US12188670B2
A building system that operates to receive building data from one or more building systems of the building, wherein at least a portion of the building data is associated with control of the one or more environmental conditions of the building and generate, based on the building data, a plurality of building health scores of the building, wherein an overall building health score is based on a combination of the plurality of building health scores. The building system operates to receive user feedback regarding the plurality of building health scores via one or more user devices, determine whether the user feedback confirms or denies an accuracy of the plurality of health scores, and generate a user interface and cause the user interface to display an indication of whether the user feedback confirms the accuracy of the plurality of building health scores.
US12188663B2
A cooking device includes a frame to form a cooking chamber; a burner disposed in the cooking chamber and to generate a flame for supplying heat to the cooking chamber; a burner cover in which the burner is installed and having a plate with an outlet opening through which an air passes; a fan to flow an air of the cooking chamber; and a stabilizer to reduce an influence of the air on a flame of the burner when the air of the cooking chamber passes through the outlet opening of the burner cover by the fan. The stabilizer includes: a body having an opening for air passage; a barrier extended from the body; and a fastening unit for fastening the body to the burner cover, and while the fastening unit is fastened to the burner cover, the body is spaced apart from the plate of the burner cover.
US12188657B2
A gas burner device includes an orifice holder including an orifice. The gas burner device also includes a burner body. The burner body includes a venturi tube arranged to receive a gas from the orifice and a burner port discharging the gas supplied through the venturi tube. The venturi tube includes a venturi inlet through which the gas that is jetted from the orifice flows in. The venturi tube also includes a venturi outlet through which the gas flowing in through the venturi inlet is discharged. The venturi tube further includes an acceleration part including a smaller diameter than the venturi inlet and the venturi outlet and includes a cylindrical shape.
US12188655B2
A luminaire including an LED light source, a plurality of color filters, an optical device, and a control system is provided. In response to receiving an optical device setting value via a data link, the control system moves the optical device according to the setting value, calculates modified positions for one or more of the color filters based on an effect of the optical device on the color of the light beam of the luminaire, and causes the one or more color filters to move to their modified color filter positions, in order to reduce the effect of the optical device on a beam color emitted by the luminaire.
US12188650B2
A lighting device includes a substrate, light sources having a first light source on the substrate, a resin layer sealing the plurality of light sources on the substrate; and a light transmitting layer on the resin layer. A surface of the resin layer has an upper surface and side surfaces, and the side surfaces of the resin layer has a convex curved surface. The light transmitting layer has a first flat region on the upper surface of the resin layer and a second curved region on the side surfaces of the resin layer. The convex curved surface of the resin layer and the second curved region of the light transmitting layer overlap the first light source in a vertical direction, and a corner between two adjacent the side surfaces of the resin layer has a convex curved surface.
US12188647B2
Disclosed is a combination plug that provides both AC and DC power to an artificial pre-lit tree. Connector assemblies between trunk sections of the artificial tree connect both AC and DC power between the trunk sections. DC power sockets are provided on the trunk sections so that light strings can be plugged into the trunk sections and receive DC power.
US12188641B2
A yoke for a suspension system for a medical lamp comprises a rigid yoke member having a first end and a second end, a first revolving joint-component fixed to the first end, wherein the first revolving joint has a first rotation axis, and a second revolving joint-component fixed to the second end, wherein the second revolving joint has a second rotation axis. The first rotation axis is included in a plane and the second rotation axis intersects the plane or is included in the plane, and the first rotation axis and a projection, onto the plane, of the second rotation axis intersecting the plane or the second rotation axis included in the plane enclose an angle (α) of more than 0 degrees and less than 90 degrees.
US12188637B1
A portable light having a swivel light, a handle and a swivel arm. The portable light will rotate in a number of directions and may be held in the hand or attached by one or more magnets to a metal surface.
US12188636B2
A display device is provided, including a display panel and a backlight module for providing a light passing through the display panel. The backlight module includes a plurality of cushion elements, wherein at least portion of the plurality of cushion elements has a less deformation modulus than the display panel.
US12188621B2
A system for minimizing heat leaks to a liquid cryogen pump incorporating a bayonet includes a male bayonet portion received in a female bayonet portion, each having a circular cross-section and comprising an outer pipe surrounding an inner pipe and an annulus therebetween which is under vacuum, wherein a liquid cryogen pump is contained within an interior of the male bayonet portions.
US12188618B2
A method of checking a pressure of an agent cylinder that includes coupling a gauge assembly to an outlet of a gauge tool, the gauge assembly having a pressure gauge and a vent valve movable between an open position and a closed position. The method further includes moving the vent valve towards the closed position; attaching a fill adapter defining an inlet of the gauge tool to a valve port of an agent cylinder; and actuating a drive member of the gauge tool in a first direction to move a valve member of the gauge tool from a first position towards a second position to facilitate a fluid flow between the inlet and the outlet of the gauge tool.
US12188617B2
A protective device for a pressurized gas tank comprises a shell designed to absorb energy in the event of an impact and a mechanical joining interface to mechanically join the shell to the pressurized gas tank.
US12188615B2
A machine lubrication system includes a bellows-type container filled with lubricant that connects to a support base of a pump of the lubrication system. The container includes a neck extending from a convex bottom surface of the container. The support base includes a concave mounting surface and a passageway in communication with an inlet of the pump. The neck sealingly attaches the container to the passageway with the bottom surface of the container on the mounting surface the support base.
US12188611B2
A lubricant bath structure includes a casing for storing a liquid lubricant, where: the casing is provided with a supply hole, a discharge hole, a part attachment hole, and a liquid level check hole that penetrate from inside to outside of the casing; the supply hole enables injecting the lubricant into the casing; the discharge hole enables discharging the lubricant in the casing; the part attachment hole is opened/closed by detaching/attaching a mechanism part that is to be detachably attached to an outside surface of the casing; and the liquid level check hole can be arranged at a position coincident with or lower than a lower edge of the part attachment hole, but higher than the discharge hole, and, during the discharge of the lubricant, it is possible to confirm that a liquid level of the lubricant has reached below the lower edge of the part attachment hole.
US12188597B2
An improved quick release coupling is provided. The quick release coupling enables higher fluid flow rates and lower pressure drops. The quick release coupling is configured to be a connection and disconnection under high pressure conditions on one or both of the male and the female sides of the coupling. The quick release coupling enables intentional manual disconnection as well as breakaway disconnection under high working pressures.
US12188594B2
A coupling fitting comprises a cylindrical first body having a first end portion, a first coupling part having a plurality of first protrusions arranged around the first end portion and having hooks formed thereon, and a first seal material provided on an outer circumference of the first end portion. A gap is formed between the outer circumference and the plurality of first protrusions. When the coupling fitting is coupled with the target fitting, a part of the target fitting is inserted into the gap, the hooks of the plurality of first protrusions engage the target fitting, and the first seal material contacts an inner circumference of the target fitting.
US12188592B2
Provided is a connection assembly for connecting to inner and outer hoses. The connection assembly includes a first connector assembly, a second connector assembly, a first hose connector assembly coupled to the connector assembly and configured to be coupled to the inner and outer hoses, the first hose connector assembly including a first tube connector configured to be coupled to the inner hose and a first collar configured to be coupled to the outer hose, and a second hose connector assembly coupled to the second connector assembly and configured to be coupled to the inner and outer hoses, the second hose connector assembly including a second tube connector configured to be coupled to the inner hose and a second collar configured to be coupled to the outer hose, wherein the second tube connector has a cross-sectional area that is smaller than a cross-sectional area of the first tube connector.
US12188591B2
A support clamp is provided for supporting an elongate object. The support clamp can include a clamp body that forms a cylindrical sleeve and a collar that extends radially inwardly from the cylindrical sleeve to provide an internal passageway sized to receive the elongate object. The clamp body can include first and second clamp sections that can each have, respectively, a sleeve wall that forms part of the cylindrical sleeve and a collar wall that forms part of the collar and includes an edge that extends radially between the sleeve wall and the internal passage. The edge of the first clamp section can include a channel profile, and the edge of the second clamp section can include a protruding profile. The protruding profile can be received into the channel profile to removably secure the first and second clamp sections together.
US12188587B2
A device and method of positioning a component on a cable. The method includes: moving a collet into position on the component; engaging the component with the collet; moving the collet with the component positioned thereon into alignment with an end of the cable; securing the collet to the end of the cable; moving the component from the collet to the cable; and removing the collet from the end of the cable.
US12188584B2
A fluid connection assembly, including a connector body, including a first end, a second end, a through-bore, and a radially outward facing surface including a groove, the groove including a first width, and a retainer operatively arranged to be removably connected to the connector body, the retainer including a third end, a fourth end, a first section, a second section displaceable with respect to the first section, a radially inward facing surface, a first flange extending radially inward from the radially inward facing surface and operatively arranged to engage the groove, the first flange including a second width, the second width being less than the first width, and a second flange extending radially inward from the radially inward facing surface.
US12188576B2
According to an embodiment of the present invention, there is provided a method of diagnosing an abnormal state of a valve including: applying a current having a predetermined intensity to a valve; estimating a resistance value of the valve on the basis of an intensity of a feedback current from the valve according to the application of the current and a voltage between both terminals of the valve; and when a difference between a resistance value of the valve estimated at a first time point and a resistance value of the valve estimated at a second time point is greater than or equal to a threshold, determining that abnormality has occurred in the valve.
US12188573B2
A spool valve includes a sleeve having a plurality of ports, and a spool arranged inside the sleeve and having a land formed so as to be brought into sliding contact with inner walls of the sleeve. A depression is formed in the land over an entire circumference.
US12188570B2
A valve guide includes a valve guide body having a valve guide bore along a central axis thereof. In an assembled configuration of a horizontal valve assembly comprising the valve guide, a valve stem passes through the valve guide bore, connecting a valve body to the valve guide. The valve guide further includes first and second skis that each extends radially outward from the valve guide body to a lower wing outer surface, such that the lower wing outer surface is a first radial distance from the valve guide bore central axis; and an upper wing extending radially outward from the valve guide body to an upper wing outer surface. The upper wing outer surface is a second radial distance from the valve guide bore central axis. The first radial distance is greater than an interior radius of a housing bore the horizontal valve assembly is positioned in for use.
US12188565B2
A valve device, in particular a lifting valve device, includes a housing, a valve seat, and a movable closing body that can be brought into an open position in an opening movement and into a closed position in a closing movement. In the closed position, the closing body and the valve seat are in sealing contact. The valve device also includes a piston to which a pressure medium can be applied and that is received in a cylinder. To improve hygienic properties, it is proposed that the cylinder is part of the closing body.
US12188564B2
A piston ring includes a substrate, and a film covering at least a part of a surface of the substrate. The film includes Si and N. A Si content of the film is in a range of 1.1 to 7.5 at %, a crystallite size of the film is in a range of 10 to 30 nm, and a compressive residual stress of the film is 400 to 800 MPa.
US12188555B2
The present invention provides a shift control method include: setting a basic target synchronization rotation speed that is a basic target value of the input shaft rotation speed during the shift; determining whether or not an accelerating intention is present when the shift is a downshift with a driving force requirement to the vehicle; when the accelerating intention is present, setting a first target input shaft rotation speed as the target input shaft rotation speed, the first target input shaft rotation speed being obtained by increasingly correcting the basic target synchronization rotation speed; and when the accelerating intention is not present, setting a second target input shaft rotation speed as the target input shaft rotation speed, the second target input shaft rotation speed being obtained by maintaining or decreasingly correcting the basic target synchronization rotation speed.
US12188554B2
Provided is a control apparatus for vehicle that enables a driver to activate and deactivate a freewheeling mode at his/her discretion. A control apparatus 1 for vehicle switches the vehicle to a freewheeling mode in which power generated by an engine 2 of the vehicle is not transmitted to drive shafts 7 of the vehicle. The control apparatus 1 for vehicle includes: a decelerator having a plurality of deceleration gear stages for changing deceleration of the vehicle; and a manipulator 10 provided on steering 11 of the vehicle and configured to allow selection of the freewheeling mode in accordance with an operation performed by a driver. The vehicle transitions to the freewheeling mode upon the freewheeling mode being selected through an operation of the manipulator 10.
US12188552B2
An electric beam axle for use in an electric or hybrid motor vehicle includes a valve positioned between a differential case and an axle tube. The valve includes a valve housing with a fluid flow path extending through the valve housing, and a valve member positioned within the fluid flow path of the valve housing. The valve can also include a stop coupled to the valve housing, the stop being configured to retain the valve member within the fluid flow path of the valve housing. The valve member is configured to prevent fluid from flowing through the fluid flow path and into the axle tube of the electric beam axle when the electric or hybrid motor vehicle is driving across steep road grades and/or under lateral acceleration (cornering) events.
US12188551B1
An engine assembly is provided that includes a geartrain, a rotating structure, a support structure and a bearing. The rotating structure is rotatable about an axis. The rotating structure forms a first component of the geartrain. The rotating structure includes a shaft and a rotating structure passage. The support structure circumscribes the shaft with a plenum, where the plenum is formed by and radially between the support structure and the shaft. The support structure includes a support structure passage. The plenum fluidly couples the support structure passage to the rotating structure passage. The bearing rotatably couples the shaft to the support structure.
US12188542B2
A transmission for a power train of a motor vehicle has a first stationary housing part having a first axial contact surface, a second stationary housing part, and a first sealing element on the second stationary housing part, the first sealing element being axially compressible. Additionally, the transmission includes a first planetary gear set including a planet carrier, at least one planet gear, a sun gear, and a ring gear. The planet carrier is fixed relative to one or both of the first stationary housing part and the second stationary housing part. One side of the planet carrier rests against the first axial contact surface, where the first sealing element acts on another side of the planet carrier to axially preload the planet carrier against the first axial contact surface to prevent the planet carrier from tilting relative to a rotation axis of the first planetary gear set.
US12188538B2
A container system including an outer shell, a deck disposed within the outer shell and configured to support cargo, and at least one vibration isolator member to support the deck within the outer shell and reduce or dampen a transfer of shock or vibration to the deck. Each vibration isolator member includes a hollow, flexible body configured to resiliently compress in response to a force. At least one fastener interface secures the flexible body to the bottom wall or to the deck. The hollow, flexible body has one or more apertures to allow fluid flow into and out of an inner cavity of the flexible body during compression or expansion.
US12188537B2
A fluid-filled vibration damping device including a movable film housed within a housing space of a partition partitioning a pressure receiving chamber and an equilibrium chamber. An outer peripheral end of the movable film includes a contact part and a sealing part being respectively in contact with a pressure receiving chamber-side wall inner surface and an equilibrium chamber-side wall inner surface of the housing space. A communication passage, which communicates with a gap circumferentially between the movable film and the housing space, is provided away from the contact part in the outer peripheral end of the movable film. The outer peripheral end of the movable film will be separated from the equilibrium chamber-side wall inner surface due to a pressure differential arising between the two chambers so as to form a relief passage interconnecting the two chambers including the gap and the communication passage.
US12188503B2
A system, including a pin having a first cylindrical portion defining a first central axis and a second cylindrical portion defining a second central axis that is parallel to and offset from the first central axis, a first plate with a first aperture matching with the cross section of the first cylindrical portion; a second plate with a second aperture matching with the cross section of the second cylindrical portion, the second plate lying against the first plate where the first cylindrical portion of the pin is inserted in the first aperture and includes a first surface that axially abuts against the second plate and wherein the second cylindrical portion of the pin is inserted in the second aperture and includes a second surface that axially abuts against the first plate.
US12188502B2
A one piece staple strip is provided, including: a plurality of staples, each of the plurality of staples including two leg portions and a crown portion connected with and between the two leg portions; a connection portion, connected with and between every neighboring two staples of the plurality of staples; and a stop portion, projecting laterally from the leg portion of each of the plurality of staples and defining a holding space with the crown portion of each of the plurality of staples, the holding space being configured to receive a cable; wherein each of the two leg portions of each of the plurality of staples includes a spike section extending from the stop portion.
US12188500B2
The heater assembly includes a case having a heating element therein, a channel extending through the case and having a size and shape for selectively receiving therethrough a first end of an elastomeric fixture outstretched through a substrate to a first length having a first width, and a heat transfer surface positioned relative to the heating element for receiving generated heat therefrom. The heat transfer surface is generally positionable relative to the substrate to cooperate with an adhesively bondable attachment coupled to a second end of the elastomeric fixture opposite the first end and including an uncured bonding agent disposed thereon. The heater assembly and attachment simultaneously sandwich the substrate in compression engagement in between when the elastomeric fixture extends through the substrate into the central channel and relaxes to a second relatively shorter length having a second relatively larger width.
US12188499B2
An oral care system includes a fluid reservoir, a check intake valve, and a pump configured to cause fluid to be provided from fluid reservoir to an oral insert of the oral care system via the check intake valve. The fluid reservoir includes one or more fluid flow disrupters. The check intake valve is located at an offset from a center of the fluid reservoir.
US12188495B2
A pressure-medium cylinder does not have a component that dynamically seals the piston rod and can be well-cleaned safely from outside. The pressure-medium cylinder includes a cylinder housing, a piston, a piston rod, and a static end-position seal. The piston is axially movably disposed in the cylinder housing. The piston rod is connected to the piston and penetrates the cylinder housing toward an end face through an outlet opening. The piston rod has a stop surface extending radially from the piston rod in a piston rod portion disposed outside of the cylinder housing. The stop surface contacts the cylinder housing in an end position during retracting of the piston rod and thus sealingly covers and/or extends around a gap region or gap regions between the piston rod and an edge of the outlet opening.
US12188484B2
Lock protrusions 4s are projectingly provided to a peripheral edge part of an intake opening part 4c of a first case 4a at a plurality of positions. A removal hole 4t whose width becomes narrower from an upstream side to a downstream side in a rotational direction of a centrifugal fan 2 is provided to extend on a radial-direction outer side of each lock protrusion 4s. An inclined surface F is chamfered to continue to an outer-peripheral-side peripheral edge part 4t1 of the removal hole 4t, the peripheral edge part 4t1 facing to an inner wall surface 4a1 of the first case 4a.
US12188479B2
A fan assembly for a clothes treatment device and a clothes treatment device. The fan assembly includes an air passage housing defining an installation cavity; an impeller rotatably provided in the installation cavity; and a motor provided in the air passage housing and including a stator and a rotor. The stator is fitted over an outside of the rotor, and the rotor is configured to drive the impeller to rotate. The motor extend towards an upper cover of the clothes treatment device and/or an inner wall of the air passage housing. A distance between an upper end of the motor and the upper cover is h1, and the h1 is greater than or equal to 5 mm. A distance between a lower end of the motor and the inner wall of the air passage housing in a vertical direction is h2, and the h2 is greater than or equal to 0.5 mm.
US12188476B2
A fan including: a motor stator; an axial diffuser, fixedly connected to the motor stator and comprising an outer cylinder, a main body portion disposed in the outer cylinder, and diffuser blades connected to the outer cylinder and the main body portion, the diffuser blades separating an annular space between the outer cylinder and the main body portion into more than one pressure diffusion ducts, the main body portion being provided with a central shaft hole; an air inlet cover, fixedly connected to the axial diffuser, the air inlet cover and the axial diffuser forming an impeller chamber and an annular no-gate channel around the impeller chamber, the annular no-gate channel communicating with the impeller chamber and the pressure diffusion ducts, and the air inlet cover being provided with an air inlet; and an impeller, disposed in the impeller chamber and used to introduce air from the air inlet.
US12188474B2
A roots pump comprising: a rotary shaft; a rotor having a hole-forming surface that forms an insertion hole, and a first bearing and a second bearing. Each of the first bearing and the second bearing includes an inner ring and an outer ring. The rotary shaft is press-fitted in the inner ring of the first bearing, and fitted in the inner ring of the second bearing with a clearance between the rotary shaft and the inner ring of the second bearing. An edge portion of the hole-forming surface adjacent to the first bearing serves as a press-fitting portion in which the rotary shaft is press-fitted, and at least an edge portion of the hole-forming surface adjacent to the second bearing serves as a clearance-fitting portion in which the rotary shaft is fitted with a clearance between the rotary shaft and the clearance-fitting portion.
US12188462B2
The packing seal for a piston compressor, having a longitudinal axis L as well as, following one after the other in the direction of the longitudinal axis L, a fastening part and a cylindrical part, wherein a magnetic bearing and at least one chamber ring with a sealing ring arranged therein are arranged following one after the other in the direction of the longitudinal axis L in the cylindrical part, wherein the magnetic bearing includes at least one controllable electromagnet.
US12188459B2
A valve plate of a hydraulic pump/motor, includes a high pressure-side port and a low pressure-side port, a first oil groove provided to be endless in an outer peripheral part of the high and low pressure-side ports, and a plurality of second oil grooves. Further, a plurality of pad oil grooves communicating with the first oil groove and opened toward the end face of the cylinder block is provided in an outer peripheral portion of the high pressure-side port, at least in a portion being on a downstream side of the relative rotation, in a pad region contacting the end face of the cylinder block, and the plurality of pad oil grooves is provided such that a proportion of an opening area to the end face of the cylinder block is larger on the downstream side than on an upstream side of the relative rotation.
US12188454B2
A nacelle for a wind turbine, the nacelle comprising: a drivetrain with a drivetrain axis, at least two torque arms positioned around the drivetrain axis and attached to a member of the drivetrain, and a frame attached to a yaw bearing. The torque arms of the drive train are supported by the frame and at least one of the torque arms has an orientation deviating at least substantially from being horizontal.
US12188453B2
Arrangement for lowering and raising service tools used for wind turbine blade and tower maintenance
An offshore wind turbine blade and tower maintenance devices and systems, more particularly, to the system for service tools positioning relative to the offshore wind turbine blade and tower. An arrangement for lowering and raising service tools used for offshore wind turbine blade and tower maintenance, having: a truss system, a rigging and a rigging pulling in and letting out means. The truss system, includes booms, pivotally attached to a supporting means, which are adapted to be leaned against or releasably fixed to a wind turbine tower or wind turbine tower mooring elements; wherein the rigging and a rigging pulling in and letting out means are operably connected with the truss system, so to allow lowering and raising service tools used for offshore wind turbine blade and tower maintenance.
US12188451B2
A noise reduction element extends between a first end and a second end in a first direction. The noise reduction element extends between a third end and a fourth end in a second direction perpendicular to the first direction. The noise reduction element includes a base part configured to be attached to a trailing edge of a wind turbine blade. The base part has a first base part surface and a second base part surface. The base part extends between the first end and a first position in the first direction. The noise reduction element includes a first serration part having a serration pressure surface and a serration suction surface and extending in the first direction between the first position and the second end. The first serration part has a thickness in a third direction between the serration pressure surface and the serration suction surface.
US12188442B2
An aquifer storage and recovery system can include a pump, an electric motor coupled to the pump, a drive unit configured to control operation of the electric motor, and a controller. The controller can be configured to flow water into a well bore from a source reservoir through the pump such that the pump rotates in a reverse direction and drives the electric motor coupled to the pump in the reverse direction to operate as a generator, determine a power output of the electric motor, determine a difference between the power output of the electric motor and a power output set point, and operate the drive unit to control a rotational speed of the electric motor based at least in part on the difference between the power output of the electric motor and the power output set point.
US12188440B2
A valve assembly for a fuel pump and having: a one-way outlet closing valve, which only allows fuel to flow out; a one-way pressure relief valve, which only allows fuel to flow in; a connector, which has a housing on the inside; and a valve disc, which engages the housing of the connector and has a plurality of through outlet holes and a through relief hole. A shutter of the outlet closing valve consists of a flexible sheet, which is fixed to the valve disc and has: a plurality of shutting portions arranged in the area of the outlet holes; a peripheral mounting portion with an annular shape; a plurality of outer connection portions, each connecting the peripheral mounting portion to a corresponding shutting portion; a central mounting portion; and a plurality of inner connection portions, each connecting the central mounting portion to a corresponding shutting portion.
