in part, a furrow for receiving a fertilizer. The system also includes a fertilizer injector attached to the frame and which is configured to deposit the fertilizer into the furrow in a trailing position relative to the fertilizer opener disk.
US10729050B2

Systems and methods for fine pitch component placement on printed circuit boards are described. In one embodiment, a printed circuit board includes multiple vias and multiple of electrically conductive pads. The multiple vias include at least a first via and a second via. The multiple electrically conductive pads include a first pad and a second pad. The first pad and/or the second pad may include an electrically conductive material such as copper, silver, gold, or another conductive material. In some cases, the first pad and the second pad each have a reduced width portion positioned between and spaced apart from the first via and the second via.
US10729038B1

Mobile devices executing applications utilize data services worldwide. An application executing on these mobile devices may be tested using proxy access devices (PADs) located at various points-of-presence (POPs) at different geolocations. A PAD retainer device is used to maintain a plurality of PADs in a high density arrangement while still permitting adequate cooling, wireless connectivity, and physical connectivity to a proxy host device. In one implementation, the PAD retainer device is configured to maintain a predefined physical configuration of the PADs mounted therein, while hot spots of the PADs are exposed to the ambient atmosphere to facilitate heat dissipation.
US10729026B2

A casing of an electronic device including a metallic housing and a first non-conductive spacer is provided. The metallic housing has an inner surface and an outer surface opposite to the inner surface, and the outer surface has a back side and lateral sides connecting with the back side. The inner surface is substantially a recessed structure. The metallic housing has a first gap communicating the inner surface and the outer surface, and the metallic housing further includes a second gap and at least one connecting terminal. The first non-conductive spacer is selectively disposed in the first gap of the metallic housing, and extends from a first side of the lateral sides of the metallic housing to the back side of the metallic housing.
US10729017B2

A circuit board includes a substrate and at least two through holes defined in the substrate. The substrate includes a first conductive circuit layer and a second conductive circuit layer. The first conductive circuit layer and the second conductive circuit layer are respectively formed on opposite surfaces of the substrate. A number of conductive strips are formed on an inner wall of each of the at least two through holes. The number of conductive strips on the inner wall of a first one of the at least two through holes faces the number of conductive strips on the inner wall of a second one of the at least one through hole.
US10729015B2

A pre-press head may be operated by an operating method. The pre-press head includes an adsorption unit and a control unit. The adsorption unit includes at least two vacuum adsorption structures each including a gas path and at least one gas hole communicated with the gas path. The control unit is configured to control, according to a size of a to-be-adsorbed object, formation of vacuum environment of each vacuum adsorption structure. The adsorption unit is configured to adsorb the to-be-adsorbed object under the control of the control unit. The solution provided by the application adjusts adsorption functions of the vacuum adsorption structures according to a size of a to-be-adsorbed circuit board, so that the pre-press head can be applicable to circuit boards having different sizes.
US10729004B1

A circuit board structure for preventing high-frequency signal leakage and a manufacturing method thereof are provided, in which the circuit board structure body includes a signal layer, a first ground layer, and a second ground layer. A first shielding film structure and a second shielding film structure are respectively covered on the upper surface and the lower surface of the circuit board structure body and are aligned and adhered, so that the upper surface, the lower surface and the entire board edge of the circuit board structure body are wrapped by the first shielding film structure and the second shielding film structure. The first shielding film structure includes a first conductive metal layer and a first insulating layer, and the second shielding film structure includes a second conductive metal layer and a second insulating layer.
US10728979B1

A lighting fixture may provide a proximal lighting effect and a distal lighting effect. In some cases, the lighting fixture may include a multi-channel driver and multiple groups of LEDs. Based on an adjustable input level, the driver may provide current to subgroups of the LEDs, arranged at various areas of the lighting fixture. Responsive to the level of the input, the driver may provide current to various LED subgroups at the various areas, such that a particular proximal effect is provided at a particular area of the lighting fixture based on the particular value of the input level. In addition, the distal lighting effect may have a stable value across the adjustments to the input level, and the corresponding adjustments to the proximal effects. The distal effect may be perceivable at a location remote from the lighting fixture, such as a work surface.
US10728976B2