US12188438B1
An automobile air intake system that has a detachable transparent window assembly for visually inspecting the air filter is contemplated. A user may inspect the air filter by viewing the air filter through the transparent window assembly. Alternatively, the user may remove the window assembly from the air intake system to provide an unobstructed view of the filter. The window assembly may be releasably secured to an airbox with magnets and magnetic materials. The airbox and window assembly may be contoured about the air filter, to provide a larger section of the filter to be viewed and inspected.
US12188437B2
Exhaust gas recirculation pump (30) for an internal combustion engine that includes an electric motor (32) disposed within a housing (36). A Roots device (38) is coupled to the electric motor (32) and includes a housing (40) defining an internal volume (42) in which rotors (44) are disposed and are connected to the electric motor (32). The electric motor housing (36) includes a coolant path (48) formed therein which extends from a coolant inlet (58) to a coolant outlet (78), both coupled to an engine coolant circulation system. The housing includes an oil path (108) formed therein. The oil path includes an oil inlet (110) extending to at least one oil outlet (112). The oil inlet and outlet are coupled to an engine oil circulation system wherein the oil path (108) lubricates bearings (100) and a transmission assembly (46) of the exhaust gas recirculation pump (30).
US12188435B2
Disclosed is a dual-mode ramjet engine including: a combustor through which air flowing in from the front passes; a sliding injector configured to perform a sliding operation from an upper surface of the combustor along a height direction perpendicular to an air flow direction; and a cavity-type flame holder formed behind the sliding injector on the upper surface of the combustor and having a cavity that is concavely recessed, wherein the sliding injector includes: a plurality of fuel injection holes formed on both sides and configured to inject fuel; a fuel injection passage passing through the inside along the height direction to be opened downward, and configured to inject fuel; and a first sliding drive unit configured to drive the sliding injector to perform the sliding operation.
US12188432B2
A device for attaching a connecting rod small end for a thrust reversal cascade flap onto a fixed internal structure of a turbojet engine nacelle includes a fitting configured to be fixed to the internal structure and a connection interface forming a joint between the connecting rod small end and the fitting. The device further includes a removable fork configured to cooperate with the connection interface, wherein the fork and the connection interface are arranged inside the fitting.
US12188430B2
A crankcase includes: at least one cylinder for an internal combustion engine, the cylinder including: a cylinder interior; a cylinder liner which is arranged within the cylinder interior; a cylinder head which closes the cylinder interior, wherein the cylinder head includes a receiving way; a cooling system which guides a coolant flow and has a cooling chamber; a distribution system to separate the coolant flow into a primary partial flow and at least one secondary partial flow, the distribution system including a main channel for the primary partial flow and at least one branch-off passage for the at least one secondary partial flow, the at least one branch-off passage branching off from the main channel and being arranged transversely to the main channel for the at least one secondary partial flow.
US12188425B2
The disclosure relates to a method for determining a size of a leak in a fuel tank system. The method includes: starting an internal combustion engine; calculating a stoppage time for a vehicle and/or a temperature difference between the fuel in the fuel tank system and the environment; and checking whether at least one of a plurality of diagnostic conditions is fulfilled. A first diagnostic condition is fulfilled when the stoppage time is longer than a predetermined minimum stoppage time. A second diagnostic condition is fulfilled when the temperature difference is smaller than a predetermined maximum temperature difference. Additionally, when at least one of the plurality of diagnostic conditions is fulfilled, the method includes: evacuating the fuel tank system; recording a time profile of the pressure in the fuel tank system; and determining the size of a leak based on the recorded time profile of the pressure.
US12188423B2
In a cylinder deactivation control method of an engine, a cylinder deactivation trigger moment of a to-be-controlled engine is determined; a second cycle and a cylinder deactivation mode corresponding to the next first cycle are determined according to the crankshaft rotation speed at the cylinder deactivation trigger moment, the target torque at the cylinder deactivation trigger moment, and a second cycle and a cylinder deactivation mode corresponding to the current first cycle at the cylinder deactivation trigger moment; the cylinder pressure type of each cylinder in the current first cycle is determined in conjunction with the cylinder deactivation modes of three adjacent first cycles; the fuel injection quantity of each ignition cylinder in the current first cycle is determined based on the calibrated preset fuel injection quantity chart of the first cycle.
US12188417B1
A fan drive gear system for a turbine engine includes a carrier that supports rotation of the plurality of intermediate gears and is configured for rotation about the axis. A rotating oil inlet and rotating gutter are attached to the carrier. A transfer bearing is fixed to a static engine structure and engaged to communicate oil to the rotating oil inlet. A static baffle that is disposed radially outward of the transfer bearing and configured to direct oil that is expelled from the transfer bearing into the rotating gutter.
US12188411B2
A state determining device determines a state of a gas turbine connected to an electric generator. The gas turbine includes a compressor that compresses intake air into compression air, a fuel supply device that supplies fuel, a combustor that mixes the compression air supplied from the compressor and the fuel supplied from the fuel supply device and combusts a resultant mixture to generate combustion gas, and a turbine that is rotated with the generated combustion gas.
US12188396B2
A controller for controlling regeneration of a selective catalytic reduction (SCR) catalyst of an aftertreatment system is configured to cause increase in a SCR catalyst temperature of the SCR catalyst to a first regeneration temperature, the first regeneration temperature being lower than a high regeneration temperature that is equal to or greater than 500 degrees Celsius. The controller is configured to determine an amount of ammonia slip downstream of the SCR catalyst; and cause an increase in the SCR catalyst temperature to a second regeneration temperature greater than the first regeneration temperature but lower than the high regeneration temperature based on the determined amount of ammonia slip.
US12188389B2
A method for filling a silencer with a sound absorbing material in which an inside of a shell is partitioned into a plurality of silencing chambers by a separator and at least one silencing chamber is filled with the material, the method including: forming a hole at the silencing chamber to be filled with the material in the shell; inserting a filling nozzle into the silencing chamber from the hole; injecting the material from the filling nozzle into the silencing chamber S2 for filling; and externally sealing the hole opening to the shell with a hole sealing member. An outer peripheral flange portion is abutted on and welded to an outer surface of the shell to seal the hole with the hole sealing member 8 allowing stably holding the silencer and easily filling the silencer with the material irrespective of a shell shape and a structure inside the shell.
US12188382B2
A rocker arm assembly can include an outer arm having an outer rocker shaft bore configured to receive a rocker shaft and an inner arm having an inner rocker shaft bore configured to receive the rocker shaft. The inner arm can be configured to selectively rotate. A latch pin can be movably seated in the outer arm and configured to move between a latched position and an unlatched position. The rocker arm assembly can further include a lost motion spring. The lost motion spring can include a first end connected to a connecting portion of the inner arm above the inner rocker shaft bore and a second end connected to the outer arm. The inner arm can include an inner arm stop member configured contact with a corresponding outer arm stop member of the outer arm.
US12188375B2
A structure for assembling turbine blade seals, which includes a turbine blade including an airfoil, a platform, and a root, a turbine rotor disk to which the root of the turbine blade is mounted, a seal plate mounted between the platform and one side of the turbine rotor disk to seal a cooling channel defined within the root and the platform, and an insertion pin inserted through the turbine rotor disk to fix the seal plate to the turbine rotor disk by supporting the seal plate, wherein the turbine rotor disk has a mounting groove into which a radially inner end of the seal plate is inserted, and the seal plate has a jaw portion radially supported by a stepped portion of the mounting groove.
US12188370B2
An impeller (58) for a radial turbine comprises a substantially conical hub (70), and a plurality of impeller blades (80) arranged along an outer periphery of the hub at regular intervals, wherein a tip end (80D) of each impeller blade is provided with a fin (82) projecting in a thickness-wise direction of the impeller blade over a prescribed region (X) extending along a chord length thereof from a first point (P1) at a first distance from an upstream end (80A) of the tip end to a second point (P2) at a second distance from a downstream end (80D) of the tip end.
US12188367B2
A handling system includes an elongated member including a first end and a second end, and a first bend therein. The elongated member is positioned in a slot of the turbine shroud. A base retention member extends from the first end of the elongated member to engage and retain a first end portion of the turbine shroud on the elongated member, and a sliding retainer is configured to slidingly receive the elongated member. The sliding retainer is shaped and sized to slidingly engage in the slot and selectively retain a second end portion of the turbine shroud in a handling position on the elongated member. A lock is coupled to the sliding retainer and selectively movable between a locked position in which the lock retains the sliding retainer in the handling position and an unlocked position in which the sliding retainer slides freely on the elongated member.
US12188366B2
Methods, apparatus, systems, and articles of manufacture are disclosed. An example apparatus includes a tubular or cylindrical body including a shaft, a shoulder, and a neck, the shaft coupled to the shoulder, the shoulder coupled to the neck, the shoulder having a greater diameter than respective diameters of the shaft and the neck. The example apparatus includes a plug coupled to the shoulder at a first plug edge and coupled to a first fastener at a second plug edge, the first fastener including a hole. The example apparatus includes a second fastener coupled to the first fastener, the second fastener extending through the tubular body, the plug, and the first fastener.
US12188356B2
The present application relates to an assembly for a turbine engine (1), comprising a first rotor (2) which is rotatable about a longitudinal axis (X-X) of the turbine engine (1), the first rotor (2) comprising a first arm (26); a second rotor (3) which is rotatable about the longitudinal axis (X-X) and comprises a second arm (36); a first sealing ring (4) which is centred on the longitudinal axis (X-X), is arranged radially outside the first arm (26) and comprises a first radial flange (40) fixedly mounted between the first arm (26) and the second arm (36); and a second sealing ring (5) which is separate from the first sealing ring (4), is centred on the longitudinal axis (X-X) and is arranged radially outside the second arm (36), the second sealing ring (5) comprising a first part (51) which is designed to come into contact with the second rotor (3), and a second part (52) which is separate from the first part (51) and is designed to come into contact with the first sealing ring (4).
US12188354B1
Reciprocating engines and methods of their operation of. Pistons of such an engine are interconnected through a pinion gear and dual gear rack of a reciprocating assembly in a manner capable of reducing the loss of torque at the top-dead-center (TDC) positions of the pistons.
US12188349B1
Described is a system for identifying leaks in a wellbore. The system includes a bottom hole assembly having an acoustic logging tool, coiled tubing, and one or more inflatable packers. The system further includes a computing device with an artificial intelligence analyzer having edge computing capabilities. When the bottom hole assembly is run into the wellbore, the acoustic logging tool is configured to identify a leak interval using acoustic waves. Data associated with the leak interval is transmitted to the computing device to be analyzed using the edge computing capabilities. A leak is identified within the leak interval upon analysis of the data. In response to identifying the leak, the one or more inflatable packers are deployed to seal the leak in the leak interval.
US12188337B2
A can include a gas injection mandrel configured to inject a gas into fluids produced into a flow passage of a production string, and a gas dispersal tool including at least one turbulence-inducing structure configured to disperse the gas in the fluids. A method can include connecting a gas dispersal tool in a production string, producing fluids into a flow passage extending longitudinally through the production string, and injecting a gas into the flow passage, thereby causing the gas and the fluids to flow through the gas dispersal tool, and the gas dispersal tool dispersing the gas in the fluids. A gas dispersal tool can include a generally tubular outer housing, a flow passage extending longitudinally through the outer housing, and at least one turbulence-inducing structure in the flow passage, the turbulence-inducing structure being configured to disperse gas in a flow of produced fluid through the flow passage.
US12188333B2
Provided is a frac window system, a well system, and a method. The frac window system, in at least one aspect, includes an elongated tubular having a first end and a second end with an opening defined in a wall of the elongated tubular between the first end and the second end, the wall having an inner surface and an outer surface, wherein the opening in the wall is configured to align with a window of a first wellbore casing, and a spacer window sleeve positioned within the elongated tubular, the spacer window sleeve including a tubular having a first tubular end and a second tubular end with a second opening defined in a second wall of the tubular between the first tubular end and the second tubular end, the second wall having a second inner surface and a second outer surface, wherein the second opening in the second wall is configured to at least partially align with the opening in the wall of the elongated tubular.
US12188330B2
A downhole tool includes a body including a microwave generator, a susceptor shell connected to the body, the susceptor shell having wall made of susceptor material and a cavity formed between the wall and the body, and a thermometer connected to the body. A system includes a well extending from a surface, a microwave heating tool positioned in the well, a thermometer, and an electrical cable extending from a power source at the surface to the microwave heating tool. A method of treating organic deposits in a well includes lowering a microwave heating tool into the well to a treatment zone including organic deposits, providing power to the microwave heating tool via an electrical cable, increasing a temperature of the treatment zone to an elevated temperature using heat generated from the microwave heating tool, and melting the organic deposits in the treatment zone.
US12188325B2
A system can comprise a drill string sub that is configured to couple to a drill rod of a drill string, wherein the drill string sub defines a shoulder and at least one through hole. A plug assembly can be receivable with a bore of the drill. The plug assembly can be releasably coupled to the drill string sub. When decoupled from the drill string, the plug assembly can be configured to be pumped into the drill string. The plug assembly can comprise a distal subassembly that defines a receiver that is configured engage a reverse circulation overshot. A proximal subassembly can be coupled to the distal subassembly. The proximal subassembly can comprise a brake apparatus that is configured to inhibit proximal movement of the plug assembly.
US12188322B2
A wedge to be used with a lockdown ring is disclosed. The lockdown ring is to be used with a wellhead. The wedge is enabled to engage a separation in the lockdown ring. The wedge includes a stopping feature to enable the wedge to be in one of a plurality of positions within the separation in the lockdown ring.
US12188308B2
What is provided is a method and apparatus which can be detachably connected to an annular blowout preventer thereby separating the drilling fluid or mud into upper and lower sections and allowing the fluid to be displaced in two stages, such as while the drill string is being rotated and/or reciprocated. In one embodiment the sleeve can be rotatably and sealably connected to a mandrel. The swivel can be incorporated into a drill or well string and enabling string sections both above and below the sleeve to be rotated in relation to the sleeve. In one embodiment the drill or well string does not move in a longitudinal direction relative to the swivel. In one embodiment, the drill or well string does move longitudinally relative to the sleeve of the swivel.
US12188300B2
An earth-boring rotary drill tool may comprise a body comprising a pin, a roller cone mounted on the pin, and a seal assembly disposed between the pin and the roller cone. The first ring may comprise longitudinally converging sidewall surfaces defining a minimum radial thickness of the first ring at points of tangential intersection with a convex curved surface spanning a radial thickness of the first ring. The second ring may comprise a concave surface located and configured to interface over an area of contact with the convex curved surface of the first ring. The third ring may be positioned adjacent to, and concentric with, the second ring. The second ring may be disposed radially inward from the third ring. The first ring may also contact a surface of the roller cone or an insert ring adjacent the roller cone to form a seal between the first ring and the surface.
US12188298B2
A door system includes a doorframe having opposing vertical jambs, a door pivotably coupled to the doorframe, a threshold extending between the opposing vertical jambs and providing an upper surface that defines a valley, and a dam removably mountable to the threshold at the valley. A valley seal interposes the dam and the threshold at the valley when the dam is mounted to the threshold and thereby generates a sealed interface between the dam and the threshold.
US12188293B2
A mullion includes a body including a first co-extruded portion and a second co-extruded portion adjacent to the first co-extruded portion. The second co-extruded portion has a lower density than the first co-extruded portion. In some implementations, the mullion includes a body having a rear section and a pair of opposing lateral sections adjoining either side of the rear section. The lateral sections can each include two or more walls spaced from one another in a lateral direction.
US12188292B2
In an embodiment, a safe door apparatus is provided. The apparatus comprises a locking apparatus affixed to an inside portion of a safe door for a safe and at least one vertically oriented bolt fastened to the inside portion of the safe door with the locking apparatus. The bolt is adapted to move with the locking apparatus during locking and unlocking of the safe door from a safe body of the safe. The bolt is further adapted to fasten and unfasten to a horizontal plate, which is affixed to an inside of the safe body during locking and unlocking of the safe door by the locking apparatus.
US12188283B2
A gearing device for discontinuously moving at least two elements, in particular barrier elements of a passageway device, having a drive axis, a first active axis of rotation, formed for a torque-transmitting operative connection with the first element, in particular barrier element, a first non-uniformly translating gearing stage between the drive axis and the first active axis of rotation, a second active axis of rotation formed for a torque-transmitting operative connection with the second element, in particular barrier element, a second non-uniformly translating gearing stage between the drive axis and the second active axis of rotation.
US12188281B2
An embodiment system includes an actuator mounted in a housing and configured to be operated in response to a connection state of a charging cable, a lever arm rotatably provided outside the housing and configured to be rotated in conjunction with operation of the actuator, a debris removal unit configured to remove debris on the lever arm, and a controller configured to control the operation of the actuator in response to the connection state of the charging cable being a connected state or a released state and to control the debris removal unit to remove the debris on the lever arm in response to an operational state according to the operation of the actuator deviating from a normal range.
US12188280B2
A passenger safe exit assist device and a method thereof obtain information of an obstacle around a vehicle and a speed at which the door of the vehicle is opened, set a virtual first line along the obstacle, and control the speed at which the door is opened, based on at least one of the first line or the speed. The device and method provide a customer with various safe exit modes such that the customer freely selects a mode and experiences alighting safely from the vehicle.
US12188279B2
Disclosed is a detection and mitigation system to detect potential interference conditions of a potential interference condition between a tailgate or rear gate and a component attached to the hitch receiver of the vehicle.
US12188273B1
Window hinge assemblies with energy control and methods of using the same are described herein. The hinge assemblies include a track assembly, a shoe slidably engaged in a shoe track of the track assembly, a sash arm configured for attachment to a rotating sash, the sash arm being pivotally attached to the shoe, and a connecting arm pivotally connected to both the track assembly and the sash arm. The track assembly includes a base extending along a track axis, a shoe track extending along the track axis, and one or more energy control structures associated with the sash arm.
US12188264B2
A wing lock and deployment apparatus for an air launched vehicle includes a driver acted on by a single linear actuation event. The disclosed wing lock and deployment apparatus is capable of unlocking deployable wings of an air launched vehicle, deploying deployable wings of the air launched vehicle from a stored position, and locking deployable wings of the air launched vehicle in a deployed position in sequential order with the one single linear actuation event.
US12188252B2
An article for securing a line to an external surface, such as a fence post, includes a spiral member having a first end and a second end. The first end is adapted to be secured to the external surface. The spiral member has a curved portion extending from the first end. The curved portion has an exterior surface. The second end has an outer surface that overlies in spaced relation the exterior surface of the curved portion. The space between the exterior surface of the curved portion and the outer surface of the second end having a distance that is greater than a diameter or thickness of the line. The spiral member has a circular cross-section. The curved portion extends for greater than 360°.
US12188246B2
An apparatus for an entryway includes: a sheet of material having a top, a bottom, a left side, and a right side, and a sleeve at the top of the sheet of material. The sheet of material has an opening extending to the bottom of the sheet of material between the left side and the right side of the sheet of material from a position below the sleeve. The opening has a left seam and a right seam, wherein a first magnet is positioned at the left seam of the opening and a second magnet is positioned at the right seam of the opening, wherein the first and second magnets are magnetically coupled. A variable-length cross member has a first end and a second end. The cross member is positioned in the sleeve and includes a first securing mechanism at the first end and a second securing mechanism at the second end that secure the cross member respectively to body portions of a first vertical pole and a second vertical pole.
US12188245B2
The present invention discloses a 3D weaving and printing integrated structure construction equipment including: a printing matrix material preparation device, processing the printing matrix raw materials and then delivering them to a printing matrix extrusion device; a printing matrix extrusion device, having the functions of promoting extrusion and lamination molding, and printing a matrix; a wire pushing and spatial anchoring device, using a nail-shooting to position and tow a rope/wire/cable for continuously weaving layer by layer stacking along the vertical direction; an electromagnetic guided shuttle dropping device, weaving the rope wire/cable material along the longitude and latitude directions; a locking device, positioning and fixing the rope/wire/cable woven along the longitude and latitude directions; a tensioning traction device, performing spatial multi-directional prestress tensioning on the rope/wire/cable woven along the longitude and latitude directions.
US12188242B2
An invertible tapping block having first and second opposed sides each configured to be struck with an impacting member, and a web between the sides, the web having upper and lower support surfaces to which a handle is selectively attached, and the web including opposed projections, different from each other, and configured to engage different configurations of flooring planks.
US12188241B2
Systems and methods of shotcrete construction are contemplated whereby guide rails are placed in proximity and forward to a shotcrete receiving surface, with any guide rails disposed directly in front of the shotcrete receiving surface being configured to be offset from the receiving surface allowing shotcrete to be sprayed behind the offset guide rails. Following application of shotcrete, a screed configured to engage with and traverse along at least two of the guide rails may be used to rod the shotcrete via a protruding region of the screed extending beyond the guide rails, thereby removing excess shotcrete and imparting to the shotcrete surface a contour at least partially defined by the configuration of the guide rails and the configuration of the protruding region of the screed. Complex, precise, and even exotic architectural shotcrete installations may be created in this fashion by providing a suitable set of guide rails and screed.
US12188240B2
A covering element for a floor covering comprising an upper surface having a relief structure, wherein the relief structure comprises excavations having a depth decreasing towards at least one perimetric edge of the covering element.
US12188223B2
An end seal member, which includes a contacting surface including a drainage cavity along the contacting surface. The end seal member also includes a seal material body including a central body protrusion projecting in a horizontal direction substantially orthogonal to the seal material body from an opposite face of the contacting surface. The end seal member also includes a first and second extending elements extending upward from the seal material body and a reinforcing metal plate within the seal material body. The contacting surface is substantially flat.
US12188221B2
The present invention provides a construction set suitable for creating a variety of structures and includes a plurality of elements. A modular construction system includes hubs which are embodied as solid-surfaced hexahedrons having at least one flanged protrusion on at least two faces of each hexahedron. Adjacent structural bodies in the modular construction system may be connected to as few as one face of a hub, or to as many as all six faces, by means of attachable connector elements. The hexahedron at the core of the hub may be of the same or larger dimensions relative to the cross-section of the framing materials (e.g., lumber, tubing, composites, metals, extruded members) it connects.
US12188216B2
A wastewater drain assembly that includes a selectively openable drain stopper. The wastewater drain assembly is interconnected to a fluid basin wherein a flange, which is interconnected to wastewater plumbing, is situated within the sink. The flange receives an insert that has a portion that conceals the flange.
US12188214B2
A sink cover is disclosed herein. The sink cover includes an edge portion that is shaped to come into contact with a circumference of a rim of a sink and a lip portion that is connected to the edge portion where the lip portion is shaped to extend beyond the circumference of the rim of the sink. The sink cover includes a top portion that is connected to the lip portion to envelop an upper end of the sink cover. The sink cover further includes a sliding mechanism that modifies a length of the sink cover.
US12188212B2
An automatic shutoff valve for breakaway wet barrel fire hydrant is disclosed. In general, one aspect disclosed features an apparatus comprising: a valve housing comprising a valve body, a flange, and a valve seat; a valve pedal configured to engage the valve seat and prevent fluid flow through the valve seat in a closed position, and to permit fluid flow through the valve seat in an open position; a lockout tab disposed within the valve body, wherein the lockout tab maintains the valve pedal in the open position; a lockout bar disposed distally from the valve body; and an activation rod mechanically coupled to the lockout bar and configured to keep the valve pedal engaged with the lockout tab.
US12188211B2
A pit defining an opening and having a footing. Cutouts are located in the footing and are created in mold to avoid secondary cutting operations. The wall of the pit above the footing is narrower than the footing and includes ribs extending from the wall for added compressive resistance. The ribs may vary in size both in length and extension into the center of the pit.
US12188207B2
A terrain-based travel assist system and method are provided for stability control in a self-propelled work vehicle such as an excavator comprising ground engaging units and at least one work implement configured for controllably working terrain. Upon selecting or determining a travel mode for the work vehicle, the respective predetermined target positions and/or operations of the at least one work implement are retrieved from data storage, corresponding to the determined travel mode. Feedback signals are received from sensors corresponding to respective current positions and/or operations of the at least one implement, and in some embodiments to a vehicle speed. Control signals are generated for automatically controlling the at least one work implement to the respective predetermined target positions and/or through the respective operations, responsive to the determined travel mode and the received feedback signals.
US12188206B2
The present disclosure provides methods for adjusting steering angle and articulation angle in an auto steering operation of a work vehicle. The percentage of travel of an articulation joystick of the work vehicle at least partially determines an articulation desired angle change, which can be used to calculate an articulation desired angle and a steering desired angle change. The difference between the articulation desired angle and an articulation angle detected by an articulation angle sensor is used to adjust the articulation angle. The steering desired angle change can be used to calculate a steering desired angle. The difference between the steering desired angle and a steering angle detected by a steering angle sensor is used to adjust the steering angle.
US12188202B2
A cam frame assembly for a walking system includes a plurality of frame components. The frame components include an upper frame, a lower frame, a front guide frame, and a rear guide frame. At least one of the frame components includes a replaceable wear surface. The replaceable wear surface is an insert retained within a notch in the frame component.
US12188200B2
An automatic control determination unit determines whether to start automatic dumping control. A dumping control unit generates a first command to rotate a bucket in a dump direction until an inclination of the bucket reaches a predetermined dumping completion angle upon determining to start the automatic dumping control. The dumping control unit generates a second command to rotate a boom in a raising direction during a period until the inclination of the bucket reaches the dumping completion angle from an inclination at the time of start of the automatic dumping control.
US12188193B2
Provided is a technique for preventing repeated river, storm surge, and tsunami disasters. “Sea hollow (UTSURO)” is constructed at an estuary, violent tide is generated in an estuary basin water area of a river, ebb and flow energy is caused to exceed flow energy due to gravity in a downstream part of the estuary flow area conventionally dominated by the flow energy due to gravity, the flow energy in the river is thus redistributed to deeply dig the riverbed, enhance flood discharge ability, and prevent repeated river disasters, a levee body of the “sea hollow (UTSURO)” is shared, tsunami or storm surge is reflected in a coastal sea area and is prevented in the sea area, tsunami or storm surge invading the estuary, or estuary flood is caused to overflow into an upstream migration water path constituting the “sea hollow (UTSURO)”, and peak cut thereof is performed.
US12188176B2
The present invention relates to a device for dyeing a moving yarn that comprises a liquid dye supply line, a first nozzle positioned above the yarn and configured to deposit dye on a first surface of the yarn, a second nozzle positioned above the yarn and configured to deposit dye on a second surface of the yarn corresponding to a surface opposite the first surface relative to the axis of the yarn, a synchronization mechanism for actuating the nozzles as a function of the movement of the yarn such that, between the first and the second nozzle, the yarn is able to pivot axially under the effect of the gravity of the dye deposited by the first nozzle.
US12188163B2
Embodiments of the present invention include a quilting ruler to facilitate home embroidery machine user's “quilting-in-the hoop” capabilities. This includes a thin, generally polygonal ruler with apertures for center marking, cross-hair marking, and size marking, as well as perimeters for edge markings to delineate fabric areas for quilting-in-the-hoop. The invention also includes a quilting ruler system with a plurality of such rulers of various dimensions and classes. Finally the invention includes a method of using the quilting rulers to map and extend quilting designs across a fabric area by selecting a quilting ruler, placing it on a fabric at a first fabric location, marking the fabric at the first fabric location through apertures, marking the fabric around the perimeter of the ruler, marking the dimension of the perimeter on the fabric, quilting at the first fabric location, and repeating these steps.
US12188149B2
A method of manufacturing a semiconductor device, includes attaching a first susceptor to a film forming apparatus, measuring a magnitude of a warp of the first susceptor, setting a first initial film formation condition as a film formation condition of the film forming apparatus in accordance with the measured magnitude of the warp of the first susceptor, and placing a plurality of first wafers on the first susceptor and forming a first film on the plurality of first wafers under the film formation condition. The setting of the first initial film formation condition includes reading the first initial film formation condition from a recording medium storing a database. The database includes a plurality of pieces of data in which magnitudes of warps of susceptors are associated with initial film formation conditions for forming the first film.
US12188145B2
The invention discloses a device and a method for continuous VGF crystal growth through reverse injection synthesis, relating to a device for preparing a semiconductor crystal and growing a single crystal, in particular to a method and a device for continuously growing the crystal in situ by using a VGF method and reverse injection synthesis. The device includes a furnace body, a crucible, a heat preservation system, a heating system, a temperature control system and a gas pressure regulation system, wherein the crucible is arranged in the furnace body, has a synthesis unit at its upper part, and has a crystal growth unit and a seed crystal unit at its lower part, and the synthesis unit is communicated with the crystal growth unit through capillary pores.
US12188140B2
An electrorefining process for refining relatively purer lithium metal from a lithium-alloy feedstock material using a three-layer electrorefining apparatus can include a) providing an anode layer comprising a molten, lithium-alloy feedstock material that includes a combination of lithium metal having a first purity and a carrier material; b) providing an electrolyte layer comprising a molten salt electrolyte material; c) providing a product layer comprising molten lithium metal having a second purity that is greater than the first purity above the electrolyte layer; and d) applying an activation electric potential that is sufficient to electrolyze the lithium-alloy feedstock material between an anode layer and the product layer that is electrically isolated from the anode layer, whereby lithium metal is liberated from the lithium-alloy feedstock material, migrates through the electrolyte layer and collects in the product layer.
US12188135B2
A fluorine gas production device includes an electrolytic cell, a partition wall extending downward in the vertical direction from the ceiling surface inside the electrolytic cell to partition the electrolytic cell into an anode chamber and a cathode chamber, an anode, and a cathode. The lower end of the partition wall is immersed in the electrolytic solution and a length in the vertical direction of a portion immersed in the electrolytic solution of the partition wall is from 10% to 30% of the distance from the bottom surface inside the electrolytic cell to the liquid level of the electrolytic solution. The cathode is completely immersed in the electrolytic solution and the upper end of the cathode is arranged at a lower position in the vertical direction relative to the lower end of the partition wall. The anode is partially exposed from the liquid level of the electrolytic solution.
US12188133B2
A cable-to-pipe connector is provided. A cable-to-pipe connector for providing continuous transfer of current from a cable to a utility pipe in above grade and below grade systems, comprising a conductive lug comprising a head at a top end of the conductive lug affixed to a noncircular neck that is further affixed to a body in a linear formation, the head, the neck, and the body having decreasing diameters respectively. An insulating shell partially encasing by the conductive lug. A horizontal aperture at a midway point of the head. A first fastener extending from above a top of the head through the horizontal aperture. A threaded member at a base end of the conductive lug and a bottom end of the insulation shell.
US12188130B2
Disclosed is a phosphate-free aqueous acidic conversion coating comprising zinc sulfate and sulfuric acid. The conversion coating finds special use as a conversion coating to metal substrates prior to application of a cold forming lubricant or prior to application of a paint. The conversion coatings according to the present disclosure avoid the issues associated with phosphate containing conversion coatings but provide similar benefits to phosphate-based conversion coatings. Optional components of the conversion coating solutions include one or more of pH adjustment neutralizers, coating stabilizers, coating accelerators, coating refiners, etchants, paint adhesion promotors and mixtures thereof. In an additional option, manganese oxide can be used in place of zinc oxide.
US12188127B2
A method of manufacturing a layer of crystalline ytterbium doped zirconia on a substrate is disclosed. The method includes depositing a solution including precursor metal salts of the ytterbium doped zirconia onto a surface of the substrate, wherein the surface is a metallic or a ceramic surface. The solution is dried to form a film of the precursor metal salts on the surface. The film of the precursor metal salts is heated to decompose it to form an ytterbium doped zirconia. The previous steps may optionally be repeated. The film(s) are fired in order to form the layer of crystalline ytterbium doped zirconia. The ytterbium doped zirconia has a formula: ([YbxM1−x]2O3)z(ZrO2)1−z wherein M is a metallic dopant ion; z is in the range of 0.03 to 0.13; and x is in the range of 0.05 to 1.
US12188110B2
The steel material according to the present disclosure has a chemical composition consisting of, in mass %, C: more than 0.20 to 0.35%, Si: 0.05 to 1.00%, Mn: 0.02 to 1.00%, P: 0.025% or less, S: 0.0100% or less, Al: 0.005 to 0.100%, Cr: 0.40 to 1.50%, Mo: 0.30 to 1.50%, Ti: 0.002 to 0.050%, B: 0.0001 to 0.0050%, N: 0.0100% or less and O: 0.0100% or less, with the balance being Fe and impurities, and satisfies Formula (1) and Formula (2) described in the description. The yield strength is 862 MPa or more. A numerical proportion of precipitates having an equivalent circular diameter within a range of 20 to 300 nm among precipitates having an equivalent circular diameter of 20 nm or more in the steel material is 0.85 or more.
US12188106B2
A device for the production of a metallic strip using a rapid solidification technology is provided. The device includes a movable heat sink with an external surface onto which a melt is poured and on which the melt solidifies to produce the strip, and which device includes a rolling device which can be pressed against the external surface of the movable heat sink while the heat sink is in motion.
US12188100B2
A spray quenching system including a quench box configured to receive a part for quenching. The system may include mechanical arms disposed within the quench box and thermocouples disposed on the mechanical arms that may be moved to contact the part surface. The system may include non-contact temperature sensors within the quench box that measure the temperature part surface, and spray nozzles within the quench box that spray the part with a quenching fluid. The system may include a controller in electronic communication with the mechanical arms, the spray nozzles, the thermocouples, and the non-contact temperature sensors, that is configured to initiate a quenching process, receive temperature data, analyze the temperature data to determine a temperature difference value, determine that the temperature difference value exceeds a threshold temperature difference value, and adjust the quenching process if the temperature difference value exceeds the threshold temperature difference value.
US12188097B2
The invention generally relates to methods and compositions for the prediction of therapeutic efficacy of cancer treatments and the prognosis of cancer. The invention discloses markers that are associated with favorable and unfavorable outcomes, respectively, in certain cancer treatments and are useful as prognostic markers for cancer. Methods involving these markers are disclosed for predicting cancer therapy benefit and prognosing clinical outcome for cancer patients.
US12188095B2
Described herein are methods and compositions useful in detecting, diagnosing and treating small cell lung cancer. Transgenic animal models and cell lines are disclosed for the study of a small cell lung cancer subtype. Methods of screening and identifying active agents for the treatment of a small cell lung cancer subtype as well as methods of identifying patients susceptible to treatment with aurora kinase inhibitors are also provided.
US12188092B2
The present disclosure describes methods of determining the risk of developing breast cancer in a subject or determining whether a subject suffers from breast cancer. The methods can comprise detecting the expression level of microRNAs (miRNAs) hsa-miR-186-5p (SEQ ID NO: 77) and/or hsa-miR-409-3p (SEQ ID NO: 178) in a bodily fluid sample obtained from the subject and determining whether it is upregulated or downregulated as compared to a control, wherein the upregulation of hsa-miR-186-5p (SEQ ID NO: 77) and/or downregulation of hsa-miR-409-3p (SEQ ID NO: 178) indicates that the subject has breast cancer or is at risk of developing breast cancers. Also encompassed are methods of prognosis or diagnosis of breast cancer by detecting expression levels of combinations of miRNAs and using a score based on a panel of miRNA markers.
US12188090B2
Disclosed is a method for determining the sex of yellowtails, the method comprising a step of identifying whether an amino acid residue at position 143 in polypeptide encoded by the HSD17B1 gene of yellowtails is a glutamic acid residue or a glycine residue; a nucleic acid molecule or a primer set which is for use in said method; or a kit comprising the same, for determining the sex of yellowtails. The method according to the present invention is useful in that the genetic sex of yellowtails can be accurately determined.
US12188084B2
Methods, compositions and kits are provided to amplify an amount of genomic methylated DNA that can be subsequently analyzed and/or sequenced. It has particular use with small amounts of DNA, including, but not limited to cell free DNA samples. In some embodiments, the ratio of polymerase and methyltransferase is controlled in order to provide maximum yields. In some embodiments, a dual primase/polymerase is used.
US12188083B2
Provided herein are products and processes for primer extension reactions using chain terminating reagents and enzymes having 3′ to 5′ exonuclease activity, whereby unextended oligonucleotides are digested and extended oligonucleotides are not digested. Also provided herein are products and processes for the detection of the presence, absence or amount of one or more variants of a target nucleic acid species or a plurality of target nucleic acid species comprising primer extension reactions using chain terminating reagents and enzymes having 3′ to 5′ exonuclease activity, whereby unextended oligonucleotides are digested and extended oligonucleotides are not digested.
US12188076B2
A medium composition for detection of P. carotovorum includes pectin, cellobiose, and inositol as active ingredients. P. carotovorum is highly likely to cause soft rot during cultivation as well as storage and transportation such that continuous monitoring is required. In order to solve the issues, the medium composition ensures remarkably outstanding selectivity for P. carotovorum.
US12188058B2
This invention provides compositions of active highly phosphorylated lysosomal sulfatase enzymes, their pharmaceutical compositions, methods of producing and purifying such lysosomal sulfatase enzymes and compositions and their use in the diagnosis, prophylaxis, or treatment of diseases and conditions, including particularly lysosomal storage diseases that are caused by, or associated with, a deficiency in the lysosomal sulfatase enzyme.
US12188056B2
The present disclosure relates to the production of sialylated Human Milk Oligosaccharides (HMOs), in particular to the biosynthetic production of 3′-sialyllactose (3′SL), and to genetically engineered cells and methods suitable for said production.
US12188049B2
The present disclosure provides a soluble P-selectin (sP-sel) interfering the interaction between stem cells and niches to mobilize stem cells from bone marrow. The mobilization of stem cells with sP-sel can treat a subject in need of preservation, repair, or regeneration of a tissue, or revascularization.
US12188046B2
The present disclosure described herein provides, inter alia, an expansion method for expanding mDAPs and a culture medium and a coating matrix combination used in the expansion method, as well as a maturation method for maturing mDAPs and a culture medium used in the maturation method. The present disclosure also provides a substantially homogeneous population of mDAPs and a substantially homogeneous population of mDANs.
US12188044B2
The present invention provides high efficiency targeted and marker-less single or simultaneous multiple integrations using nucleases and a stable plasmid in Kluyveromyces host cells.
US12188039B2
The present disclosure provides methods and compositions for the treatment of diseases and genetic disorders linked to SURF1 loss and/or misfunction. The methods and compositions of the present disclosure comprise rAAV vectors and rAAV viral vectors comprising transgene nucleic acid molecules comprising nucleic acid sequences encoding for a SURF1 polypeptide.
US12188025B2
A transformant obtained by introducing a DNA of (a1), (a2), or (a3) below, and (b) an alcohol dehydrogenase gene, into a bacterium of the genus Hydrogenophilus, can efficiently produce isobutanol utilizing carbon dioxide as a sole carbon source. (a1) DNA which consists of a base sequence of SEQ ID NO: 1; (a2) DNA which consists of a base sequence having 90% or more identity with SEQ ID NO: 1, the DNA encoding a polypeptide having 2-keto-acid decarboxylase activity; (a3) DNA which hybridizes with a DNA consisting of a base sequence complementary to SEQ ID NO: 1 under stringent conditions, and which encodes a polypeptide having 2-keto-acid decarboxylase activity.
US12188023B2
Described herein is a protein display selection method which uncouples a protein of interest (POI) library from the display selection system. Display of the POI can be achieved by forming a covalent bond between the POI and the anchor protein post expression either by enzymatic protein ligation (e.g. SpyLigase, SnoopLigase, sortase, butelase, peptiligase etc.) or by spontaneous covalent bond formation (e.g. SpyTag/SpyCatcher, SnoopTag/SnoopCatcher, etc.). The POI library is fused to a tethering sequence, for example SpyTag, at the C-terminus of the POI which then forms a covalent bond to a capture sequence found on an anchor protein, for example, the SpyCatcher-fused anchor protein, e.g., a SpyCatcher-geneIII protein (SpyCatcher-pIII) fusion, for the most common form of phage display. Nucleic acid constructs, host cell systems and methods of producing the protein display systems are also provided.
US12188014B1
Methods and systems for sample preparation techniques that prevent inhibition of reactions such as due to the presence of longer oligonucleotides are presented herein. The methods and systems provided herein allow amplification (e.g., whole genome amplification) and sequencing of chromatin accessible regions of single cells.
US12188013B2
The present invention relates to catalytic biomolecule characterization and microfluidics. It is used for identification of nucleic acids encoding active catalytic molecules in the plurality of nucleic acids and for gathering information about catalytic biomolecule activity. It can also be used for exploring different properties of regulating sequences that modulate expression of catalytic biomolecules by recording that information into the DNA sequence of the same catalytic biomolecule using microfluidic techniques.
US12187990B2
A method for treating a wort in a kettle provides a kettle with an inlet for feeding a wort into the kettle and with an outlet for flowing the wort out of the kettle. A heating means for bringing the wort contained in the kettle close to or at boiling temperature, as well as for controlling the temperature. A gas sparging system for sparging an inert gas into said wort. Feeding wort from a lautering step into said boiling kettle through the inlet, the wort at a temperature below its boiling temperature. During sparging, heating the wort and maintaining it at a treatment temperature below the boiling temperature of the wort for a duration between 15 and 90 min, and no longer than required to evaporate at most 4 wt. % of water initially in the wort. Transferring the treated wort to a trub separation step through the outlet.
US12187978B2
The present invention relates to the use of (3-hydroxy-2,2-dimethyl-propyl) acetate for enhancing and/or modifying the aroma of (3-acetoxy-2,2-dimethyl-propyl) acetate. The invention further relates to the use of (3-acetoxy-2,2-dimethyl-propyl) acetate in combination with (3-hydroxy-2,2-dimethyl-propyl) acetate as an aroma chemical and for enhancing and/or modifying the aroma of a composition. The present invention further relates to compositions comprising (3-acetoxy-2,2-dimethyl-propyl) acetate combined with (3-hydroxy-2,2-dimethyl-propyl) acetate and at least one aroma chemical and/or at least one non-aroma chemical carrier.
US12187971B2
A secondary fluid is provided for use in an internal combustion engine that burns a primary fuel. The secondary fluid comprises about 15 vol % to about 30 vol % of alcohol; and about 0.0025 vol % to about 0.5 vol % of a lubricity enhancer which optionally is a castor oil. The secondary fluid is a thermodynamically stable microemulsion with water being the continuous phase.
US12187970B2
Lubricity additives for hydrocarbon fuels are provided according to formula I: wherein n is 1 or 0; each Q is independently selected from oxygen and sulfur; each R is independently selected from C8-C60 alkenyl groups which are substituted or unsubstituted; and L is a linking group comprising 0-20 carbons which may be substituted or unsubstituted and may optionally comprise catenary heteroatoms. Fuel mixtures comprising a hydrocarbon fuel; and a lubricity additive according to the present disclosure are also provided. Methods of making lubricity additives comprise reacting an alkenyl succinic anhydrides (ASA's) with certain bisamides or bisthioamides.
US12187964B2
A method and composition is described for reducing the levels of hydrogen sulfide in a fluid such as a hydrocarbon stream. The method involves contacting the gas stream with a composition comprising a mixture of amines reacted with formaldehyde. The composition reduces the formation and deposition of solids commonly associated with spent triazine scavengers.
US12187962B2
A disposal system for the processing of solid waste devices to recycle materials located within the devices and recover, reuse and recycle such materials. Such system may include a primary chamber and secondary chamber, attached preferably by use of one or more exhaust ducts, and a secondary chamber exhaust duct. The solid waste devices may include any type of waste, such as electronics waste, medical device waste, and the like.
US12187956B2
Implementations described herein generally relate to a drag reducing agent (DRA) for improving flow of crude oils having high asphaltene content through pipelines. The DRA is a terpolymer having a glass transition temperature (Tg) of 6 degrees Celsius or below. The terpolymer is formed by a first monomer, a second monomer, and a third monomer. The first and second monomers are chosen based on the glass transition temperatures of corresponding homopolymers. The glass transition temperature of the homopolymer formed with the first monomer is at least 120 degrees Celsius higher than the glass transition temperature of the homopolymer formed with the second monomer. The DRA comprised of the terpolymer formed with the second monomer produces softer solids and fewer solids due to the low glass transition temperature of the terpolymer. The softer solids are more easily handled by the pump to keep the injection system clear.
US12187945B1
Provided herein are ferroelectric nematic (NF) compositions comprising a ferroelectric nematic host and one or more nonlinear optical compounds (chromophores).
US12187938B1
A method for synthesizing carbon quantum dots (CQDs) including reacting a mixture of macroalgae and ethanol hydrothermally in an autoclave at a reaction temperature between 150 degrees Celsius (° C.) and 250° C. to form a suspension. The method further includes separating the CQDs from the suspension. The CQDs have a size of 1 to 5 nanometers (nm). The CQDs have a Stokes shift of at least 80 nm at an excitation wavelength of 270-410 nm.
US12187935B1
Liquid dispersions of quantum dot particles comprise an acrylic medium and quantum dot particles dispersed in the acrylic medium have an initial viscosity. The quantum particles comprise ligands attached to the quantum dot particles, the ligands comprising functional groups configured to stabilize the initial viscosity liquid dispersion of the quantum dot particles. The liquid dispersions of quantum dot particles are useful as stable liquid formulations that resist gelling for spin-coating and inkjet printing of color conversion layers in the manufacture of LED and micro-LED panel for advanced displays. Methods of manufacturing light-emitting devices using the liquid dispersions of quantum dot particles are disclosed.
US12187932B2
An object of the present invention is to provide an adhesive film that can be applied easily to an adherend having a three-dimensional shape. An adhesive film according to the present disclosure is an adhesive film having a three-dimensional molded shape and including: a base layer; an adhesive layer including a fine structure in a surface; and a liner layer covering the adhesive layer. The fine structure of the adhesive layer includes a plurality of convex parts. Each of the plurality of convex parts includes two or more parts joined to each other via an interface. A first part present in a top of the convex part includes a non-adhesive or weak adhesive material, and a second part present below the first part includes a strong adhesive material.
US12187931B2
A release film for pressure-sensitive silicone adhesives which comprises: any of various bases; a primer layer (first layer) disposed on at least one surface of the base, the primer layer having a specific thickness and comprising as a main component an organosilicon compound having a plurality of silanol groups in the molecule; and a release layer (second layer) disposed on the outer surface of the primer layer, the release layer having a specific thickness and comprising as a main component a cured object obtained from a hydrolyzable fluorinated compound. A release coating film having excellent releasing properties can be stably and easily imparted to various bases, and the primer layer and the release layer can be formed even by room-temperature (25° C.) application.
US12187907B2
The present invention provides energy curable compositions comprising self-initiating oligomers, amine synergists and Group IV metal chelates. The compositions optionally comprise acrylate monomers having carbonate ester, carbamate, or oxazolidinone groups. The compositions of the present invention exhibit improved cure, and are suitable for packaging, such as food packaging.
US12187904B2
Methods of printing a three-dimensional object using co-reactive components are disclosed. Thermosetting compositions for three-dimensional printing are also disclosed.