A lighting apparatus may include light sources. Each light source may emit a different electromagnetic radiation having a different color temperature when turned ON. The lighting apparatus may include a voltage source providing power to the light sources and a controller. The controller may turn ON and OFF each light source such that each electromagnetic radiation of each light source comprises a series of pulses. The controller may alternate between turning ON each of the light sources with a speed sufficient to cause a perception of mixing the electromagnetic radiations of the light sources, thereby causing an appearance of a perceived light having a perceived color temperature different from the color temperatures of the light sources. To ensure that only one of the light sources is ON at a time, the controller may wait a predetermined time between turning OFF a light source and turning ON a subsequent light source.
US10728975B2

Described is a lighting system that includes a lighting device and a switching device. The switching device controls application of lighting power to the lighting device. Further, the lighting system includes an automation system that includes a non-transitory computer-readable medium having instructions stored thereon. The instructions are executable by a processing device to receive a lighting profile selection. Additionally, the instructions are executable to cycle the switching device to transmit a binary signal to the lighting device. The binary signal identifies the lighting profile selection and instructs the lighting device to emit a lighting profile identified by the binary signal.
US10728969B2

Aspects of the subject technology relate to control circuitry for light-emitting diodes. The control circuitry may operate a light-emitting diode using a multi-peak pulse-width-modulation signal. The control circuitry may include a multi-stage driver having a relatively larger driver stage for providing a direct current through a light-emitting diode and a relatively smaller driver stage configured to cooperate with a pulse-width-modulation controller to pulse-width-modulate a current through the light-emitting diode.
US10728959B2

A pane having an electric heating layer is described, including: a first pane having a surface; at least one electric heating layer that is applied to at least part of the surface and has at least one uncoated zone; at least two busbars, provided for connection to a voltage source, which are connected to the electric heating layer such that a current path for a heating current is formed between the busbars; and n separating lines which electrically subdivide the electric layer into m segments. The segments are arranged in the form of strips around the uncoated zone such that the current path for the heating current is at least partially guided around the uncoated zone and the segments have equal width and the sum of widths of segments is equal to the width of the electric heating layer.
US10728952B2

A network architecture and methods of managing packet data unit (PDU) sessions in a network are provided. The methods include PDU session establishment procedures, PDU session modification procedures, PDU session state transfer procedures, PDU session release procedures, and user equipment (UE) handover procedures.
US10728948B2

A method for operating a user equipment (UE) includes receiving, by the UE from a network, a mobile subscriber identifier for the UE, the mobile subscriber identifier being exclusively assigned to the UE within a wireless tracking area of the network, and transmitting, by the UE to a relay node, an initial message of an access procedure for accessing a user data service of the network, wherein the initial message comprises a request to connect to a control node of the network, and wherein the initial message includes the mobile subscriber identifier, and an indication to relay the initial message over a first signaling radio bearer (SRB) to the control node.
US10728944B2

There is disclosed a method for operating a network node in a wireless communication network, the network node being connected to a terminal via a first cell group. The method comprises receiving, by the network node, information indicating an activation status of the terminal regarding a second cell group, wherein the method further comprises transmitting, by the network node, further information based on the received information to the terminal and/or one or more further network nodes.The disclosure also pertains to related methods and devices.
US10728939B2

A wireless communication device establishes voice communication between a supported user and a selected remote device supporting another user via a point-to-point wireless ad hoc network link. The device selects a particular remote device, establishes an ad hoc network link with the selected remote device, and communicates voice communication signals with the selected remote device. Selection can be based upon a user interaction with the device which specifies the particular remote device. The user interaction can include interaction with a graphical representation of the particular remote device presented in a graphical user interface. The user interaction can include an audio command received via an audio interface of the device. The device can include one or more headset devices, including a pair of headset devices which can be switched between providing audio signals to a single user to supporting communication between separate users via an ad hoc network link.
US10728937B2