US12187896B2
Some embodiments of the present disclosure relate to a method comprising mixing at least one compatibilizer precursor with at least one polymer, so as to result in a polymer concentrate and mixing the polymer concentrate with asphalt, so as to result in a polymer modified asphalt (“PMA”). Some embodiments of the present disclosure relate to formulations comprising a compatibilizer precursor, a polymer concentrate, PMA, or any combination thereof.
US12187895B2
In a first aspect, the present invention is directed to a rubber composition comprising 70 phr to 95 phr of styrene butadiene rubber comprising at least 5 phr of a first styrene butadiene rubber having a glass transition temperature within a range of −49° C. to −15° C. and at least 45 phr of a second styrene butadiene rubber having a glass transition temperature within a range of −50° C. to −89° C., wherein the rubber composition comprises more of the second styrene butadiene rubber than of the first styrene butadiene rubber. Moreover, the rubber composition comprises 5 phr to 30 phr of one or more of natural rubber and synthetic polyisoprene; 135 phr to 200 phr of silica; and at least 55 phr of at least one hydrocarbon resin comprising at least one terpene resin having a glass transition temperature of at least 30° C.
US12187889B2
A non-painted thermoplastic resin composition including viscose rayon so as to embody a marble pattern and a method for making it are disclosed. The viscose rayon is included in the thermoplastic resin composition to minimize the deterioration of physical properties while minimizing weld lines and flow marks during an extrusion process, and a luxurious outer appearance of a marble pattern is embodied without additional post-processing or painting process. The non-painted thermoplastic resin composition includes 80-90 parts by weight of a thermoplastic resin composition, 0.1-5 parts by weight of a carbon fiber, and 0.1-3 parts by weight of viscose rayon based on 100 parts by weight of the entire resin composition. The viscose rayon provides an effect of minimizing weld lines and flow marks during injection, improving physical properties, and providing the luxurious appearance of the marble pattern.
US12187888B2
Cardiac tissue-on-a-chip platforms aimed at mimicking human cardiac tissue structures, are valuable tools to model, and serve as preclinical platforms for drug testing or therapies for cardiac repair. We have developed three types of electrospun scaffolds including furfuryl gelatin (f-gelatin) alone, with polycaprolactone (PCL) in the ratio of f-gelatin and PCL (1:1), and coaxial scaffolds with PCL (core) and f-gelatin (sheath). Scaffolds were developed through single nozzle electrospinning and coaxial electrospinning, respectively, to serve as scaffolds for cardiac tissue-on-a-chip platforms.
US12187885B2
A dispersion includes a hyperbranched polymer having latent crosslinking functionality and comprising the reaction product of: a partially neutralized, acid-functional resin; and an epoxy; and optionally, an effective amount of a crosslinking agent; wherein: the partially neutralized, acid-functional resin comprises the reaction product of a mixture of: a first acid-functional resin with a base and a second acid-functional resin; or a first and a second acid-functional resin with a base; the first acid-functional resin is not the same as the second acid-functional resin; at least one of the acid functional resins comprises a further functional group capable of Schiff-Base crosslinking after film formation; and the dispersion is a single pack waterborne polymer dispersion.
US12187877B2
An extrusion additive manufacturing process including the step of extruding a polyethylene composition having a melt flow index MIE of at least 0.1 g/10 min., the composition made from or containing: A) from 1% to 40% by weight of a polyethylene component having a weight average molar mass Mw, as measured by GPC (Gel Permeation Chromatography), equal to or higher than 1,000,000 g/mol; B) from 1% to 95% by weight of a polyethylene component having a Mw value from 50,000 to 500,000 g/mol; and C) from 1% to 59% by weight of a polyethylene component having a Mw value equal to or lower than 5,000 g/mol.
US12187873B2
An example of a multi-fluid kit for three-dimensional (3D) printing includes an elasticity agent to be applied to at least a portion of a build material composition during 3D printing and a fusing agent to be applied to the at least the portion of the build material composition during 3D printing. The elasticity agent includes a plasticizer having: a formula (I): wherein n is an integer ranging from 3 to 8; or a formula (II): wherein m is an integer ranging from 3 to 8. The fusing agent includes an energy absorber.
US12187870B2
In one or more embodiments, the present invention is directed to an electrically conductive polymer composition comprising a conductive metal filler material comprising a plurality of metal particles and one or more carbon-based filler material substantially homogenously dispersed throughout a polymer matrix, wherein the aspect ratio of the one or more carbon-based filler material is at least ten times greater than the aspect ratio of the conductive metal filler material comprising a plurality of metal particles. In one or more embodiment, the carbon-based filler material will comprise at least one of carbon nanotubes, multi-walled carbon nanotubes and edge-functionalized graphene.
US12187866B2
A cellulose composite film, and a method for producing a cellulose composite film are provided. The cellulose composite film includes a cellulose film, a primer layer that is disposed on one side of the cellulose film, and a barrier layer that is disposed on one side of the primer layer. The cellulose film includes a regenerated cellulose film, the primer layer includes polyurethane film-forming resin, and the barrier layer includes a polyvinylidene chloride (PVDC) coating with an anti-fogging agent.
US12187855B2
Provided are a block copolymer having a narrow molecular weight distribution such that the copolymer can be used in a DSA technique, a block copolymer intermediate thereof, and methods for producing the same. A block copolymer intermediate represented by the general formula (1) or (2): wherein, in the formulae (1) and (2), each of R1 and R3 independently represents a polymerization initiator residue, each of R2 and R4 independently represents an aromatic group or an alkyl group, Y1 represents a polymer block of (a)an (meth)acrylic acid ester, Y2 represents a polymer block of styrene or a derivative thereof, L represents an alkylene group or a phenylene group, X represents a halogen group, and each of m and n independently represents an integer of 1 to 5.
US12187846B2
The invention provides a high-molecular-weight polyethylene glycol derivative that does not cause vacuolation of cells. The degradable polyethylene glycol derivative is represented by the following formula (1): wherein m is 1-7, n1 and n2 are each independently 45-682, p is 1-4, R is an alkyl group having 1-4 carbon atoms, Z is an oligopeptide with 2-8 residues composed of neutral amino acids excluding cysteine, Q is a residue of a compound having 2-5 active hydrogens, X is a functional group capable of reacting with a bio-related substance, and L1, L2, L3, L4 and L5 are each independently a single bond or a divalent spacer.
US12187845B2
A polyester resin containing: a diol constituent unit containing a unit a1 derived from spiroglycol represented by formula (1) and a unit a2 derived from ethylene glycol; and a dicarboxylic acid constituent unit containing a unit b derived from terephthalic acid and/or an ester thereof. A content of the unit a1 is from 5 to 60 mol % and a content of the unit a2 is from 30 to 95 mol %, based on a total amount of the unit a1 and the unit a2. A content of the unit b is from 80 to 100 mol % based on a total amount of the dicarboxylic acid constituent unit.
US12187838B2
A preparation method for a self-thixotropic polyurethane curing agent includes the following steps: mixing an isocyanate and a crystalline polyester diol and/or polyether diol, reacting at a temperature between 70° C.-110° C., after a reaction, cooling to room temperature and standing still for more than 12 h to obtain the self-thixotropic polyurethane curing agent.
US12187836B2
A polyurethane composition consisting of a first component and a second component, wherein the first component contains a polyol having an OH functionality in the range from 1.5 to 4 and an average molecular weight in the range from 250 to 15 000 g/mol, a diol having two hydroxyl groups joined via a C2 to C9 carbon chain, and a compound having at least one thiol group. In addition, one of the two components additionally contains at least one metal catalyst for the reaction of hydroxyl groups and isocyanate groups that is able to form thio complexes, and the molar ratio of all NCO groups in the polyisocyanurates to all OH groups in the polyols is 0.9:1-1.2:1, and the polyurethane composition, directly after mixing of the components at 23° C., is free-flowing, and has a viscosity of <5000 Pa·s at a shear rate of 0.01 s−1.
US12187833B2
A polymerisable radiation-curable, in particular UV-Vis-, UV- or Vis-curable, composition comprising: (i) monomers, wherein the monomers comprise: (a.1) at least one triacrylate derived from 1,3,5-tris(ω-hydroxyalkyl) isocyanurate, wherein the hydroxyalkyl residue comprises 1 to 8 C-atoms and may be linear, branched and/or cyclic, and (a.2) at least one di-functional monomer, not being a urethane (meth)acrylate, and (ii) at least one further component, comprising: at least one photo-initiator for the UV and/or Vis spectral region or a photo-initiator system for the UV and/or Vis spectral region. Also disclosed is a blank in the form of a three-dimensional moulded body of a polymerised composition, in particular of a radiation-cured composition for producing dental prosthetic parts, orthopaedic appliances or dental pre-forms, and also to the use of the composition for producing dental prosthetic parts, orthopaedic appliances or dental pre-forms in a rapid prototyping or in a rapid manufacturing or rapid tooling method.
US12187826B2
The present invention provides a method for producing a molded body, having the step 1 of applying a composition containing an alicyclic urethane (meth)acrylate to a thermoplastic resin substrate to obtain a coated material, the step 2 of irradiating the obtained coated material with an active energy ray to cure the composition, obtaining a laminated material having a cured product layer obtained from the cured composition, and the step 3 of subjecting the obtained laminated material to bending processing to obtain a molded body, wherein the alicyclic urethane (meth)acrylate has a structure having an alicyclic structure represented by the formula (A), and a group having two or more (meth)acryloyl groups represented by the formula (B), and further has a polymerizable double bond equivalent of 100 to 1,000 g/mol.
US12187822B2
The present disclosure is directed to methods and compositions comprising photopolymerizable compositions for use in additive manufacturing, particularly for digital light processing, stereolithography or continuous liquid interface processing.
US12187821B2
A method for producing a fluorosulfonyl group-containing compound to obtain a compound represented by the following formula 5 from a compound represented by the following formula 1 as a starting material and a method for producing a fluorosulfonyl group-containing monomer in which the fluorosulfonyl group-containing compound is used: wherein R1 and R2 are a C1-3 alkylene group, and RF1 and RF2 are a C1-3 perfluoroalkylene group.
US12187809B2
The invention relates to proximity-based sortase-mediated protein purification and ligation. Specifically, the invention relates to techniques that links protein expression/purification with conjugation to therapeutic agents, imaging agents, or linkers.
US12187806B2
The present invention relates to a novel antibody, an antigen-binding fragment thereof and the uses of the antibody and fragment, wherein the antibody and the fragment comprise specific complementarity-determining regions (CDRs) and/or specifically bind to human CD73 at specific epitopes.
US12187802B2
The present invention provides antibodies that bind to the IL-3 receptor alpha subunit alpha (Il3Rα) chain, and compositions comprising such antibodies. The present invention provides methods for inhibiting or reducing an IL3Rα-expressing cell population, the methods comprising contacting a population of IL3Rα-expressing cells (e.g., cancer cells and/or cancer stem cells) with an antibody that binds to IL3Rα. The present invention also provides antibody conjugates comprising an antibody that binds to an IL3Rα chain linked to a cytotoxic agent or anticellular agent and compositions comprising such conjugates. The present invention also provides methods for preventing, treating and/or managing a disorder associated with IL3Rα-expressing cells (e.g., a hematological cancer), the methods comprising administering to a subject in need thereof an antibody that binds to IL3Rα.
US12187798B2
The present invention relates to specific binding members which bind to lymphocyte-activation gene 3 (LAG-3). The specific binding members preferably comprise a LAG-3 antigen-binding site which may be located in two or more structural loops of a CH3 domain of the specific binding member. The specific binding members of the invention find application, for example, in cancer therapy.
US12187791B2
The present disclosure relates to compositions for treating interleukin 5 (IL-5) mediated diseases, and related methods.
US12187776B2
The present application relates to the field of immunotherapy, more particularly to the field of chimeric antigen receptors (CARs). Currently, second and third generation CAR designs are quite rigid in that they combine fixed costimulatory domains in cis on the same intracellular protein domain. Trans signaling is not equivalent as costimulatory receptors have different expression levels or stoichiometry. Here, a ‘mix and match’ approach is proposed where different signaling and costimulatory domains are present on separate chains within the same CAR complex, allowing increased flexibility and control of the nature and strength of the CAR-generated signal. Also proposed are polynucleotides, vectors encoding the transmembrane polypeptide chains and cells expressing such CARs. These cells are particularly suitable for use in immunotherapy, and strategies to treat diseases such as cancer using these cells are also provided.
US12187775B2
Provided are chimeric antigen receptors having the hinge, transmembrane region, and/or intracellular domain of LILRB1, or functional fragments or variants thereof. Also provided herein are cells comprising the LILRB1 based receptors, and methods of making and using same.
US12187774B2
The present invention relates to heterodimeric Relaxin fusion polypeptides, in particular to heterodimeric Relaxin 2 fusion polypeptides and uses thereof. Thus, the invention provides Relaxin fusion polypeptides, nucleic acid molecules, vectors, host cells, pharmaceutical compositions and kits comprising the same and uses of the same including methods of treatment. The polypeptides and compositions of the invention may be useful, in particular, in the treatment of cardiovascular diseases, for example for the treatment of heart failure.
US12187770B2
A cyclic peptide from a bone morphogenetic protein 2 (BrvIP2). The cyclic peptide from the novel BMP2 is selected from one of the following cyclic polypeptides: 1. a cyclic polypeptide having the sequence of CKIPKASSVPTELSAISMLYLGPGGDWIVAC (SEQ ID NO:1); and 2. a cyclic polypeptide of which the sequence has an 80% homology with the sequence defined in item 1. A preparation method for the cyclic peptide from the novel Blv1P2, and an application thereof in the preparation of the composite material for promoting the repair of large-sized bone defects.
US12187767B2
The present application relates to methods and compositions and methods for treating viral infections, especially those caused by SARS-CoV-2. In one aspect, a method of treatment comprises administering to a subject in need of such treatment an effective amount of a pharmaceutical composition comprising a multipartite SARS-CoV-2-inhibiting peptide comprising a secretion modulating region (VI-SMR) peptide from HIV-1 Nef in combination with a cell-penetrating peptide (CPP) domain, a Clusterin (Clu)-binding peptide (Clu-BP) domain, a mitochondrial targeting (Mito-T) peptide domain, an anti-fusogenic (AF) peptide domain, a viral attachment inhibitor (VAI) domain or combination thereof, optionally where the SARS-CoV-2-inhibiting peptide is pegylated and/or modified with one or more hydrophobic domains.
US12187764B2
Provision of an affinity carrier using a mutant VHH antibody. An affinity carrier comprising: a solid phase carrier; and an immunoglobulin-binding protein bound to the solid phase carrier; wherein the immunoglobulin-binding protein comprises a mutant VHH antibody or a fragment of the mutant VHH antibody that recognizes an epitope in at least one region selected from the group consisting of amino acids 127 to 184 of SEQ ID NO: 22 and amino acids 13 to 210 of SEQ ID NO: 23.
US12187762B2
There are provided, inter alia, methods for decreasing mucus elasticity or decreasing mucus viscosity in a subject in need thereof, the methods including administering to the subject an effective amount of a dithiolsaccharide mucolytic agent, and compounds and pharmaceutical compositions useful for the methods.
US12187754B2
Provided herein are LpxC inhibitor compounds, as well as pharmaceutical compositions comprising said compounds, and methods of use thereof in the treatment of disease that would benefit from treatment with an LpxC inhibitor, including gram-negative bacterial infections such as urinary tract infections and the like.
US12187750B2
A bicyclic triolborate of the general formula and its use in an electrolyte composition. The use of a bicyclic triolborate in an electrolyte composition in electrochemical supercapacitors, such as for example in double-layer capacitors in electric motors.
US12187749B2
Biologically active compounds and their methods of preparation are provided that may be used as photosensitizers for diagnostic and therapeutic applications, particularly for PDT of cancer, infections and other hyperproliferative diseases, fluorescence diagnosis and PDT treatment of non-tumorous indications such as arthritis, inflammatory diseases, viral or bacterial infections, dermatological, otorhinolaryngology disorders, ophthalmological or urological disorders. As the compounds exhibit also toxicity against targets (tumor cells, bacteria inflammation-related cells) without light these biologically active compounds may also be used for the light-independent treatment of such indications. Embodiments also include methods to synthesize iridium(III) complex structures incorporating a substituted 2,3,5,6-tetrafluorophenyl-dipyrromethene (2,3,5,6-tetratfluorophenyldipyrrin) unit or a substituted 3-nitrophenyl-dipyrromethene (3-nitrophenyl-dipyrrin) unit. Amphiphilic compounds with increased anti-tumour and anti-bacterial efficacy are also provided. Specifically, this is achieved by substitution with bromine atoms and sugar moieties.
US12187747B2
Gold compounds and pharmaceutically acceptable salts thereof are disclosed. Certain compounds and salts are active as antibacterial, antifungal, and/or anti-parasitic agents. The disclosure provides pharmaceutical compositions containing the gold compounds. Methods of using the gold compounds to treat bacterial infections are disclosed.
US12187738B2
This disclosure is directed to substituted Imidazolo[2,1-b]oxazole, Imidazolo[2,1-b]thiazole, Imidazolo[2,1-b]oxadiazole, Imidazolo[2,1-b]oxadiathiazole derivatives of compounds that are antagonists of orexin receptors, and which are useful in the treatment or prevention of neurological and psychiatric disorders and diseases in which orexin receptors are involved or implicated. The invention is also directed to pharmaceutical compositions comprising these compounds and the use of these compounds and compositions in the prevention or treatment of such diseases in which orexin receptors are involved.
US12187737B2
This disclosure is directed to substituted Imidazolo[2,1-b]oxazole, Imidazolo[2,1-b]thiazole, Imidazolo[2,1-b]oxadiazole, Imidazolo[2,1-b]oxadiathiazole derivatives of compounds that are antagonists of orexin receptors, and which are useful in the treatment or prevention of neurological and psychiatric disorders and diseases in which orexin receptors are involved or implicated. The invention is also directed to pharmaceutical compositions comprising these compounds and the use of these compounds and compositions in the prevention or treatment of such diseases in which orexin receptors are involved.
US12187735B2
Described herein, are the chemical synthesis, matter of compositions, formulation, function, methods and uses of the FL118 platform Positions 7 and/or 9-derived analogues for treating cancer or other human diseases. Compounds derived from chemical modifications of the FL118 platform are employed alone or in combination with other anti-cancer agents to preclude, eliminate or reverse cancer phenotypes. This invention intends to realize unique personalized cancer treatment (personalized precision medicine) through application of a series of structural relevant individual FL118 platform-derived analogues, which target multiple cellular human disease-relevant proteins and their signaling pathways.
US12187733B1
Compounds for treating an inflammatory disease, disorder, or condition and, particularly, to compounds that are 5-(substitutedphenyl)-7-imino-7,8-dihydropyrimido[4,5-d]pyrimidine-2,4(1H,3H)-dione analogues and their use as anti-inflammatory agents.
US12187719B2
The present invention encompasses compounds of formula (1) wherein the groups R1, A, G, LK and t have the meanings given in the claims and specification, their use as degraders of SMARCA2 and/or SMARCA4, pharmaceutical compositions which contain compounds of this kind and their use as medicaments/medical uses, especially as agents for treatment and/or prevention of oncological diseases.
US12187718B1
A 1-cyclopropyl-6-fluoro-7-(4-((5-(4-methoxybenzylideneamino)-2-thioxo-1,3,4-thiadiazol-3(2H)-yl)methyl)piperazin-1-yl)-4-oxo-1,4-dihydroquinoline-3-carboxylic acid compound, its synthesis, and its use as an anticancer and/or anti-inflammatory agent.
US12187717B2
A compound represented by Formula 1, a stereoisomer thereof or a pharmaceutically acceptable salt thereof may be used for treating or preventing an autoimmune disease or a cancer. The autoimmune disease may be any one selected from the group consisting of inflammatory bowel disease, multiple sclerosis, graft-versus-host disease, asthma, atopy, psoriasis, rheumatoid arthritis, systemic lupus erythematous and type 1 diabetes. The cancer may be selected from the group consisting of colon cancer, melanoma, liver cancer, gliocytoma, ovarian cancer, colorectal cancer, head and neck cancer, bladder cancer, kidney cell cancer, stomach cancer, breast cancer, metastatic cancer, prostate cancer, gallbladder cancer, pancreatic cancer, blood cancer, skin cancer and lung cancer.
US12187714B2
The present invention provides an improved process for preparing an aminopyrimidine derivative or pharmaceutically acceptable salt thereof having a selective inhibitory activity against protein kinases, especially against the protein kinases for mutant epidermal growth factor receptors. Additionally, the present invention provides novel intermediates useful for said process and processes for preparing the same.
US12187710B2
Provided is a salt of an Syk inhibitor and a crystalline form thereof, and more specifically, provided are 5-fluoro-1-methyl-3-((5-(4-(oxetan-3-yl)piperazine-1)-yl)pyridin-2-yl)amino)-6-(1H-pyrazol-3-yl)quinoline-2(1H)-ketamine hydrochloride, a crystalline form thereof, a preparation method therefor, a pharmaceutical composition thereof and a use thereof. The hydrochloride of the compound represented by formula I and the crystalline form thereof have good salt-forming properties, high stability and low hygroscopicity, have advantages in terms of physical properties, safety and metabolic stability, and have value in prepared medicines.
US12187703B2
The present invention relates to crystalline forms of N-(3-(2-(2-hydroxyethoxy)-6-morpholinopyridin-4-yl)-4-methylphenyl)-2-(trifluoromethyl)isonicotinanmide and to processes for their preparation. Furthermore, the invention relates to a pharmaceutical composition comprising said crystalline forms of N-(3-(2-(2-hydroxyethoxy)-6-morpholinopyridin-4-yl)-4-methylphenyl)-2-trifluoromethyl)isonicotinamide, and at least one pharmaceutically acceptable excipient. The pharmaceutical composition of the present invention can be used as a medicament, in particular for the treatment of cancers.
US12187699B2
Provided herein are compounds having the formula I for treating, preventing or managing cancer. Also provided are pharmaceutical compositions comprising the compounds and methods of use of the compounds and compositions. In certain embodiments, the methods encompass treating, preventing or managing cancer, including solid tumors and blood borne tumors using the compounds provided herein.
US12187692B2
A process for producing ethylene oxide by gas-phase oxidation of ethylene, comprising: directing a feed comprising gaseous ethylene and gaseous oxygen through a packing of individual shaped catalyst bodies, under conditions conducive to obtain a reaction mixture containing at least 2.7 vol.-% of ethylene oxide, wherein each shaped catalyst body comprises silver deposited on a refractory support and is characterized by a content of at least 20 wt.-% of silver, relative to the total weight of the shaped catalyst body; a BET surface area in the range of 1.6 to 3.0 m2/g; a first face side surface, a second face side surface and a circumferential surface with a plurality of passageways extending from the first face side surface to the second face side surface; and a uniform multilobed cross-section; and a longest direct diffusion pathway d, with 2d being in the range of 0.7 to 2.4 mm, wherein the longest diffusion pathway d is defined as the shortest distance from the geometric surface of the shaped catalyst body to a point inside the structure of the shaped catalyst body for which point the shortest distance is the largest among all points. The process allows for increased activity and/or stability of the catalyst while maintaining or increasing selectivity at high productivity.
US12187691B2
Provided is a catalyst for amide compound hydrogenation characterized in that rhodium and molybdenum are supported on hydroxyapatite, the catalyst for amide compound hydrogenation providing a catalyst that can promote a reduction reaction that converts an amide compound into an amine compound, can be used under moderate conditions, and has durability that allows repeated use thereof while retaining high activity. Also provided is a method for producing an amine compound, the method being characterized by including bringing an amide compound into contact with the catalyst for amide compound hydrogenation to cause hydrogenation, thereby producing an amine compound.