This disclosure relates to techniques for supporting narrowband device-to-device (D2D) wireless communication, including possible techniques for providing synchronization and master information block signals in an off grid radio system. A wireless device may provide D2D synchronization signals for a D2D communication group. The D2D synchronization signals may be provided using multiple frequency channels. The D2D synchronization signals may be provided on each respective frequency channel of the frequency channels during a respective portion of a D2D synchronization signal cycle in a sequential manner.
US10728931B2

Described herein are systems, apparatuses, and methods for performing proximity-based authentication operations using received signal strength indicator (RSSI) values. An expected proximity of devices to be paired is used to determine whether to execute a wireless personal area network (WPAN) connection process. This expected proximity is correlated with the RSSI value of received signals. By utilizing the RSSI value of received signals, embodiments do not utilize any additional hardware for performing the described proximity-based authentication process, and in some implementations, do not utilize any additional processes or routines to determine an RSSI value (e.g., some devices utilize RSSI values in order to adjust output power levels of transmitted signals, and thus, already execute processes or routines to determine RSSI values).
US10728930B2

A communications network is being accessed by a wireless device associated with a coverage class selected from a set of coverage classes. The wireless device performs a method comprising initiating network access to the communications network by transmitting a preamble sequence for random access on a physical random access channel during a starting opportunity defined by the coverage class of the wireless device. Each coverage class may be associated with a unique number of repetitions of the preamble sequence transmission.
US10728926B2

A user equipment (UE) receives, from a network, a semi-persistent scheduling (SPS) configuration and a physical uplink control channel (PUCCH) resource configuration. The PUCCH resource configuration may be included in the SPS configuration. When a change of an SPS operation is required, the user equipment transmits an SPS change request to the network and receives, from the network, an SPS resource grant activated according to the SPS change request. The user equipment changes allocation of a PUCCH resource allocated according to the PUCCH resource configuration, on the basis of the received SPS resource grant. For example, a timing at which or a period in which the PUCCH resource is allocated can be changed.
US10728925B2

A method, an apparatus, and a computer-readable medium for wireless communication are provided. The apparatus may be a base station. The apparatus may transmit a first grant to a UE. The apparatus may determine whether an acknowledgment to the first grant is received. When the acknowledgment to the first grant fails to be received by the apparatus, the apparatus may transmit, to the UE, a second grant including information regarding the first grant. In another aspect, an apparatus may be a UE. The apparatus may receive a first grant. The first grant may include a first Mayday bit. The apparatus may receive a second grant. The second grant may include a TTI count corresponding to a number of unacknowledged TTIs. The second grant may further include a second Mayday bit. The apparatus may determine an acknowledgment based on the TTI count and the first and second Mayday bits.
US10728918B2

The invention relates to a radio base station or user equipment for scheduling respectively performing uplink transmissions via an unlicensed cell configured between the user equipment and the radio base station. The UE can perform an uplink transmission via the unlicensed cell according to at least the following types. A first type spans a complete subframe duration and starts and ends at subframe boundaries followed by the UE. A second type spans a complete subframe duration and includes an additional time offset with respect to the subframe boundaries followed by the UE. A third type spans less than a complete subframe duration and includes an additional time offset with respect to the subframe boundaries followed by the UE. The UEs perform uplink transmissions according to one of the types in such a manner that at least between two directly-subsequent uplink transmissions a time gap with no uplink transmission occurs.
US10728917B2

Embodiments of the present invention disclose a method for obtaining a request of a station, an access point, and a station. The method includes sending, by an access point, a control frame to a station and receiving, by the access point, a frame requesting to send sent by each station according to the control frame. The method also includes performing, by the access point, resource scheduling on each station according to the received frame requesting to send.
US10728914B2

Certain aspects of the present disclosure generally relate to wireless communications, and more specifically to determining uplink narrowband regions based on downlink resources. An example method generally includes identifying one or more uplink narrowband regions within a wider system bandwidth, based on downlink resources, and communicating using at least one of the identified narrowbands.
US10728912B2

In an aspect of the disclosure, a method, a computer-readable medium, and an apparatus are provided. The apparatus obtain a signal from a remote wireless node. The apparatus may switch between a first mode and a second mode in response to the signal. The apparatus may sense the shared transmission medium and sense if an absence of traffic is detected. The apparatus may delay data transmission for a fixed time interval from detecting the absence of traffic. The apparatus may initiate the data transmission at the end of the fixed time interval if operating in the first mode or initiate the data transmission at the end of a random time interval following the fixed time interval if operation in the second mode.
US10728911B2

A method includes receiving at a device a request to send data to a destination device. The device includes first subscriber identity module (SIM) card information that enables first delivery according to a best-efforts delivery priority via a wireless network and includes second SIM card information that enables second delivery according to a quality of service delivery priority at or above a first delivery rate via the wireless network. The method includes determining, at the device, a first portion of the data to send using the first delivery based on a throughput value for data transmission to the destination device via the first delivery. The method also includes determining, at the device, a second portion of the data to send using the second delivery based on the throughput value. The second portion includes none of the data responsive to the throughput value being greater than a first threshold.
US10728907B2

A method and network node for determining radio resources for allocation to a downlink control channel in a communication network are disclosed. According to one aspect, a method includes receiving, over a predetermined measurement period, a plurality of reports from a wireless device, each report being indicative of a channel quality within at least a subband of an available bandwidth of the communication network. The method further includes for each subband for which at least one report has been received, determining a variance of the channel quality and an average of the channel quality over the predetermined measurement period. The method further includes determining subbands having at least a variance of the channel quality less than a first threshold.
US10728893B2

A structure where there are self-contained subframes/slots with smaller TTIs within the subframes/slots is provided to address the issues in MMW scheduling. In an aspect of the disclosure, a method, a computer-readable medium, and an apparatus are provided. The apparatus may transmit downlink information to at least one UE using a plurality of downlink TTIs within a subframe/slot. The apparatus may receive uplink information from the at least one UE using at least one uplink region within the subframe/slot. In another aspect of the disclosure, a method, a computer-readable medium, and an apparatus are provided. The apparatus may receive downlink information from a base station using at least one downlink TTI within a subframe/slot. The subframe/slot may include a plurality of downlink TTIs and at least one uplink region. The apparatus may transmit uplink information to the base station using the at least one uplink region within the subframe/slot.
US10728891B2

Embodiments of the present invention provide information sending and receiving methods and devices. The information sending method includes: determining, by a base station, a downlink subframe that is used to send first information to user equipment UE; and sending, by the base station, the first information to the UE by using the downlink subframe, where the downlink subframe is a first subframe, a second subframe, or a third subframe, where the first subframe includes at least two sub-physical resource block pairs, the second subframe includes at least two physical resource block pairs, and the third subframe includes at least one sub-physical resource block pair and at least one physical resource block pair. According to the embodiments of the present invention, an LTE communications system efficiently and flexibly supports various network architectures and various types of UEs.
US10728884B2

A communication technique for combining a 5G communication system for supporting a higher data rate after 4G system with IoT technology includes transmitting configuration information of one or more serving cells that operate in an unlicensed band to a terminal, transmitting information indicating that an uplink control channel and an uplink data channel can be simultaneously transmitted to the terminal, determining whether the terminal is configured to transmit at least one of data and the uplink control information through the uplink data channel in at least one of a licensed band and the unlicensed band, and receiving the uplink control information in at least one of the licensed band and the unlicensed band on the basis of the determination, wherein the configuration information includes unlicensed-band uplink control channel configuration information for configuring the uplink control channel in one of the serving cells that operate in the unlicensed band.
US10728883B2

Techniques for connection information for inter-device wireless data communication are described. In at least some embodiments, a broker device maintains wireless connection information for various wireless devices. The wireless connection information includes wireless channels at which particular wireless devices can be accessed. The broker device can provide the wireless connection information to various other devices to enable wireless communication with the wireless devices.
US10728879B2