US12187690B2
The invention relates to 1,2,5-benzothiadiazepine derivatives of formula (I). These compounds are bile acid modulators having apical sodium-dependent bile acid transporter (ASBT) and/or liver bile acid transport (LBAT) inhibitory activity. The invention also relates to pharmaceutical compositions comprising these compounds and to the use of these compounds in the treatment of cardiovascular diseases, fatty acid metabolism and glucose utilization disorders, gastrointestinal diseases and liver diseases.
US12187684B2
The present invention relates to benzimidazole derivatives of formula (I) as inhibitors of retinoid-related orphan receptor gamma (RORγ) protein, pharmaceutical compositions containing the compounds, preparation methods thereof, and the use of the compounds as therapeutic agents for the treatment of RORγ-mediated diseases or disorders.
US12187668B2
Compounds, pharmaceutical compositions, methods and kits are described for treating or preventing neurodegenerative diseases such as Alzheimer's disease.
US12187663B2
The invention concerns a compound of Formula (I) or a salt thereof, wherein R1 is H, (C1-C3)alkyl or CF3; R2 is H, (C1-C3)alkyl or CF3; A is CH2COOH, XCH2COOCH2CH3, XCH2COOH, XCH2CH2NH2, where X is nitrogen or oxygen atom; Ar is an aromatic fragment selected from the group consisting of (Ar1), (Ar2) and (Ar3); where R3 is H, —CH3, —CH2CH3 or CH3CO—, R4 is H or —CH3, R5 is H or —CH3, and R6 is H or —CH3. The compounds of Formula (I) can be used in the treatment of diseases modulated by thyroid hormone receptor-beta (TRb or TRβ).
US12187662B2
Provided are compounds, or pharmaceutically acceptable salts thereof, which are useful for inhibiting FOXM1, inhibiting cancer growth, and/or treating cancer. In particular, these compounds and their corresponding quaternary ammonium salts may be used to treat various forms of breast cancer.
US12187660B2
Compositions for increasing nitrogen sources life span in plant growth mediums and methods of making
Disclosed are compositions and methods of making a liquid fertilizer additive solution of polymeric and/or oligomeric heterocyclic nitrogen containing nitrification inhibitors comprising a non-aqueous polar, aprotic organo liquid (NAPAOL) as the reaction medium for the reaction of aldehyde(s) with heterocyclic nitrogen containing nitrification inhibitors that have one or more aldehyde reactive groups selected from the group consisting of a) primary, b) secondary amines, c) amides, d) thiols, e) hydroxyls and f) phenols. Fertilizer compositions are disclosed comprising of a) one or more polymeric and/or oligomeric heterocyclic nitrogen containing nitrification inhibitors adducts from the reaction of aldehyde(s) with heterocyclic nitrogen containing nitrification inhibitors that have one or more aldehyde reactive groups selected from the group consisting of a) primary, b) secondary amines, c) amides, d) thiols, e) hydroxyls and f) phenols b) a non-aqueous organo solvent delivery system (NOSDS), and c) one or more nitrogen sources.
US12187659B2
A method for preparing a nano carbon dioxide agent and an application of the agent are disclosed. The method takes cationic surfactant modified bentonite as a carrier, and the CO2 nano agent prepared by loading cationic surfactant modified chitosan, graphene oxide and organic alkali modified hydrotalcite has the photocatalytic effect of nano materials, which can enhance photosynthesis, increase photosynthetic rate, inhibit light respiration at night, synthesize chlorophyll for crop growth, accumulate three essential elements of carbon, hydrogen and oxygen for crop growth, effectively absorb, synthesize and transform organic components such as nitrogen, phosphorus and potassium in soil, fully promote the gestation, growth and maturity of crops, and increases production and income. The CO2 capture agent of the disclosure can be used for both facility crops and field crops, and the CO2 capture agent under normal temperature and pressure has wide application.
US12187657B2
An improved terrazzo process for applying terrazzo to an existing concrete surface comprising preparing the concrete surface, applying two layers of a primer agent, applying a terrazzo layer comprising calcium sulfoaluminate (CSA) cement, white milk glass, and one or more of broken mirrored glass and colored glass, cutting the terrazzo layer, applying a concrete densifier such that the concrete densifier penetrates into at least a portion of the concrete substrate, and grinding and polishing the densified terrazzo layer.
US12187656B2
A tooling assembly suitable for use in infiltrating a fibrous preform comprises a first perforated plate having an outer surface and an oppositely disposed inner surface defining a plate thickness therebetween, and a plurality of tapered holes extending through the thickness. Each hole of the plurality of tapered holes has a first diameter at the outer surface and a second diameter at the inner surface, and the first diameter is greater than the second diameter.
US12187650B2
A silicon carbide ceramic honeycomb structure having large numbers of axially penetrating flow paths partitioned by porous silicon carbide cell walls and being formed by integrally bonding honeycomb segments by binder layers, the cell walls having porosity of 40-50% and a median pore diameter of 8-18 μm, an average pore width W determined by averaging the lengths (pore widths) of all measured pore portions being 10-25 μm, the number N of pores per length determined by dividing the total number of the measured pores by the total length of the straight lines used for measurement being 20-40/mm, and the volume of pores having pore diameters of 20 μm or more being 10-20% of the total pore volume in the cell walls and the volume of pores having pore diameters of 9 μm or less being 3-25% of the total pore volume in the cell walls, measured by mercury porosimetry.
US12187636B2
An anti-fog glass includes a glass body configured as a single layer or a multilayer stack; an active anti-fog layer disposed on the glass body and heating up when being provided with power; and a passive anti-fog layer disposed on the glass body and inhibiting fog from forming on the passive anti-fog layer. The passive anti-fog layer is a super hydrophobic coating and/or hydrophilic coating. Both the active anti-fog layer and the passive anti-fog layer are simultaneously disposed on the glass body to inhibit fog from forming. In this way, in a region of the glass body not covered by the active anti-fog layer, the anti-fog function is achieved by the passive anti-fog layer to a certain degree; in addition, in a region where the passive anti-fog layer itself cannot provide a desired anti-fog level, the active anti-fog layer together with the passive anti-fog layer provide a better anti-fog effect.
US12187628B2
An exemplary embodiment of the present invention provides a system for disinfecting a fluid. The system can comprise: a cylindrically-shaped outer electrode defining an internal cavity: a center electrode positioned within the internal cavity, the center electrode extending along at least a portion of a longitudinal axis of the outer electrode: an inlet positioned proximate a first end of the outer electrode and configured to allow a fluid to pass from an area external to the internal cavity into the internal cavity; and an outlet positioned proximate a second end of the outer electrode and configured to allow the fluid to pass from the internal cavity into an area external to the internal cavity. The outer electrode and the center electrode can comprise at least one metal selected from the group consisting of copper, silver, and zinc.
US12187621B2
A method of making a composition of matter comprising calcium hydroxide. The method includes the steps of contacting a calcium-containing molecule with an aqueous solution of a water-soluble salt having ammonium cation and a counter-anion, under conditions effective to yield a compound containing calcium and the counter-anion; and reacting the compound comprising calcium and the counter-anion with ammonia and water under conditions to yield calcium hydroxide.
US12187617B2
A method of removing surface carbon contamination from polycrystalline silicon comprises providing a polycrystalline silicon feed stream having surface carbon contamination, subjecting the polycrystalline silicon to a high velocity fluid selected from gas, gas/liquid mixtures, gas/solid mixtures and gas/solid/liquid mixtures to form a product stream comprising polycrystalline silicon having surface carbon in an amount of less than 200 parts per billion by weight based on weight of the polycrystalline silicon product and/or a reduction in surface carbon contamination of at least 20%. A system for conducting the method comprises an enclosure, a conveyer for moving a polycrystalline silicon feed stream through the enclosure, at least one stream of a high velocity fluid passing through outlets in the enclosure and directed at the feed stream, an ionizing source in the enclosure or integrated with the at least one stream of high velocity fluid, and an exhaust system for the enclosure.
US12187613B2
A system and method of producing carbon nanotubes from flare gas and other gaseous carbon-containing sources.
US12187610B2
A positive electrode for a sodium ion battery is provided. The positive electrode includes a sodium metal vanadium fluorophosphate having a formula according to Formula I: Na3V2-xMxOy(PO4)2F3-y I; wherein 0
US12187604B2
Techniques to be described herein are based upon the combination of a digital lock-in amplifier approach with a numerical method to yield accurate estimations of the amplitude and phase of a sense signal obtained from a movement sensor associated with a resonant MEMS device such as a MEMS mirror. The techniques described herein are efficient from a computational point of view, in a manner which is suitable for applications in which the implementing hardware is to follow size and power consumption constraints.
US12187601B2
Described examples include sensor apparatus and integrated circuits having a package structure with an internal cavity and an opening that connects of the cavity with an ambient condition of an exterior of the package structure, and an electronic sensor structure mechanically supported by wires in the cavity and including a sensing surface exposed to the cavity to sense the ambient condition of an exterior of the package structure.
US12187588B2
A rib for an elevating platform, the rib designed and configured to insert through a slot in the sidewall of the elevating platform. The rib includes an internal rib component and an external rib component, wherein each of the components include at least an arm and a stem. The rib is operable to support an external load, such as an attached apparatus.
US12187583B2
A hoist lifting system having planning and monitoring of components. The system monitors one or more components and may have a processing structure and memory storing instructions to configure the processing structure to: receive hoist machine data; determine a rotation speed of a bearing, a travel speed of a rope, a load on the bearing, a friction in the at least one bearing based on the hoist machine data; and store the rotation speed, the travel speed, the load, and the friction in a maintenance database in memory. The hoist lifting system may have the processing structure determine a wear of one or more components.
US12187582B2
Controlling a container, such as a spreader, is described for engaging, retaining, and moving containers, as well as for unloading containers, particularly bottom-unloading containers. A spreader includes a frame having mounted thereon twistlocks, an actuator, a movable engagement mechanism, and force transmission means connecting the actuator and the movable engagement mechanism. The actuator and the force transmission means are substantially disposed along the long sides of the frame, and the movable engagement mechanism is substantially disposed on the short sides of the frame. The actuator allows the movable engagement mechanism to move reciprocally primarily in a direction perpendicular to the plane of the frame. The spreader significantly expands the functionality of devices used for engaging, retaining, moving, and unloading containers, makes it possible to unload a bottom-unloading container, and also allows the automation, simplification, and acceleration of the unloading process of such a container.
US12187578B2
A protector (200) for an elevator car (102) includes a protective panel (202) and at least one magnet (204) mounted to the protective panel (202). The magnet (204) is configured to be attracted to an internal wall (106) of a passenger compartment (104) of an elevator car (102) so as to retain the protective panel (202) against the internal wall (106). The magnet (204) may be retained against a support (210) of the protector (200) by a retainer assembly (220). The protector (200) may further comprise an electrical device which comprises a lighting device (240) configured to emit light into the passenger compartment (104) of the elevator car (102).
US12187575B2
A processing machine includes at least one processing unit configured as at least one shaping unit following, in a transport direction of a substrate, at least one processing unit configured as at least one application unit. Additionally, at least one transport unit is arranged between the at least one application unit and at least one succeeding processing unit. The at least one transport unit includes a plurality of transport elements that are arranged one behind the other in the transport direction. At least one transport element is axially adjustable based on detection of at least one image-producing element of a substrate by at least one sensor for substrate alignment.
US12187571B2
A reel handling robot for handling reels of web material, includes a movable arm carrying an end effector having a base, a reel picking tool, and a web gripping tool configured for gripping a head portion of a web on an outer surface of the reel.
US12187567B2
A tape dispenser comprises a main body, a blade, and an adhesive portion provided with a pressure-sensitive adhesive on a surface thereof. The adhesive portion is mounted below the blade and protruded from the main body. After a tape is cut by the blade, the adhesive portion contacts and adheres to the back of the tape's end so as to prevent the tape's end from flapping freely or unintentionally sticking back to the original location. At the next use, the adhesive portion can press the tape's end onto an object that needs to be taped.
US12187565B2
To prevent deformation to relatively stiffer sheets during flipping, while ensuring reliable holding of relatively weaker sheets, a method for stacking sheets received from a printer by a sheet flipping device includes at least one slot for receiving a leading portion of a sheet. The method includes determining a respective insertion depth parameter for a first and a second sheet, wherein the second sheet has a greater stiffness than the first sheet; inserting a length of the first sheet into the at least one slot in correspondence with its respective insertion depth parameter, followed by flipping said first sheet; inserting a length (D2) of the second sheet into the at least one slot in correspondence with its respective insertion depth parameter, followed by flipping said second sheet, wherein the inserted length of the first sheet is greater than that of the second sheet.
US12187560B2
A driving force transmission device includes a rotating body that is rotated by receiving a driving force, a control unit that controls rotation of the other rotating part by being switched between a connection state where the control unit is connected to the other rotating part and a separation state where the control unit is separated from the other rotating part as states of the control unit with respect to the other rotating part, and an operation unit that is operated by receiving a force output from the rotating body and includes a contact mechanism to be in contact with the control unit, the contact mechanism being moved by the force output from the rotating body to operate the control unit and the contact mechanism then being separated from the control unit.
US12187557B2
A food dispensing machine includes a housing, a tray, an auger, and a motor. The housing defines an interior and includes a front wall that defines a dispensation opening adjacent to the interior. The tray is disposed in the interior and defines a trough that is disposed adjacent to the dispensation opening. The auger is disposed in the trough and is selectively rotatable about a rotational axis. The motor is operably coupled with the auger for powering rotation of the auger.
US12187553B2
A layer destacking system, for destacking a layer from a stacked layer pallet load, including a layer seating platform configured so as to seat the destacked layer on the layer seating platform, a slip sheet detection sensor arranged to sense a slip sheet in contact with the seated destacked layer, a slip sheet pickup removal mechanism, and a controller that receives a signal from the slip sheet detection sensor identifying presence of the slip sheet. The controller is operably connected to the slip sheet pickup removal mechanism so as to actuate the slip sheet pickup removal mechanism effecting discharge of the slip sheet off the layer seating platform.
US12187551B1
Systems and methods are disclosed for seamless disengagement of shuttles powered by electromagnets. An example system may include a frame coupled to a track, a first conveyor disposed along the first side of the track, a second conveyor disposed along the second side of the track, and an actuator configured to drive the first conveyor and the second conveyor, where the first conveyor and the second conveyor are configured to engage a first bar disposed on a lower surface of the shuttle. The system may be configured to (i) move the shuttle from a first location along the track to a second location along the track, and (ii) pause movement of the shuttle between the first location and the second location.
US12187546B2
A printed magnetic rip insert and system for monitoring conveyor belts using printed rip inserts is disclosed. The system includes: a plurality of printed rip insert elements on a substrate of a conveyor belt; a field generator for generating a magnetic field proximate the printed rip insert elements; and a detector for detecting an image of a magnetic field produced by the plurality of printed rip inserts.
US12187542B2
A sprocket having a series of circumferentially spaced tooth blades bridging the peripheries of two axially spaced outer rings. An optional locking ring between the outer rings provides additional support for the tooth blades or the outer rings and helps lock the tooth blades in place. The sprocket can be a split sprocket for easier installation onto and removal from a shaft.
US12187541B2
A conveyor frame assembly that is constructed from component parts that are formed from stamped sheet metal and assembled after formation. The conveyor frame includes a pair of frame support members that each extend along the length of the conveyor frame from a first end to a second end. The frame support members each include an attachment flange and a side wall that extend perpendicular to a top wall. The frame support members each receive a plurality of cross supports that extend between the spaced side walls. The cross supports are each formed from sheet metal and are attached to the spaced side walls by connectors. First and second pairs of end brackets support end rollers on opposite ends of the conveyor assembly. The first and second end brackets are formed from sheet metal.
US12187533B2
The present invention relates to a container liner for holding liquid goods, wherein the liner comprises a film comprising one or more layers, wherein at least one of said layers is a layer L1 comprising (a) ≥20.0 wt %, preferably ≥20.0 and ≤80.0 wt %, with regard to the total weight of that layer L1, of a polyethylene P1 having: •a density of >900 and <915 kg/m3, preferably of >905 and <913 kg/m3 as determined in accordance with ASTM D1505 (2010); •a melt mass flow rate of ≥0.1 and ≤5.0 g/10 min, preferably of ≥0.5 and ≤2.0 g/10 min, as determined in accordance with ISO 1133-1 (2011) at 190° C. using a load of 2.16 kg; and (b) ≥20.0 wt %, preferably ≥20.0 and ≤80.0 wt %, with regard to the total weight of that layer L1, of a polyethylene plastomer P2 having: •a density of >880 and <905 kg/m3, preferably of >890 and <904 kg/m3 as determined in accordance with ASTM D1505 (2010); •a melt mass flow rate of ≥0.1 and ≤5.0 g/10 min, preferably of ≥0.5 and ≤2.0 g/10 min, as determined in accordance with ISO 1133-1 (2011) at 190° C. using a load of 2.16 kg. Such container liner demonstrates a desirably high flex resistance, combined with a high dart impact resistance, and a high tensile strength.
US12187532B2
An air composition adjustment device is provided with a cover unit including a cover that covers around a gas sensor, an inflow path that takes air into the cover, and an outflow path that causes air to flow out from the cover.
US12187525B2
A container (100), such as a cooler, has a center section (108), a bottom section, and a cover or lid. The center section has a plurality of outer walls (202) and a plurality of partial columns (210). Each outer wall has an inner surface (206), an outer surface (202), a top surface, a thickness, and a plane (204, 208) defined by the outer surface. Each partial column has an inner surface (214), an outer surface (212), a top surface (218), and a thickness, and defines a corner angle (216), such as approximately 90 degrees. The partial columns alternate with the outer walls, and the outer surface of a partial column extends beyond the plane of an adjacent outer wall. The center section and the bottom section are a unitary structure formed of a flexible insulating material, such as an EVA foam.
US12187522B2
The present invention relates to improved contact lens packages and methods of use and manufacture/assembly. A contact lens package may include a cavity that houses a contact lens, packaging solution, and an absorbent member. In one aspect, the absorbent member may be configured for transitioning between an expanded state and a compressed state, and the absorbent member may be in the compressed state when the package is in an unopened state.
US12187515B2
A package, a carrier for packaging one or more articles and a blank for forming the carrier are disclosed. The carrier comprises an engaging panel with at least one article-receiving aperture disposed in engagement with a part of an article. The engaging panel has a first side edge, a first end edge, a corner defined by the first side and end edges, and a corner area. The article-receiving aperture comprises a first engaging edge across the corner area from the corner. The corner area is defined at least partially by the first engaging edge, and end portions of each of the first side and end edges extending from the corner, respectively. The corner area is folded with respect to the remainder of the engaging panel such that the end portion of the first side edge is angled with respect to an adjoining portion of the first side edge. Also disclosed is a package comprising an article carrier and at least one article, the at least one article having an upwardly tapered upper portion, the carrier comprising an engaging panel comprising a first, upper, ply and a second, lower, ply, the lower ply including at least one lower aperture having an annular series of lower ply tabs formed around the at least one lower aperture, wherein the lower ply tabs are angled upwardly with respect to the engaging panel such that the lower ply tabs are in face-contacting engagement with the upper portion of the at least one article, the upper ply includes at least one upper aperture arranged substantially coaxially with the at least one lower aperture and has an annular series of upper ply tabs formed around the at least one upper aperture, the upper ply tabs are angled upwardly with respect to the engaging panel such that at least some of each of the upper ply tabs is in face-contacting engagement with a respective adjacent pair of the lower ply tabs.
US12187509B2
Child resistant packaging for storing medicine or medicinal compositions that frustrates or prevents a child's attempts to access the contents while permitting an adult to easily open the packaging through a series of movements or steps in coordination or combination to readily access the contents. The child resistant packaging includes a housing component and an insert component that is configured to slideably interact with an interior space of the housing component between a locked configuration and an unlocked configuration.
US12187499B2
A self-adaptive air bag blocking device is disclosed. The device includes an air bag, a first gas conveying pipe and a second gas conveying pipe, wherein an air chamber is formed in the air bag, a ring-shaped abutting surface is formed on the peripheral side of the air bag, so that the abutting surface abuts against a mouth of a container. The first gas conveying pipe is communicated with the air chamber and the outer part of the air bag, so that air enters the air chamber to enable the air bag to expand. The abutting surface is elastically deformed and tightly abuts against the inner wall of the container to form air-tight abutment, and the second gas conveying pipe is arranged on the air bag, so that air enters the container through the second gas conveying pipe, and thus the working liquid is discharged.
US12187492B2
A fabric security bag having a fabric closable draw string configuration is provided. In general, the fabric security bag includes a fabric envelope surrounding the fabric security bag chamber; a closeable opening at the top of the fabric envelope open to the chamber; and at least one longitudinal cable channel housing with a cable channel running longitudinally completely around the periphery of the closeable opening. The cable channel housing is secured to the top of the fabric envelope and has entries into the cable channel at each end of the longitudinal cable channel housing. The cable channel housing has a longitudinal fabric wall along its full length with a series of voids separated by fabric portions to reduce the amount of fabric enclosing the cable channel.
US12187486B2
A system for elevating polymeric crates with mounted sidewall assembly is described; a respective method of elevating polymeric crates with sidewall mountable assemblies and a kit-of-parts implementable for elevating polymeric crates with sidewall mountable assemblies are further described; the system comprises: a polymeric crate comprising a pair of longitudinal sidewalls and a pair of flanking sidewalls, at least one sidewall mountable elevating assembly comprising a pair of longitudinal members and a pair of flanking members; the method comprises: providing polymeric crate, providing pair of longitudinal members, providing pair of flanking members, mounting flanking members on polymeric crate, mounting longitudinal members on polymeric crate, assembling flanking members to longitudinal members; the kit-of-parts comprises: at least a pair of longitudinal members and at least a pair of flanking members.
US12187485B1
The basket with forearm grip is a container. The basket with forearm grip is adapted for use with an individual. The basket with forearm grip is carried by the individual. The basket with forearm grip is secured to one or more forearms of the individual. By forearm is meant the region from the elbow to the wrist of the individual. The basket with forearm grip includes a basket structure and a plurality of prismatic bifurcations. The plurality of prismatic bifurcations attaches to the basket structure. The basket structure contains goods that are carried by the individual using the basket with forearm grip. The plurality of prismatic bifurcations allows the individual carrying the basket with forearm grip to transfer a portion of the load of the goods contained in the basket structure to the skeletal structure of the individual. This transfer to the skeletal structure reduces muscle fatigue.
US12187482B2
A packaging apparatus for small piece goods, the use of the packaging apparatus, and a method for producing a blister tube are provided. The packaging apparatus includes a packaging material guiding device for providing a shaped packaging material web suitable for receiving small piece goods, a longitudinal joining device which is arranged downstream of the packaging material guiding device and a transverse joining device which is arranged downstream of the packaging material guiding device. The transverse joining device joins the shaped packaging material web together at predetermined intervals transversely to the direction of travel to form a transverse joining area. The transverse joining device includes two joiners, a first joiner having a plurality of embossers that are individually movable transversely to the direction of travel and are arranged so that they can be extended from the first joiner and retracted into the first joiner.
US12187473B2
A drying agent bag shaping and pushing device are provided, wherein a transverse moving block is slidably connected to a transverse moving rail, a short connecting block is connected to a long connecting block, a shaping platform is connected to a short connecting block, a lifting frame is provided on the shaping platform, lifting cylinders are connected to two sides of the lifting frame, a clamping cylinder is fixedly connected to a bottom surface of the lifting frame, a clamping plate connecting plate is connected to a cylinder connecting plate, a clamping plate is connected to the clamping plate connecting plate, a positioning plate is provided between the clamping plates, a front end and a rear end of the positioning plate are connected to two sides of the lifting frame, and a material pushing mechanism is provided on a side of the shaping platform away from the traverse moving rail.
US12187472B2
An apparatus for filling disposable capsules for preparation of beverages is disclosed. The apparatus includes a belt production line in continuous advancement comprising a plurality of seats arranged at a constant pitch for housing a plurality of capsules to be filled, a filling unit above the belt production line including a plurality of dosers for dosing food substance, wherein the plurality of dosers is configured in at least one rectilinear row of dosers and the plurality of seats is configured for transit below the filling unit in at least one rectilinear row of seats, in that the plurality of dosers is arranged at a constant pitch greater than the constant pitch of the plurality of housing seats. In addition, a coordinated movement element is envisaged, configured to impose on the rectilinear row of dosers and on said rectilinear row of seats a null relative speed.
US12187469B1
A method for packing includes a preparing step, a moving step, a first time feeding strap step, an encircling article step, a first time tightening step, a second time feeding strap step, a manual inserting step, a second time tightening step, and a strap cutting and bonding step. A strap feeding and retreating control unit of the strapping machine is controlled to tighten the packing strap tightly around the article, and then the strap feeding and retreating control unit is controlled to automatically pull out the packing strap, so that two insertion spaces are created between the packing strap and the article. The two right-angle pad elements can be respectively inserted into the two insertion spaces. Then, the packing strap is tightened to tightly wrap around the article and the two right-angle pad elements. Next, the packing strap is cut and bonded to complete the packing action of the article.
US12187454B2
An electronic flight assistant device has a first processor coupled to a firmware memory containing machine readable instructions executable by the processor (Firmware) and a random access (RAM) memory; an electronic camera coupled to the processor; a visible-wavelength laser adapted to be gated and scanned by the processor; a switchable cockpit light; at least one digital radio coupled to the processor; and a housing containing the processor, electronic camera, laser, digital radio, and cockpit light; the firmware configured to perform optical reading of cockpit instruments, to determine error conditions, and to scan the laser to provide indications to a pilot of error conditions.
US12187450B1
Integrated cooling structures and methods may comprise a motor, a propeller, and a component having at least one structural feature configured to receive or channel airflow to generate a positive pressure region at a first end of the motor. During operation of the motor and propeller, a negative pressure region may be generated at a second end of the motor proximate the propeller. The positive and negative pressure regions may generate a pressure differential or gradient between ends of the motor, such that a cooling airflow may be generated that flows through an interior of the motor from the positive pressure region to the negative pressure region. The cooling airflow may increase cooling of internal components of the motor, and consequently improve various operational capabilities, performance, and reliability of the motor and associated vehicle, machine, or system.
US12187443B2
Systems and methods for varying excess thrust of an aircraft include: a first electric fan rotatable about a first axis for directing a first air flow along a first air flow path; and a second electric fan rotatable about a second axis different from the first axis for directing a second air flow along a second air flow path fluidly isolated from the first air flow path, wherein the first electric fan and the second electric fan are disposed radially about a roll axis of the aircraft and adjacent an aft end of the aircraft, and the first electric fan and the second electric fan are configured to intake boundary layer air to form the first air flow and the second air flow.
US12187442B2
System for protecting an outer surface of an aircraft comprising at least two fuel cells (112, 212) from icing, characterized in that it comprises a first and a third liquid circuit (114, 214) each causing a cooling liquid of the fuel cells (112, 212) to flow, a second and a fourth liquid circuit (118a, 118b) each causing an icing protection liquid to flow, at least two icing protection heat exchangers (120a-d, 220a-d) arranged on the outer surface of the aircraft and having each icing protection liquid pass through them when it flows in the second or fourth liquid circuit (118a, 118b), and two liquid-liquid heat exchangers (116, 216) in which the cooling liquids form a hot pass and the icing protection liquids form a cold pass to reheat the icing protection liquid by the heat from the cooling liquids.
US12187440B2
A vehicle includes an internal cabin, a first group of seats within a first row within the internal cabin, a second group of seats within a second row within the internal cabin, and an air curtain system within the internal cabin. The air curtain system is configured to provide one or more air curtains between one or both of (a) the first row and the second row or (b) adjacent seats of one or both of the first group or the second group.
US12187428B2
One or more arrangements and associated methods for mechanical installation of an item at a location on a line that is suspended are provided. An arrangement includes a portion for mechanical actuation to install the item upon the line at the location. The arrangement includes a flying drone portion for levitation of the portion to the location on the line.
US12187419B2
A rotary shaft assembly includes a rotary shaft having a first end portion, a second end portion opposite the first end portion, a longitudinal axis extending centrally through the first and second end portions, and a shaft body that defines a bore between the first and second end portions. An anti-flailing mechanism is positioned within the bore of the shaft body. The anti-flailing mechanism is coupled to rotary shaft and extends at least partially between the first and second end portions to contain the rotary shaft about the longitudinal axis when the rotary shaft fails.
US12187406B2
A bulkhead assembly for an aircraft passenger cabin having a floor and a secondary support member includes upper and lower bulkhead panels and a bulkhead coupling member. The upper bulkhead panel defines an elongated tower portion that protrudes through a slot opening in an overhead closeout panel, and directly or indirectly connects to the secondary support member. The lower bulkhead panel connects to the upper bulkhead panel and to the floor via the bulkhead coupling member. A method for installing the bulkhead assembly in the passenger cabin includes connecting the lower bulkhead panel to the floor, joining the lower bulkhead panel to the base of the upper bulkhead panel using a bulkhead coupling member, inserting the terminal end through the slot opening, and connecting the terminal end to the secondary support member behind the overhead closeout panel.
US12187402B2
A ship steering device includes a handle which is mechanically separated from a rudder mechanism, a steering angle detecting unit that detects a steering angle of the handle, a rudder motor that drives the rudder mechanism, and a turn controller that controls, based on a steering characteristics map which associates a basic relation between the steering angle and a turn angle, the rudder motor so as to obtain the turn angle in accordance with the steering angle. The steering characteristics map has a characteristic such that, in a second steering region where the steering angle is larger than the steering angle in a first steering region, a change amount of the turn angle relative to the steering angle is large with respect to the first steering region where the steering angle is set from zero in advance.
US12187398B2
An outboard propulsion system comprising an engine configured to receive oil; an oil pan configured to receive oil from the engine; and an oil reservoir configured to receive oil from the oil pan and provide oil to the engine, in use.
US12187394B2
A watercraft lift system including one or more laterally-adjustable or rotating components and related methods are disclosed. The watercraft lift system can include a cradle assembly and optionally at least one side guide, which can (but need not) be connected to the cradle assembly. The cradle assembly can include first and second cradle rails. One or both of the first cradle rail and the at least one side guide can be movable between a wider watercraft-receiving position and a narrower watercraft-received position. In an example, movement of the first cradle rail and/or the at least one side guide from the watercraft-receiving position to the watercraft-received position occurs automatically upon entry of a watercraft into the confines of the watercraft lift system. The watercraft lift system can further comprise an actuator to cause lateral or rotational movement, for example, of the first cradle rail and/or the at least one side guide. In an example, the actuator can be operably connected to the first cradle rail and/or the at least one side guide via one or more cables or extension plate members.
US12187387B2
Described herein are polymers and associated methods to occlude structures and malformations of the vasculature with polymers with delayed controlled rates of expansion. Methods of forming such devices are also disclosed.
US12187380B2
A transmission apparatus which reverses transport gears, including a third transmission shaft provided with a plurality of third transmission members each of which is configurable between a non-selected condition and a selected condition. Furthermore, the apparatus comprises a second transmission shaft provided with a plurality of second transmission members axially arranged at a respective third transmission member and engaged with the latter to establish a predetermined transmission ratio. An activation device is operationally associated with said third transmission members to configure at most only one in the selected condition to select the relative transmission ratio. Finally, the apparatus comprises a gear reversal member interposed between a third and a second transmission member both used for gear reversal so that said third transmission shaft rotates inversely with respect to the other transmission ratios.
US12187368B2
The present disclosure relates to a steering joint assembly comprising an axle beam, a first king pin rigidly mounted on the axle beam, a steering knuckle, and a first spherical plain bearing rotatably connecting the first king pin to the steering knuckle.
US12187363B2
A working machine has a frame, a ground engaging propulsion system, a drive arrangement for providing motive power to the ground engaging propulsion system, an operator platform pivotally connected to the frame and moveable between a deployed position for supporting an operator thereon and a stowed position; and a sensor arrangement configured to sense when an external force is applied to the operator platform when said operator platform is in the deployed position. The machine prevents movement of the ground engaging propulsion system when the sensor arrangement does not sense an external force applied to the operator platform when said operator platform is in the deployed position.
US12187350B2
The present disclosure relates to a vehicle steering apparatus, the vehicle steering apparatus includes a main housing; a worm shaft rotatably disposed on the main housing; a worm wheel meshed with the worm shaft; a bearing disposed on the worm shaft; an elastically deformable guide surrounding an outer surface of the bearing and disposed within the main housing; and a pressing part extending through the elastically deformable guide to be in contact with the bearing and configured to press the worm shaft toward the worm wheel.
US12187349B2
A cavity sealing bulkhead part is provided comprising a first structural component, a second structural component and a hinge for producing a movable connection between the first structural component and the second structural component; the hinge comprising a first hinge component assigned to the first structural component and a second hinge component assigned to the second structural component, the first hinge component and the second hinge component being movable relative to one another about a shaft, at least one of the two hinge components comprising an expansion material that is convertible from an initial state into an expanded state by activation, and in the expanded state acting as a sealant between the first and second hinge components; and the bulkhead part being produced in a two-component injection molding process using a carrier material and the expansion material; also provided are methods for producing the bulkhead part.
US12187338B2
A pallet sled includes a lower frame and a plurality of wheels supporting the lower frame. An upper frame is configured to support a pallet thereon. A ratchet is configured to lift the upper frame relative to the lower frame. A handle is configured to operate the ratchet to lift the upper frame relative to the lower frame. The handle may be pivotable relative to the lower frame. The ratchet may include a gear and a pawl. The ratchet may also be configured to selectively lower the upper frame. As another option, one or more of the handle, the upper frame or the plurality of wheels are reconfigurable between an extended position and a retracted position.
US12187337B2
A conveyance system and a conveyance method capable of efficiently delivering/receiving containers between an AGV and a cart are provided. A conveyance system according to an aspect of the present disclosure includes an AGV configured to convey a plurality of containers, a cart configured to support the containers, and two platforms each of which includes a ramp on which the cart travels. The cart is further configured to, by a force applied from the AGV, climb up the ramp, and lift and support the containers placed on the AGV.
US12187335B2
A flatbed truck with a foldable caster unit, comprising a load-bearing plate, a load-bearing support frame and a caster unit, and further comprising a caster unit rotation driving device. The caster unit rotation driving device comprises an operating handle, a connecting rod, a front linkage mechanism and a rear linkage mechanism, wherein the operating handle is pivotally connected with the load-bearing plate and is rotatable around a pivot axis of the operating handle. The operating handle is capable of linking with the front linkage mechanism and the rear linkage mechanism via the connecting rod to respectively drive the front caster unit and the rear caster unit to be rotated from the folded storage position to the unfolded rolling position, when the operating handle is rotated from a first position to a second position.
US12187334B2
An enclosed medical case cart includes a left-side panel, a back panel, and a right-side panel supported on a chassis. A top panel is supported on the left and right-side panels and the back panel. A door including a transparent panel is coupled to either the left or right-side panel by a hinge. A plurality of freely-swiveling caster wheels are coupled to the chassis. A first status indicator assembly including a plurality of flags movable between a first position and a second position is coupled to the top panel. A second status indicatory assembly having an indicator disc movable between a first position and a second position is coupled to an interior surface of the door. A fifth-wheel assembly having a non-swiveling wheel movable between a first position and a second position is coupled to the chassis.
US12187330B2
A method and a structure for an Autonomous Train Control System (ATCS) are disclosed, and are based on a plurality of autonomous train control elements that operate independent of each other. An autonomous train control element operates within an allocated track space, and based on predefined rules. Further, autonomous train control elements are paired together to exchange operational data. Pursuant to the predefined rules, an autonomous train control element acquires needed track space from a paired element, and relinquishes track space that is not required for its autonomous operation to a paired element. Further, an autonomous train control element is assigned a priority level with respect to the acquisition/relinquishment of track space.
US12187326B2
A vehicular control system for controlling a vehicle includes a vehicle control, an acceleration sensor and a camera. The vehicle control includes an image processor for processing image data captured by the camera as the vehicle is driven along a route by a driver of the vehicle. The vehicle control detects traffic and road topography and determines acceleration of the vehicle as the vehicle is driven along the route by the driver. The vehicle control learns the route during multiple repetitive drives of the route by the driver of the vehicle. The vehicle control increases a confidence level of the learned route during multiple repetitive drives of the route by the vehicle. When the confidence level exceeds a threshold value, the vehicle control is operable to at least semi-autonomously control the vehicle to drive the vehicle along the route.
US12187320B2
Aspects of the present disclosure relate to differentiating between active and inactive construction zones. In one example, this may include identifying a construction object associated with a construction zone. The identified construction object may be used to map the area of the construction zone. Detailed map information may then be used to classify the activity of the construction zone. The area of the construction zone and the classification may be added to the detailed map information. Subsequent to adding the construction zone and the classification to the detailed map information, the construction object (or another construction object) may be identified. The location of the construction object may be used to identify the construction zone and classification from the detailed map information. The classification of the classification may be used to operate a vehicle having an autonomous mode.
US12187319B2
A control device associated with an autonomous vehicle receives sensor data and detects that the autonomous vehicle is approaching a railroad crossing based on the sensor data. The control device determines that no train is approaching the railroad crossing from the sensor data. The control device detects an indication of a stopped vehicle in front of the autonomous vehicle and behind the railroad crossing. The control device determines whether the stopped vehicle is associated with a mandatory stop rule. The mandatory stop rule indicates vehicles carrying hazardous materials have to stop behind the railroad crossing even when no train is approaching or traveling through the railroad crossing. If it is determined that the stopped vehicle is associated with the mandatory stop rule, the control device waits behind the stopped vehicle until the stopped vehicle crosses the railroad crossing and instructs the autonomous vehicle to cross the railroad.
US12187301B2
A method of implementing distributed AI or ML learning for autonomous vehicles is disclosed. An AI or ML model specific to a location or a type of the location is generated at a vehicle. In response to a detection that the vehicle is within a proximity to a road side unit (RSU) associated with the location or the type of the location or the vehicle is within a proximity to an additional vehicle that is present or anticipated to be present at the location or the type of the location, causing an AI or ML model transmission to the additional vehicle or the RSU. Based on the causing the AI or ML model reception, causing deployment of an additional AI or ML model in the vehicle to optimize the vehicle for the location or the type of the location.
US12187296B2
An electronic system for controlling vibrations and/or inertial forces occurring at a plurality of areas of interest within an operating vehicle, the electronic device comprising circuitry configured to: receive input data comprising sensor data from one or more environment sensors (12) and/or one or more internal sensors (14); convert, by means of a machine learning system (18), the input data into actuator settings; and transmit the actuator settings to one or more actuators (20) to control vibrations and/or inertial forces occurring at each of the plurality of areas of interest within the vehicle.
US12187291B2
A control device executes: a process of calculating a boundary line based on information on an environment around the vehicle such that the boundary line is set at a predetermined position distanced from a recognized object around the vehicle; a process of determining whether the vehicle is traveling in a direction to approach the boundary line, based on information on a running state of the vehicle; and a process of generating a reaction force to an operation on a steering device of the vehicle by a driver in the direction to approach the boundary line such that the reaction force corresponds to a relative position of the vehicle to the boundary line, the process being executed in a case where an affirmative determination is made in the process of determining.
US12187289B1
A data analytics computing device for generating refined risk models responsive to vehicle-based telematics data is configured to receive geolocation data and telematics data associated with a plurality of vehicles. The geolocation data is captured at a location sensor of a vehicle computing device and representative of a location of the vehicle, and the telematics data is captured at a plurality of sensors of at least one of the vehicle or the vehicle computing device and representative of movement of the vehicle. The plurality of vehicles is associated with a geographic area. The data analytics computing device is also configured to apply machine-learning techniques to the geolocation data and the telematics data to define standard driving behavior within the geographic area, and generate driving behavior risk models for the geographic area based upon the standard driving behavior.
US12187286B2
A system and method are provided for disabling a retarder during a gearshift at low speeds for improved driver comfort. These embodiments recognize that power flow is interrupted during a shifting process and use that opportunity to disable the retarder at low speeds, thereby eliminating an additional, uncomfortable jolt to the driver. Several embodiments are provided.
US12187284B2
A vehicle control device of the embodiment includes a recognizer configured to recognize a surrounding situation of a vehicle and a driving controller configured to control one or both of steering and a speed of the vehicle on the basis of the surrounding situation recognized by the recognizer, in which the driving controller causes the vehicle to travel by executing any one of a plurality of driving modes including at least a first driving mode and a second driving mode in which a task imposed on an occupant of the vehicle is heavier than in the first driving mode, and switches from the first driving mode to the second driving mode when a first section in which the number of lanes of a road on which the vehicle travels is different from the current number of lanes and a second section in which a road having at least three lanes branches are present within a predetermined distance in a traveling direction of the vehicle while the first driving mode is executed.
US12187278B1
Methods, systems, and non-transitory computer-readable media are configured to perform operations comprising determining first speeds of first objects in a first lane and second speeds of second objects in a second lane; determining a first speed of traffic for the first lane based on the first speeds and a second speed of traffic for the second lane based on the second speeds; and generating a speed limit for a third lane based on the first speed of traffic and the second speed of traffic.
US12187273B2
A vehicle drive assist device includes an ECU. The ECU determines whether an object recognition condition meets a predetermined condition, which means that a driver of the vehicle recognizes the presence of an object ahead of the vehicle, based on the state of an operation of an operator of the vehicle by the driver. The ECU executes deceleration control when the collision index value is smaller than a second index value smaller than a first index value and the ECU determines the object recognition condition does not meet the predetermined condition. The ECU does not execute the deceleration control when the ECU determines the object recognition condition meets the predetermined condition even when the collision index value is smaller than the second index value.
US12187272B2
A vehicle comprises an autonomous driving system and a vehicle platform that controls the vehicle in response to a command received from the autonomous driving system. In the present vehicle, when the autonomous driving system issues a first command to request the vehicle platform to provide deceleration to stop the vehicle and a first signal indicates 0 km/h or a prescribed velocity or less, the autonomous driving system issues a second command to request the vehicle platform to maintain stationary. And after brake hold control is finished, a second signal indicates standstill. Until the second signal indicates standstill, the first command continues to request the vehicle platform to provide deceleration.
US12187271B2
A control device to be applied to a vehicle equipped with an imaging device and a safety device is configured to, based on moving-object detection information detected from images captured by the imaging device, actuate the safety device for a moving object. In the control device, a control unit is configured to, in response to any of certain information that it is certain that the object is a moving object and uncertain information indicating that it is not certain whether the object is a moving object being acquired as moving-object detection information, actuate the safety device based on a position of the object subjected to detection with the certain information or the uncertain information. An actuation region setting unit is configured to, when the moving-object detection information is the uncertain information, narrow an actuation region as compared to when the moving-object detection information is the certain information.
US12187269B2
A real-time machine perception system and vehicles with real-time perception systems can be adapted for navigation in conflict zone environments and include an optical sensor and an optical processing component coupled to the optical sensor. The optical processing component can be configured to solve a non-linear control problem comprising solving a multi-vehicle merging or multi-vehicle synchronization problem. The optical processing component can perform optical processing on a signal from the optical sensor according to a deep learning algorithm having weights determined by solving the non-linear control problem.
US12187268B2
An autonomous vehicle configured for active sensing may also be configured to weigh expected information gains from active-sensing actions against risk costs associated with the active-sensing actions. An example method involves: (a) receiving information from one or more sensors of an autonomous vehicle, (b) determining a risk-cost framework that indicates risk costs across a range of degrees to which an active-sensing action can be performed, wherein the active-sensing action comprises an action that is performable by the autonomous vehicle to potentially improve the information upon which at least one of the control processes for the autonomous vehicle is based, (c) determining an information-improvement expectation framework across the range of degrees to which the active-sensing action can be performed, and (d) applying the risk-cost framework and the information-improvement expectation framework to determine a degree to which the active-sensing action should be performed.
US12187251B2
An electro-mechanical brake device comprising: a sensor unit comprising one or more sensors; an electronic parking brake (EPB) configured to fix a wheel of the vehicle when the vehicle is parked; a hydraulic braking unit configured to supply a braking force to a wheel brake using hydraulic pressure generated at a master cylinder; a driving control unit configured to determine whether braking is required for the vehicle based on at least one of a driver's braking intention, a change in the hydraulic pressure at the master cylinder, a vehicle status, an engine status and a transmission state, and further configured to determine whether an actuator has failed; and an actuator decision unit configured to, when the driving control unit determines that braking is required for the vehicle, brake the vehicle using any one of the hydraulic braking unit and the EPB depending on whether the actuator has failed.
US12187250B2
Disclosed is an electronic parking brake system including an electronic front-wheel parking brake provided on a front wheel side of a vehicle and configured to be operated by a front wheel motor, an electronic rear-wheel parking brake provided on a rear wheel side of the vehicle and configured to be operated by a rear wheel motor, a motor driving device configured to drive at least one of the front wheel motor and the rear wheel motor, and a controller electrically connected to the motor driving device, wherein the controller receives operation mode selection information in which an operation mode for operating at least one of the electronic front-wheel parking brake and the electronic rear-wheel parking brake is selected, and controls the motor driving device to operate at least one of the electronic front-wheel parking brake and the electronic rear-wheel parking brake in response to the operation mode of the received operation mode selection information.
US12187248B2
An apparatus controls release of a parking brake of a parking brake system of an associated vehicle. A processor of an electronic control system of the apparatus executes parking brake control logic stored in a non-transient memory device to selectively generate a parking brake release (PBR) signal based on receiving a set of predetermined PBR interlock override signals in an absence of receiving fully all of a set of predetermined PBR interlock standard satisfaction signals, wherein receiving fully all of the set of predetermined PBR interlock standard satisfaction signals causes the processor executing the parking brake control logic to generate the PBR signal. The sets of predetermined PBR interlock override and interlock standard satisfaction signals are mutually different, and the PBR signal is deliverable for use by the associated vehicle to effect the release of the parking brake of the parking brake system of the associated vehicle.
US12187247B2
Disclosed herein an electronic brake system includes a first block in which a mechanical unit operated mechanically in association with a brake pedal is disposed; a second block in which an electrical unit electronically operated and controlled by an electronic control unit is disposed; and a connection line configured to hydraulically connect the first block and the second block, and the first block and the second block are installed at positions spaced apart in a vehicle so that mountability of the brake system and the degree of freedom in design of the vehicle may be improved.
US12187245B2
The vehicle includes a SBW actuator capable of switching between a locked state in which the drive wheels of the vehicle are restrained from rotating and an unlocked state in which the rotation of the drive wheels is not restrained by the actuator, a parking lock releasing operation unit for switching the locked state of SBW actuator to an unlocked state by manual operation, and an undercover covering a lower portion of the parking lock releasing operation unit, and the undercover is provided with a through hole, and the parking lock releasing operation unit is exposed downward from the through hole.
US12187238B2
The invention relates to a cleaning unit for cleaning a sensor window pane of an optical sensing device of a motor vehicle. The optical sensing device can preferably be for optical distance measurement, more preferably it can be a LiDAR sensor device. The cleaning unit comprises a wiper blade. The cleaning unit further comprises at least a first scraper for scraping impediments off the wiper blade. The cleaning unit is arranged for wiping the wiper blade over the sensor window pane. The cleaning unit is further arranged for moving at least one of the wiper blade and the first scraper with respect to each other and along each other for scraping impediments off the wiper blade.