A method of transmitting a device-to-device (D2D) signal by a user equipment (UE) in D2D communication is disclosed. The method for transmitting a D2D signal includes the steps of performing frequency hopping for physical resource blocks (PRBs) in a resource block pool based on a predefined hopping patter, and transmitting a D2D signal using the PRBs. The resource block pool is configured by means of higher layer signaling and the transmission of the D2D signal occurs only when PRBs for transmitting the D2D signal are consecutive in a subframe.
US10728874B2

A mobile node includes a plurality of transceivers, has a network conforming to network-based mobility as its home link and performs position registration to a positional managing apparatus and performs position registration to the position managing apparatus through a foreign network by position registration conforming to host-based mobility. In mobile node and position managing apparatus, a plurality of routes passing through the home link and the foreign link are established. Accordingly, when the mobile node has the plurality of transceivers, it can simultaneously connect to the home link and the foreign link through respective transceivers, to perform communication.
US10728873B2

An embodiment of a semiconductor package apparatus may include technology to determine if one or more co-located radio transmitters and radio receivers are in a tracked area, enable an active tracking mode if one or more of the co-located radio transmitters and radio receivers are determined to be in the tracked area, and periodically transmit identification information from at least one of the radio transmitters if the active tracking mode is enabled. Other embodiments are disclosed and claimed.
US10728865B1

The present disclosure includes systems and techniques relating to multi-antenna coherent combining (MACC) for carrier sensing (CS) and symbol timing (ST) in a wireless communication system. In some implementations, a device includes a receiver and processor electronics. The receiver is configured to receive two or more signals from two or more antennas, each of the two or more signals including a known, periodic reference signal that has gone through a respective wireless channel via one of the two or more antennas. The processor electronics are configured to obtain estimated phases of the two or more signals from the two or more antennas; obtain a combined signal by combining the two or more signals with coherent estimated phases of the two or more signals; and perform carrier sensing and symbol timing of the two or more signals based on the combined signal.
US10728863B2

The present application discloses a method for data transmission in a radio cell of a mobile terminal. The radio cell includes an auxiliary carrier in a low frequency band and at least one master carrier in a high frequency band, the method including: the mobile terminal achieving downlink synchronization with the radio cell through the auxiliary carrier in the low frequency band, and after achieving the downlink synchronization, obtaining configuration information of the radio cell, and transmitting data by using the master carrier and/or the auxiliary carrier according to the configuration information. The present application also provides a mobile terminal. By using the present application, radio cell coverage and transmission performance may be improved.
US10728861B2

Methods, systems, and devices for wireless communication are described. A wireless device may identify a transmission mode for transmission of an input signal to be transmitted. The input signal may thus be modulated according to the identified transmission mode, and the modulated signal may then be transmitted at some power level to produce a transmitted signal having a spectral envelope. In some cases, the spectral envelope may be defined in terms of a power spectral density (PSD) of the transmitted waveform. The PSD may generally define the power of the waveform signal distributed over frequencies of the waveform. Further, the wireless device may control the modulation of the input signal, in addition to the power level of the input signal, to maintain the spectral envelope to be within a spectral mask defined for the implemented transmission mode as well as to conform to spectral flatness parameters.
US10728852B2

Methods, systems, and devices for wireless communication are described. A user equipment (UE) may monitor a narrowband (e.g., a single carrier, anchor carrier, etc.) for a control message that includes a grant for downlink data transmissions. The narrowband containing the control message may be a portion of a system bandwidth. The UE may then monitor a wideband (e.g., all or multiple carriers of the system bandwidth) for data according to the control message. Monitoring the wideband may include additional or alternate circuitry being powered (e.g., receiver circuit switching) to enable reception on an increased range of frequency spectrum. In some examples, a gap or narrowband data transmission may be scheduled between the control message and the grant to allow grant processing and receiver circuitry switching at the UE. In some cases, the control message and data transmission may be received in the same or different transmission time intervals (TTIs).
Patent Agency Ranking