US12187236B2
A car-mounted bike rack includes a connecting beam and at least one support beam, wherein the support beam is fixedly disposed on the connecting beam, a front wheel fixing assembly and a rear wheel fixing assembly are disposed on the support beam, the front wheel fixing assembly comprises an arc-shaped support plate and a clamping mechanism, a convex arc surface of the arc-shaped support plate is rotatably connected to an upper surface of the support beam, and the clamping mechanism is rotatably connected to a side face of the support beam and is matched with a concave arc surface of the arc-shaped support plate to lock a front wheel of a bike.
US12187235B2
An accessory support platform is provided for supporting a removable accessory, e.g. a stair system or cabinet, adjacent to a vehicle or portable living quarter, such as a truck-bed mounted camper. The accessory platform includes a support frame for coupling the platform to the truck camper. The support frame supports or suspends a support rail system from the rear portion of the truck camper. The rail system includes an upper support rail and a lower support rail that is suspended below and apart from the upper rail. The removable accessory may be coupled at one of or between both of the upper and lower support rails. The removable accessory is preferably readily repositionable relative to the upper and lower support rails. A coupling bracket and/or hanger secures the removable accessory to the rail system.
US12187227B2
A system is mounted on a vehicle and includes a sensor configured to perform a detection process that detects a fingerprint of a finger touching the sensor in order to perform a fingerprint authentication process, and a controller. The controller is configured to: (i) control a power supply of the vehicle to be ON when a predetermined authentication process through a predetermined communication with another device other than the sensor is successful, the predetermined authentication process being different from the fingerprint authentication process, and (ii) suppress the detection process that detects the fingerprint in response to the power supply of the vehicle being ON and the predetermined authentication process being successful.
US12187223B2
A lock control system includes: an automatic door lock configured to unlock and lock a door of a vehicle; a wireless transceiver configured to wirelessly receive a first unique identifier for a period of use of the vehicle by a non-owner of the vehicle from a server that is remote from the vehicle; an input device configured to capture a second unique identifier output by an electronic device through a glass component of the vehicle; and a lock control module configured to: compare the first unique identifier with the second unique identifier; and selectively actuate the automatic door lock thereby unlocking the door in response to a determination that the second unique identifier is the same as the first unique identifier.
US12187211B2
To suppress deformation of a vehicle cabin by efficiently absorbing an impact load obliquely from a vehicle front side, a vehicle-body front structure includes an upper-side cross member, a lower-side cross member, upper-side impact absorption members that support respective ones of both vehicle-width-direction sides of the upper-side cross member, and lower-side impact absorption members that support respective ones of both vehicle-width-direction sides of the lower-side cross member. The upper-side impact absorption members and the lower-side impact absorption members are each positioned farther on a vehicle-width-direction outer side at a position farther on a vehicle front side.
US12187206B2
A motor vehicle power cable comprising a flat conductor having an at least rectangular profile, wherein the flat conductor extends along a longitudinal axis, a vertical axis extending along a surface normal of a wide surface of the flat conductor, and a transverse axis extending along a surface normal of a narrow surface of the flat conductor and the flat conductor is bent about the vertical axis and having an inner bend radius and an outer bend radius, characterized in that the flat conductor has at least one forming about the longitudinal axis in the region of the inner bending radius at its inner side edge arranged at the inner bending radius.
US12187201B2
The invention relates to a management method of an assistance system for a windscreen of a cab of a vehicle, the vehicle comprising a camera assembly including at least one camera located on the top of the windscreen with an angle between 25° and 75° with respect to the windscreen, for providing a captured image of a wide angle field of view located in front of the vehicle, said wide angle field of view comprising a first front field of vision, a second field of vision of a front-view and a third rear field of the vision, the method comprising: Determining a state of the windscreen using the at least one camera and Processing the captured image, according to the state of the windscreen, to operate the windscreen system on the windscreen.
US12187191B2
A vehicular active spoiler-type lighting device and a vehicular active spoiler-type lighting method includes an insertion recess formed in a vehicle body, an air current adjustment module inserted into the insertion recess and protruding out of the insertion recess, thereby changing a direction of air current flowing along a surface of the vehicle body, a drive module mounted in the insertion recess, connected to the air current adjustment module, and configured to insert the air current adjustment module into the insertion recess or to pull the air current adjustment module out of the insertion recess, and a lamp module configured to provide lighting to the air current adjustment module.
US12187187B1
The present disclosure relates to determining a first illumination level corresponding to an area based at least on a first illumination detection obtained using a first illumination detector corresponding to a machine. A second illumination level corresponding to the area may be determined based at least on a second illumination detection obtained using a second illumination detector corresponding to the machine. Based at least on the first illumination level and the second illumination level, a scene illumination state of the area may be determined. Based at least on the scene illumination state, one or more lights of the machine may be controlled.
US12187186B2
A vehicle lamp system includes an illuminance variable lamp, a lamp-mounted camera, and a lamp control unit. After acquiring position information of a low accuracy region from a vehicle control unit, the lamp control unit acquires illuminance of the low accuracy region by referring to information acquired by the lamp-mounted camera, controls the illuminance variable lamp so as to increase the illuminance of the low accuracy region if the illuminance of the low accuracy region is less than a threshold, and/or controls the illuminance variable lamp so as to decrease the illuminance of the low accuracy region if the illuminance of the low accuracy region is equal to or greater than the threshold.
US12187178B2
A utility land vehicle is provided having a cargo compartment that includes a retention system. One embodiment of the retention system includes latch and receiver assemblies. The latch assembly includes first and second latches. The first and second latches are spaced apart from each other. A tie attached to each of the first and second latches actuates to cause both first and second latches to release. The receiver assemblies comprise first and second receivers. Each of the first and second receivers includes a body and a slot formed in the body. Each of the slots formed in each body of each of the first and second receivers includes an opening wherein the opening of the slot formed in the body of the first receiver faces the first latch, and the opening of the slot formed in the body of the second receiver faces the second latch.
US12187171B2
A seatbelt adjusting structure, a child carrier comprising the seat belt adjusting structure, and a child safety seat. The seat belt adjusting structure is suitable for adjusting the position of a seatbelt of the child carrier corresponding to the shoulder of a child, the seatbelt adjusting structure comprises a supporting member movably arranged on the child carrier, the supporting member is provided with a plurality of rows of adjusting parts which are arranged at different heights and are used for accommodating the seat belt, and the position of the seat belt corresponding to the shoulder of the child is adjusted by means of the movement of the supporting member in combination with the cooperation between the seat belt and the adjusting parts arranged at different heights. An opening part used for adjusting the seat belt can be further formed on the supporting member.
US12187167B2
The present disclosure relates to a power seat integrated control method. One embodiment of the present disclosure includes: a signal input step of receiving a power seat operation signal input that a user inputs through an interface of a vehicle; a determination step of determining an operating condition for operating a motor module that is built into the power seat and moves a specific area of the power seat; and an information transmission step of transmitting driving information for controlling the motor module in accordance with a type of the operation signal. The motor module includes a driving motor and a motor controller which controls the driving motor, and one LIN communication bus is provided between the integrated controller and each power seat. In the information transmission step, the integrated controller transmits the driving information to the motor controller through the LIN communication bus.
US12187166B2
A sliding rail transmission device includes a driving portion and at least one sliding rail assembly, the sliding rail assembly includes a rail and a movable member, the rail is provided with a flanging, the flanging forms a first transmission toothed belt, and the rail is provided with a damping strip at a position of the first transmission toothed belt, the damping strip forms a second transmission toothed belt, the first transmission toothed belt and the second transmission toothed belt are arranged side by side, the movable member is provided with a transmission gear, the transmission gear is arranged below the first transmission toothed belt and the second transmission toothed belt, and the transmission gear can mesh with the first transmission toothed belt and the second transmission toothed belt simultaneously; and the driving portion drives the transmission gear to rotate to drive the movable member to move along the rail.
US12187163B2
A high-voltage system of a fuel cell vehicle and a method for operating said system are described herein.
US12187160B2
A method for controlling the cell balancing of a battery of electrical accumulators of an electrical system includes balancing, for each subgroup, the cell having the largest amount of electrical charge to be balanced with selected cells.
US12187159B2
A system includes a vehicle including a motive electrical power path; a power distribution unit including: a current protection circuit disposed in the motive electrical power path, the current protection circuit including a fuse and a contactor in a series arrangement with the fuse; a high voltage power input coupling including a first electrical interface for a high voltage power source; and a high voltage power output coupling including a second electrical interface for a motive power load, where the current protection circuit electrically couples the high voltage power input coupling to the high voltage power output coupling.
US12187156B2
A refuse vehicle includes a chassis, a body assembly, and battery cells. The body assembly is coupled to the chassis and defines a refuse compartment. The battery cells are positioned between the body assembly and the chassis.
US12187145B2
An electrical power supply cord includes a wire cable comprising a plurality of separate conductors, a plurality of plug terminals connected to the plurality of separate conductors, a molded inner plug encasing a connection between the plurality of plug terminals and the plurality of separate conductors, and an in-mold bonding adhesive disposed intermediate the connection between the plurality of plug terminals and the plurality of separate conductors and the molded inner plug.
US12187131B2
An axle assembly (200) includes a first axle housing (102), a second axle housing (104), a first wheel end (216), a second wheel end (218), and at least one drive shaft (150) extending through the first axle housing (102) and the second axle housing (104) and coupled to the first and second wheel ends (216, 218). The axle assembly (200) also includes a gearbox (210) having a body (240) with first and second portions (242, 244) defining a cavity (246) with the first axle housing (102) coupled to the first portion (242) and the second axle housing (104) coupled to the second portion (244). The axle housing (200) further includes an electric motor (122) coupled to the first portion (242) of the body (240). The gearbox (210) includes a gear train (153) having an input shaft (160) having one end coupled to the electric motor (122) and an output shaft (172) rotatably coupled to the input shaft (160). The gear train (153) further includes a clutch (174) having a shifting fork (178) movable between an engaged state and a disengaged state to couple the output shaft (172) to the drive shaft (150) such that the electric motor (122) drives the drive shaft (150) and to uncouple the output shaft (172) from the drive shaft (150) such that the drive shaft (150) is able to rotate independently from the electric motor (122).
US12187127B2
A vehicle shown herein is a side by side utility vehicle having a powertrain an engine with at least three cylinders, an intake and an exhaust, where the intake is forward of the engine and the exhaust is rearward of the engine. The vehicle may further or alternatively include an engine block configured to couple with various transmissions without alteration of the engine block itself.
US12187109B2
A wind deflector for an openable vehicle roof having a displaceable cover element, the wind deflector may have a deployable deflector element which is made of a planar flexible material and forms a windward surface, the deflector element being attached to a pivotable deploying bow at its upper edge area and to a vehicle-attached base at its lower edge area and comprising a warp-knitted fabric having meshes. The warp-knitted fabric is a one-piece warp-knitted fabric. The windward surface is a curved surface whose curvature is defined by the interknitted meshes of the warp-knitted fabric.
US12187101B2
In a vehicle air conditioner, a controller is configured (i) to set a target cooling temperature of air cooled by a cooling heat exchanger, (ii) to control an operation of a compressor based on a cooling temperature and the target cooling temperature of the cooling heat exchanger, and (iii) to determine a traveling state of the vehicle. The controller is configured to set a normal target temperature as the target cooling temperature when the vehicle is traveling with a normal condition, and to set a modified target temperature higher than the normal target temperature as the target cooling temperature when the vehicle starts decelerating. In addition, the controller is configured to cause the compressor to stop operating when the vehicle starts decelerating, and to cause the compressor to restart operating when the cooling temperature detected by a temperature sensor is equal to or higher than the modified target temperature.
US12187099B2
Air conditioning temperature measurement device for use with a valve actuated refrigerant recharge assembly operates in conjunction with a pressurized refrigerant bottle and a-remote temperature sensor enabled by radio frequency (RF) wireless communication. Sampled temperatures at an output vent of an air-conditioned cabin and rate of temperature change at the inlet modulate recharge of refrigerant into low pressure side of a phase change A/C control system. Automated sensing of the rate of temperature change in an air conditioner outlet vent, and modulation of refrigerant refill rate, ensure sufficient refrigerant is introduced to improve cooling efficiency while overfill is prevented by refrigerant valve control as rate of temperature change approaches a parabolic minimum. System controls for insufficient change in absolute temperature and inverted relationship in rate of temperature change to prevent recharge of unstable air conditioning system, thereby limiting the discharge of gases that contribute to greenhouse gas accumulation in the upper atmosphere.
US12187087B2
A vehicle drivetrain device, configured to be mounted between a vehicle frame and a wheel axle of a vehicle, comprises a driving assembly and a shock absorber, connected to the vehicle frame and the driving assembly. The driving assembly comprises a transmitting mechanism, pivotally connected to the vehicle frame and connected to the wheel axle, and a driving mechanism mounted at a side of the transmitting mechanism and outputting power to the wheel axle through the transmitting mechanism. The driving assembly of the vehicle drivetrain device possesses functions of a rear rocker arm and provides power. Therefore, a space between the vehicle frame and the wheel axle can be used efficiently, and the occupancy of a usable space below the vehicle frame is decreased. Furthermore, the transmitting mechanism can be directly connected to the wheel axle by a gear set, simplifying a total structure, thereby lowering the cost.
US12187085B2
A hitch system includes an upper hitch portion that is configured to couple to a trailer coupler portion and to a vehicle coupler portion to provide multiple degrees of rotational freedom as well as longitudinal coupling for towing the trailer by the vehicle. A weight distributing lower hitch portion couples to the upper hitch portion about a transverse axis. The weight distributing lower hitch portion includes spring bars extending to rearward points on a frame of the trailer between a tongue of the trailer and the axle of the trailer. The upper hitch portion and lower hitch portion are biased away from each other and hence bias the spring bars away from the trailer frame. The spring bars may then be coupled to the trailer frame by using respective levers to transfer weight distribution.
US12187078B2
A pneumatic tire including a first block line in which a plurality of first blocks sectioned by main grooves and lateral grooves are arranged in a tire circumferential direction on a tread, the plurality of lateral grooves includes first lateral grooves extending inclined with respect to a tire width direction and second lateral grooves inclined in an opposite direction to the first lateral grooves with respect to the tire width direction, the first and second lateral grooves are alternately arranged, the first block includes a first sipe extending while being inclined to the tire width direction, a second sipe inclined in an opposite direction to the first sipe with respect to the tire width direction, and a first connecting portion connecting ends of the first sipe and the second sipe, and the first connecting portion is formed by a recessed portion shallower than the first sipe and the second sipe.
US12187077B2
A tire includes a mounting direction indicator that indicates a tire mounting direction with respect to a vehicle. The tire includes a first circumferential groove and a second circumferential groove extending intermittently or continuously in a tire circumferential direction. Additionally, the second circumferential groove is located further on an inner side than the first circumferential groove in a vehicle width direction in a state in which the tire is mounted on a vehicle. Additionally, a groove volume V1 of the first circumferential groove and a groove volume V2 of the second circumferential groove have the relationship V1
US12187073B2
A method for manufacturing a one-piece wheel by forging includes: producing an integral forging comprising: a disc portion, a rim portion, and an annular protrusion protruding from one side of the disc portion in a forging method; producing an outer bend by bending the annular protrusion through a flow-forming process; and forming a hollow portion by welding one end of the outer bend to one side of the rim portion.
US12187066B2
The present invention relates to an article comprising fluorescence marker particles, wherein the fluorescence marker particles are distributed throughout the volume of the article or in a portion of the volume of the article and the fluorescence marker particles are present in a random distribution; the volume in which the fluorescence marker particles are distributed comprises a sub-volume; the sub-volume contains at least a portion of the fluorescence marker particles; the sub-volume is at least partially permeable to electromagnetic radiation having a wavelength in the visible range and/or in the near infrared range and/or in the UVA range; and/or a portion of the surface of the sub-volume is identical to a portion of the surface of the article; and a method of identifying it.
US12187060B2
A composition for producing a laser-inscribable identification tag for attachment to an assembly to be identified includes: a polymeric plastic; and a filler. The filler comprises graphene particles, barium particles, and/or barium sulfate particles. In an embodiment, the polymeric plastic includes polypropylene, polyethylene, PVC, TPU, TPE, TPV, PP/PA, polyketone, PA, ABS, PET, and/or PMMA.
US12187054B2
According to an embodiment, a controller of an image forming apparatus collects data relating to maintenance of the image forming apparatus. If failing to collect data, the controller confirms a cause of the collection failure and sets, if the cause of the collection failure is an interruption of a print job, an image forming job as a held job. Subsequently, the controller resumes the collection of the maintenance data that the controller has failed to collect.
US12187043B2
A liquid supply device supplying a liquid to a printer includes a supply tube and an agitator. The supply tube configures a supply flow path of the liquid to the printer. The supply tube is connected to a tank configured to store the liquid. The tank is provided further upstream than the printer in the supply flow path. The supply tube is configured to supply the liquid from the tank toward the printer. The agitator includes a stirrer and is configured to perform an agitation operation of driving the stirrer and agitating the liquid inside the tank.
US12187042B2
A printing apparatus includes a liquid storing container including a storage chamber configured to store a liquid supplied to a printing unit that prints an image by discharging the liquid, an outlet portion of the liquid, and a channel configured to connect the storage chamber and the outlet portion. The liquid storing container includes a first side portion on a side of a print region where printing is executed by the printing unit, and a second side portion on an opposite side of the first side portion, and the channel is formed in the second side portion.
US12187041B2
A liquid storage container includes: a discharge port member including a discharge port through which liquid stored in a storage portion is discharged and a coupling portion in which a male thread portion is arranged on the outside; and a cover portion including a female thread portion on the inside and configured to be attachable to the discharge port member, the female thread portion configured to be screwed to the male thread portion, in which the male thread portion is discontinuous in the coupling portion.
US12187040B2
A liquid ejecting apparatus includes a recording head that ejects ink, an ink tank that contains ink and that includes an inlet through which ink is poured from a refill container, an outer case that houses the recording head and the ink tank and that includes an upper case member disposed in the +Z direction and a side case member crossing the upper case member, and an opening and closing cover that is attached to the outer case and that is configured to rotate between an open position at which the ink can be poured from the refill container into the ink tank and a closed position at which the ink tank is covered. The side case member has a cutout.
US12187038B2
A method of operating a continuous inkjet printer (1). The printer comprise a printhead. The printhead comprises a droplet generator (16) comprising a printing nozzle (17) for ejecting an ink jet for printing, at least one electrode (22, 23) for steering the inkjet, and a gutter (18) having an ink receiving orifice (24) for receiving parts of the ink jet which are not used for printing. The method comprises performing a cleaning operation. Said cleaning operation comprises: ejecting a solvent jet from the printing nozzle towards the gutter; and causing at least a portion of the solvent jet to contact at least a part of the gutter (18) surrounding the orifice (24) for cleaning said part of the gutter surrounding the orifice.
US12187025B2
An on-machine development type planographic printing plate precursor has a support and an image-recording layer on the support. The image-recording layer contains an initiator, an infrared absorber capable of donating electrons to the initiator, and a color-developing substance precursor. The image-recording layer can form an image by exposure to infrared laser, and in a case where the image-recording layer is exposed to an infrared laser with a wavelength of 830 nm at an energy density of 110 mJ/cm2, a brightness change ΔL of the image-recording layer before and after the exposure is 3.0 or more. A method for preparing a planographic printing plate and a planographic printing method employ the on-machine development type planographic printing plate precursor.
US12187018B2
A sound-absorbing article (e.g., a tufted sound-absorbing article) can comprise a backing having a thickness and a plurality of face fibers associated with the backing. Optionally, the face fibers can comprise a plurality of tufts extending through the backing. The backing can define a plurality of perforations that fully extend through the thickness of the backing and are provided in a pattern to determine an acoustic property of the sound-absorbing article. Within at least a portion of the backing, sequential perforations within the pattern of the plurality of perforations can be spaced center-to-center by between 5 mm and 100 mm.
US12187008B2
A procedure is presented for making a continuous tape of at least one metallic material of malleable/ductile metallic materials. The process includes passing a continuous strip of the metallic material between a rigid cylinder and a presser in elastically compressible material, held adherent to the rigid cylinder and at the same time subjecting the continuous tape, in at least a portion of its passage between the rigid roller and the presser and a reduction in the speed of its surface in contact with the presser with respect to the speed of its surface in contact with the rigid cylinder the surfaces of the outgoing tape being always parallel to each other and the final width of the tape corresponding to the initial width.
US12187001B2
A method of molding a tire that has a container (12) that includes the steps of placing an uncured tire into a mold, and providing a bladder (16) that has a flexible portion (18) and an insert (20) that has a cavity configured for molding the container into the tire. The bladder has a fluid therein and is inflated within the mold, and material of the uncured tire flows into the cavity of the insert (20). Sufficient heat and pressure is applied to the uncured tire to at least partially cure the tire when the uncured tire is in the mold. The material in the insert (20) forms the container (12) such that the container is integrally formed with other portions of the tire. The mold is opened to retrieve the tire.
US12186996B2
A welding assembly is disclosed. The welding assembly includes a plurality of separately controllable actuators (e.g., pneumatic, having an axially movable ram) to press a corresponding portion of a first workpiece (e.g., a discrete flange of a first stiffener) against a second workpiece (e.g., an outer skin) for welding operations (e.g., via induction welding).
US12186994B2
The present disclosure provides a glue-dispensing method of a display module and a glue-dispensing device of the display module. After the display module is fixed to a glue-dispensing platform, a region to be glue-dispensed of the display module is scanned in real time. And glue-dispensing terms are adjusted in real time according to scanning results, glue bodies formed by glue-dispensing are confirmed, and the glue-dispensing terms are deeply fine-tuned according to the glue bodies. Therefore, the embodiments of the present disclosure can achieve advanced prevention, process avoidance, a detection effect after completion, and a depth compensation according to the effect.
US12186983B2
An apparatus, system and method for providing a nozzle having refined print control and enhanced printing speed by providing, on the inside or outside or on an interstitial substrate layer, of any metallic or non-metallic nozzle of a non-conductive surface suitable to support sensors relevant to the FFF process. Heat, force, flow, strain, stress, extrusion force, and like sensors may be provided on the inside or the outside of any nozzle, or on an interstitial substrate layer on the inside or outside of any nozzle. The sensors may be provided about the center access through the nozzle, longitudinally along the center access of the nozzle, or at any of various points along the nozzle, wherein the placement or shape of such sensors may vary in accordance with the type of sensing to be performed by the subject sensor.
US12186981B2
A method of forming a three-dimensional object comprises the steps of forming a layer of a particulate composition, selectively depositing a liquid composition onto the layer of the particulate composition in accordance with computer data corresponding to the shape of at least a portion of a three-dimensional object, and repeating the steps a plurality of times to form a three-dimensional object. The particulate composition comprises a plurality of first particles that comprise a resin component comprising a first resin, the first resin comprising a first resin polymerizable group. Either or both of the particulate composition and the liquid composition comprise an initiator capable of initiating polymerization of at least the first resin. At least the first resin undergoes melting and polymerization in a plurality of the locations where the liquid composition has been selectively deposited.
US12186971B2
The present invention is to provide a method for producing a biaxially oriented polyester film that is superior in mechanical properties, transparency, and heat resistance, and at the same time, superior in secondary processing suitability and printing appearance. Disclosed is a biaxially oriented polyester film, having at least one surface satisfying the following requirements (1) and (2), and the film satisfying the following requirements (3) and (4). (1) A maximum peak height roughness (SRp) is 1.2 μm to 1.6 μm. (2) An arithmetic average roughness (SRa) is 0.024 μm to 0.045 μm. (3) A tensile strength in a longitudinal direction and a width direction is 180 MPa to 300 MPa. (4) A haze is 7% or less.
US12186970B2
A multi-arm forming device for space on-orbit composite braiding is provided. Through the rotary movement of a combination of circularly arranged mechanical arm-type laying apparatuses relative to a mold, a plurality of hot press laying heads are controlled together to implement high-efficiency and high-freedom winding and braiding formation of a composite member. The retraction and expansion deformation of the gasbag mold is achieved by inflating and deflating based on design, and the overall device is lightened by switching its structural volume in an operating/non-operating state, thereby achieving the purpose of facilitating the lift-off of rockets and the demolding, repair and weight reduction of winding and braiding structural members for operation in space. Additionally, gas in a gasbag can be used as emergency kinetic energy for the movement and attitude adjustment of the overall device in space. High-quality and efficient winding and braiding formation of composites in space are achieved ultimately.
US12186962B2
The invention provides a process of obtaining a bi-oriented co-extruded film of 7 layers by triple bubble process for autoclave sterilization processes, which unlike the current existing materials for food sterilization, the invention does not require an individual manufacturing process of each sheet and subsequent lamination, but it is manufactured in a single step, in addition no metal compound is included in its composition, and provides a shelf life of more than a year in food products that are packaged in the process of sterilization (retort) inside the film.
US12186960B2
An injection molding machine including a mold clamping device for clamping a mold comprising a fixed mold and a movable mold by a predetermined mold clamping force; an injection device for injecting and filling a resin into the mold by a predetermined injection pressure, wherein the mold clamping device enables natural compression of the resin at least as the resin inside the mold solidifies; and a molding machine controller at least including a specific molding condition setting function for setting a specific molding condition by obtaining a parting opening amount which becomes a predetermined gap between the movable mold and the fixed mold during injection filling, a molding injection pressure which becomes an injection pressure capable of molding a good product and a molding clamping force which becomes a mold clamping force capable of molding a good product; a fast injection condition setting function for setting, as a fast injection condition, a fast injection speed from the start of injection, the fast injection speed being higher than the injection speed set by the specific molding condition, and a fast injection section for continuing the fast injection speed; and a molding control function for mold-clamping the mold clamping device by the molding clamping force, setting the molding injection pressure to a limit pressure, injecting and filling the mold by the fast injection condition from the start of injection, and filling the mold by the specific molding condition by the end of the fast injection section.
US12186956B2
A plasticizing device includes: a flat screw that has a groove forming surface on which a spiral first groove is formed, and that rotates; a barrel that has a facing surface facing the groove forming surface and that includes a communication hole through which a plasticizing material flows; a heater that heats resin pellets; and a screw case that accommodates the flat screw and that includes a passage port through which the resin pellets pass toward the flat screw, in which the flat screw has a first side surface on which a first supply port for supplying the resin pellets to the first groove is formed and a second side surface formed on a side farther from the barrel than the first side surface, and a first distance, which is a shortest distance between the first side surface and the screw case, is larger than a second distance, which is a shortest distance between the second side surface and the screw case.
US12186949B2
Provided is a method for manufacturing a rotary power transmission member including a ring-shaped main body part fixed to a rotating shaft, and a ring-shaped gear part formed on an outer circumference part of the main body part to transmit rotational force of the rotating shaft to other members. The method includes gear part molding for injecting a high melting point resin into a first mold to mold the gear part, and main body part molding for injecting a low melting point resin to mold the main body part while the gear part being inserted into a second mold. The first mold includes a runner defined on an inner circumference side of a ring-shaped cavity for molding the gear part, and a gate which communicates the runner with the cavity to supply a resin into the cavity.
US12186947B2
Provided are a pellet including a thermoplastic resin and cellulose nanofibers that enables the production of a molded body which has a good appearance in which yellowing is suppressed, and a method for producing a molded body using the same. According to one aspect, there is provided a pellet including a thermoplastic resin and cellulose nanofibers, wherein the number of pore-containing pellets per 100 pellets is 10 or less. Further, according to another aspect, there is provided a method for producing a molded body, which includes a step of preparing the pellets, and a step of injection molding the pellets in a mold to obtain a molded body.
US12186946B2
A pressware product includes a top piece and a bottom piece. The top piece includes a planar central portion, a sidewall extending from the central planar portion, and a flange extending horizontally from the sidewall. The flange includes a slot and a radially extending top groove. The bottom piece cooperatively defines an inner space with the top piece. The bottom piece includes a planar central portion, a sidewall extending from the central planar portion, and a flange extending horizontally from the sidewall. The flange includes a locking flap configured to engage the slot of the top piece and a radially extending bottom groove. The radially extending bottom groove cooperatively defines a channel with the top groove so that the channel is in fluid communication with the inner space.
US12186936B2
A linear actuator is used to remove solid-state parts in low-temperature condition from the containers used as a mold for manufacturing parts using freeze-casting. The device allows pressure to be applied to the material to be removed, resulting in ejection. The displacement of the material is performed with controlled displacement speed, providing the achievement of defect-free materials. The system performing the ejection includes a source of compressed air, a pressure regulator filter coupled with a manometer, a directional valve, the linear actuator, a baton, a flow regulating valve, a fastening means, a metallic support and a chamber for receiving the cooled material.
US12186933B2
The invention relates to a method for utilizing mineral materials for additive manufacturing that can be implemented more quickly, more economically and with greater technical simplicity, in comparison with common additive manufacturing, by virtue of controlled expansion in the sintering process by means of a laser source. The entire production process is free of organic materials and allows previously unfeasible end uses in the fields of acoustic insulation, thermal insulation, fire protection, filtration, design objects and lightweight components to be realized. In particular, the invention relates to a method for producing a product by means of 3-D printing or additive manufacturing, wherein an open-pore lightweight part is constructed layer-by-layer, without the use of organic binders or other organic auxiliary agents, from a pulverous mineral starting raw substance of natural origin, which raw substance is obtained without chemical alteration of the solid constituents of the natural material, and wherein, beginning with the second layer, the most recently applied layer is bonded to the surface of the existing body of the lightweight part by means of immediately subsequently performed direct selective laser sintering.
US12186920B2
A robot system is provided which can suitably perform robot movement correction. The robot system is provided with: a visual sensor which captures a first image of a target with the robot in a prescribed position and which captures a second image of the target with the robot in the position resulting from moving the robot a prescribed distance from the aforementioned prescribed position; a calibration data storage unit which stores calibration data that associates the robot coordinate system of the robot and the image coordinate system of the visual sensor; a first acquisition unit which, on the basis of the first image and the calibration data, acquires a first position of the target in the robot coordinate system; a second acquisition unit which, on the basis of the first image and the second image, acquires a second position of the target in the robot coordinate system; and a determination unit which determines whether or not the difference between the first position and the second position is within a prescribed range.
US12186907B2
Dynamically adjusting, using artificial intelligence (AI), sensors and models of an autonomous roaming robotic device, which includes receiving data regarding an asset at a computer of a roaming robotic device from sensors on the robotic device. The robotic device identifies an asset at a location using the sensors, and the robotic device has instructions, received from a control system, to inspect the location or items at the location. The data is analyzed using the computer of the robotic device, and the analysis includes using historical data for the asset. An AI model is loaded using the computer of the robotic device, based on the identification of the asset. A sensor is selected using the computer of the robotic device, for conducting an inspection of the asset based on the analysis of the data and the AI model.
US12186906B2
A robot teaching device generates an operation program of a robot by arranging an instruction icon that represents an operation instruction of the robot. The robot teaching device comprises means for displaying a plurality of marks associated with the instruction icon in a case that the operation instruction includes a plurality of positions, wherein the mark is associated with an identifier of the position.
US12186904B2
A manipulator is provided. The manipulator includes a gripper, a depth sensor, a force sensor configured to sense an external force acting on the gripper; a memory storing instructions; and a processor configured to execute the instructions to: control the gripper to grasp an object, acquire first information on the object based on a first sensing value obtained by the force sensor while grasping the object, control the gripper such that a first area of the object comes into contact with a surface on which the object is to be placed, acquire location information on a contact area between the first area and the surface, acquire a rotation direction to rotate the object based on the location information and the first information on the object, control the gripper to rotate the object in the rotation direction around the contact area, and based on a second area of the object being in contact with the surface, control the gripper to release the object.
US12186901B2
A robot system includes first and third robots arranged along a transport direction in which a workpiece is conveyed, and a second robot arranged between the first and third robots along the transport direction. Each of the first and third robots has a first distal end at which a first end effector is configured to be provided to work on the workpiece and has a plurality of axes arranged in a first axis configuration in which a rotation axis, a pivot axis, a pivot axis, and a rotation axis are arranged in this order from the first distal end. The second robot has a second distal end at which a second end effector is configured to be provided to work on the workpiece. The second robot has a second axis configuration different from the first axis configuration.
US12186899B2
An assist device includes: a first brace configured to be worn on at least a waist of a user; an arm configured to extend along a thigh of the user and to rotate with respect to the first brace; an actuator configured to generate torque that rotates the arm; and a second brace provided on the arm and configured to be worn on the thigh. The arm includes an arm body and a holding portion. The holding portion is provided on the arm body such that the holding portion is movable in a longitudinal direction of the arm body. The holding portion holds the second brace such that the second brace is rotatable.
US12186898B2
A part transporting device for transporting a consumable part includes a part housing, a container, a robot arm, and a moving mechanism. The part housing accommodates an unused consumable part and a used consumable part. The container has an opening to be connected to a processing device and a gate valve for opening or closing the opening, the container being configured to accommodate the part housing. The robot arm is provided in the container and has at least one end effector at a tip end thereof, the robot arm transferring the used consumable part from the processing device through the opening to accommodate the used consumable part in the part housing and transferring the unused consumable part from the part housing to load the unused consumable part the processing device through the opening. The moving mechanism has a power source and is configured to move the part transporting device.
US12186894B2
An assembly of links and motorized joint unit comprises two or more links. The links have a tubular body, one or both ends of the tubular body being an open end. A motorized joint unit has a first portion received in the open end of the tubular body of a first of the links so as to be secured relative to the first of the links. A second portion is rotatable relative to the first portion by actuation of the motorized joint unit, the second portion received in the open end of the tubular body of a second of the links, the motorized joint unit secured relative to the second of the links. A protective sleeve has a tubular body mounted over part of the motorized joint unit to cover a gap between the first and the second of the links, the protective sleeve having a rigid annular member and a flexible annular member, the flexible annular member foldable onto the rigid annular member.
US12186893B2
In a soft grip head, a soft grip unit having the soft grip head, and a grip device having the soft grip unit, the soft grip head has a suction pad and the suction pad makes contact with an object. The suction pad includes a sidewall and a plurality of suction cells. The sidewall divides the suction pad into a plurality of spaces, and both ends of each of the spaces are open. A plurality of suction cells is respectively formed by the spaces divided by the sidewall. The suction pad includes a material having a stiffness along an axial direction smaller than a stiffness along a width direction. The suction cells extend along the axial direction, and the width direction is substantially perpendicular to the axial direction.
US12186885B2
A device for performing emotional gestures to interact with a user. The device includes a base; a controller; a first body portion pivotally connected to the base, the first body portion having a first aperture; an electro-mechanical member disposed within the first body portion and connected to the controller; and a second body portion connected to the electro-mechanical member, the second body portion having a second aperture. The electro-mechanical member is configured to extend from the first body portion through the first aperture to the second body portion through the second aperture and the controller is configured to control movements of the electro-mechanical member and the first body portion, where the movements include emotional gestures.
US12186884B2
The invention relates to a device for holding and releasing an object, comprising a main body comprising a housing to at least partially accommodate said object and an opening to enable at least a portion of the object to be removed, a lid that can be moved from a closed position preventing access to said opening and an open position enabling access to said opening, and a stop mechanism designed such that it can be moved to different positions relative to the main body towards the opening of said main body, but blocked in the other direction, to enable the stop mechanism to be brought into contact with or close to the object while preventing any recoil of the stop mechanism. The invention also relates to a corresponding production method and release methods.
US12186882B2
A telescopic rod device includes an outer tube including adjustment holes, an inner tube having a through hole, an actuator unit mounted inside the inner tube and has an actuating portion, and an adjustment control unit having a restraining member that has a restraining portion, a resilient member, and a lug connected with the resilient member and protruding from the through hole to engage with an adjustment hole. The resilient member biases the lug to extend out of the through hole and engage an adjustment hole, and when the actuator unit moves relative to the inner tube, the actuating portion of the actuator unit actuates movement of the restraining portion, and the restraining member acts on the resilient member so that the lug disengages the adjustment hole.
US12186875B2
A nailer for suppressing misfire while keeping operability. In a first mode, a control circuit drives a drive source when a second ON determination is made and a first ON determination is made in a state where a second operation unit is maintained at a second ON position, and when the drive source is driven and then a second OFF determination is made in a state where a first operation unit is maintained at a first ON position, the control circuit does not drive the drive source again unless returning to the initial state. In a second mode, the control circuit drives the drive source when the first ON determination is made and the second ON determination is made in a state where the first operation unit is maintained at the first ON position. A second OFF determination time in the second mode is longer than in the first mode.
US12186870B2
A powered fastener driver having a motor, a biasing member configured to store a force for driving a fastener, a lifter configured to release the force, a piston configured to be urged by the force towards a bottom-dead-center position to drive the fastener into a workpiece, and a magnet coupled to the lifter for rotation therewith. The magnet is formed as a single piece including a first pair of poles having a first north pole face and a first south pole face, and a second pair of poles including a second north pole face and a second south pole face. The first north pole face is adjacent the second south pole face, and a pole junction is defined between the first and second pairs of poles. A sensor is configured to detect the pole junction. A controller is configured to control the motor based on detection of the pole junction.
US12186863B2
Disclosed is a drill attachment device comprising a transfer gear configured to rotate about an axis perpendicular to the axis of a drill used to power the transfer gear. The transfer gear may comprise an open-ended slot which provides a passageway through which a threaded rod may pass. The open-ended slot may further be configured to retain a mechanical nut, enabling a user to run a threaded rod through the open-ended slot for driving the nut along the rod. The transfer gear may also support an external driver, and the drill attachment device may comprise guide slots configured to position the rod and/or nut against the external driver for driving a nut up or down rod.
US12186852B2
A stacker for a 3D printer apparatus contains a positioning conveyor and a support plate hinged to drop on a signal, whereupon a push plate will push a printed and powdered sheet downward and onto registration pins, to form a stacked register of such sheets.
US12186851B2
A method for evacuating a volume below a substrate in a substrate processing system includes arranging the substrate on a lift mechanism of a substrate support to define the volume below the substrate between the substrate and an upper surface of the substrate support. An evacuation step is initiated to evacuate the volume below the substrate. The evacuation step includes pumping down the volume below the substrate at least one of through and around the lift mechanism. The lift mechanism is lowered during the evacuation step to position the substrate on the upper surface of the substrate support and the evacuation step is terminated.
US12186850B2
The invention makes available a device for damping the vibrations of a spindle of a machine tool, which spindle rotates about an axis of rotation, which device has a central longitudinal axis that is oriented coaxial to the axis of rotation of the spindle during use, and a housing that is provided for torque-proof coupling to the spindle and delimits a housing space that is configured as a ring space oriented coaxial to the central longitudinal axis and surrounds the central longitudinal axis, a ring-shaped damper mass that is arranged to move in the housing space relative to the central longitudinal axis and oriented coaxial to the central longitudinal axis in the rest state, and includes at least one spring element, by way of which the damper mass is movably held on the housing, with elastic resilience, with reference to the central longitudinal axis of the device, at least in the circumference direction of the damper mass. In that in the case of such a device, according to the invention, a gap is present between a circumference surface of the damper mass and an inner surface of the housing, which gap is filled with a viscous damper fluid, and in that, according to the invention, the clear width of the gap filled with the viscous fluid is adjustable, the damping effect can be adapted to the corresponding requirements in a simple manner.
US12186846B2
The present disclosure generally relates to apparatus, systems, and kits of parts for knock-down heavy-duty transportable torque tool assemblies capable of onsite field-servicing of high-pressure heavy-duty hydraulic cylinders used in heavy-duty construction equipment and industrial machinery. The embodiments disclosed herein pertain to assemblies comprising modular knock-down components that may be mounted onto the bed of a field service truck and configured as needed to provide loosening and retorquing of piston-retaining nuts.
US12186844B2
A fastening tool includes: a cylindrical rotation guide member extending in one direction and rotatably supported; a holding member having an opening to which a driver bit is detachably inserted, and configured to move in an axis direction along the extension direction of the rotation guide member inside the rotation guide member and to rotate together with the rotation guide member; and a moving member configured to move the holding member in a front and rear direction along the rotation guide member.
US12186843B2
A fastening tool including a bit holding unit configured to hold a driver bit so as to be rotatable and to be movable in an axis direction, a first drive unit having a first motor configured to rotate the driver bit held by the bit holding unit, and a second drive unit having a second motor configured to move the driver bit held by the bit holding unit along the axis direction.
US12186840B2
A pulse arc welding profile control method, a control device, a welding system, a welding program, and a welding power supply are provided in which, even when a pulse arc welding method is used, protruding change information is extractable at high accuracy without influence from a welding current or an arc voltage having a pulse shape. An electric change amount detected at the time of weaving includes, as a parameter, at least one among a welding current detection signal and an arc voltage detection signal, takes a predetermined period as one period, calculates an average value of the electric change amount in each one period, and extracts, on the basis of the average value, the protruding change information in a groove to follow a welding line.
US12186836B2
The present invention relates to a flux-cored wire for positive polarity gas-shielded arc welding use, in which a flux contains a metal powder and also contains BaF2 and SrF2 and AlF3 and/or CaF2 as fluorides wherein the content of BaF2 is 1.0 to 4.5%, the content of SrF2 is 2.0% or less, the content of CaF2 is 0.45% or less and the content of AlF3 is 0.70% or less, at least one of metal elements constituting the flux and the fluorides is a strong deoxidizing metal element having a specified standard formation Gibbs energy, and the content of each of an oxide and a carbonate in the flux is 0.5% or less.
US12186827B2
A method of forming a rod feedstock for titanium stir friction welding additive manufacturing may comprise: mixing a plurality of powdered metals comprising titanium, iron, vanadium, and aluminum to produce a powder blend; at least one of die pressing the powder blend to form a die pressed powder or continuously powder rolling the powder blend to form a die pressed powder; and sintering the powder blend to form a rod feedstock having a cross-sectional profile.
US12186825B2
A device and a method for producing a continuous strip-shaped composite material. For this purpose, a base material, which is produced using at least one casting machine as a continuous strand, in particular made of steel, and providing at least one cladding material, which is unwound in the form of at least one metal strip by a coil unwinding unit are provided. Subsequently, a slab which has formed by solidification from the strand produced by the casting machine and the metal strip unwound by the coil unwinding unit, in the hot state are brought together, wherein the materials, which are moved in the direction toward one another, formed from the slab and the unwound metal strip are hot rolled, so that a single continuous strip-shaped composite material is thus produced by roll cladding. The base material is continuously cast in the vertical direction in the casting direction.
US12186823B2
A first electrode coolant path is configured to cool a first welding electrode by liquid coolant flowing from a supply path through the first electrode coolant path to a return path. A second electrode coolant path is configured to cool a second welding electrode by liquid coolant flowing from the supply path through the second electrode coolant path to the return path. Three or more valves are configured to stop or reduce liquid coolant flow through the first or second electrode coolant path and configured to stop or reduce liquid coolant backflow from the return path when the first or second welding electrode is at least partially detached. At least one valve is coupled in the first or second electrode coolant path. A drawback apparatus generates a suction force to draw liquid coolant away from a gap formed when the first or second welding electrode is at least partially detached.
US12186821B2
An electric discharge machine is provided. The electric discharge machine includes: an axis drive part moving a tool electrode in at least one axial direction; and a sensor unit detecting a linear movement position of the axis drive part in the axial direction. The sensor unit includes a measurement scale having a linear shape, a position detector scanning the measurement scale and obtaining position information, and a pair of adjustment blocks fixed to both ends of the measurement scale or the position detector and erected perpendicular to an extension direction of the measurement scale. The adjustment blocks are fixed to the axis drive part and are curved in the axial direction due to a temperature change.
US12186804B2
A method of using a metal powder in an additive manufacturing process. The method includes providing the metal powder, and using the metal powder in the additive manufacturing process. The metal powder is a metal which is selected from tantalum and impurities, titanium and impurities, niobium and impurities, an alloy of tantalum, niobium and impurities, an alloy of titanium, niobium and impurities, and an alloy of tantalum, titanium, niobium and impurities. Particles of the metal powder have a dendritic microstructure. Particles of the metal powder have an average aspect ratio ΨA of from 0.7 to 1, where ΨA=XFeret min/XFeret max.
US12186801B2
A molding machine for molding material is provided. The machine includes a cavity to be filled with molten metal and a conduit system leading to the cavity, thus forming a system of interconnected hollow spaces. At least one pressure member is moveable in at least part of the conduit system. A centrifugal pump in fluid communication with a reservoir of molten metal is provided, the pump providing molten metal to the hollow space receiving the at least one pressure member.
US12186797B2
A method of manufacturing a component includes forming a mould assembly including an initial mould unit, providing a seed crystal including a primary growth direction, determining an optimal angular orientation of the unit, rotating the unit to dispose the unit's optimal angular orientation, encasing the unit in a refractory material, and forming a refractory mould unit having a component mould including a mould wall defining a mould cavity, and a seed holder. In the optimal angular orientation, the seed crystal's primary growth direction is angled away from the wall, thereby forming a converging disposition with the wall in a of the wall's first region facing the central sprue and a diverging disposition with the wall in the wall's second region facing a mould heater. The method includes receiving the seed crystal within the seed holder and filling the mould cavity with molten castable material to form the component.
US12186786B2
A method for treating waste printed circuit board includes carbonizing waste printed circuit board together with a calcium compound at 400° C. to 600° C. in a non-oxidizing atmosphere to fix a halogen contained in the board as calcium halide and to melt a solder of the board to allow mounted parts to be easily separated from the board, performing crushing after the carbonizing, and sieving crushed materials into fine particles of less than 0.5 mm containing the calcium compounds, medium particles containing the mounted parts, and coarse particles containing board pieces such that the crushed materials are sorted into the calcium compounds, the mounted parts, and the board pieces.
US12186773B2
A paint applicator apparatus for applying a paint line to a moving strand of a tire component comprising a paint neck and a paint head. The paint neck includes a receiving neck portion, a discharge neck portion, and a paint supply passage. The receiving neck portion extends along a receiving neck portion axis and the discharge neck portion neck portion extends along a discharge neck portion axis. The paint supply passage includes a paint inlet in the receiving neck portion and a paint outlet in the discharge neck portion. The receiving neck portion axis and the discharge neck portion axis define an obtuse angle. The discharge neck portion axis is oriented substantially parallel to the moving strand, and the receiving neck portion axis is oriented upwardly relative to the moving strand. The paint head is coupled to the discharge neck portion and includes a rotatable paint wheel for carrying paint from the paint outlet to the moving strand.
US12186762B2
A fluid spray nozzle includes a first member that is configured to be fixed to a sensor or a mounted portion to which the sensor is mounted, and a second member that is fixed to the first member. The first member has a fluid inlet and a first fluid passage that is connected to the fluid inlet. The second member has a second fluid passage that is connected to the first fluid passage, and a spray port from which the fluid that has passed through the second fluid passage is sprayed onto a predetermined location of the sensor.
US12186759B2
The various embodiments disclosed and pictured illustrate a hammer cluster for comminuting various materials. The embodiments pictured and described herein are primarily for use with a rotatable hammermill assembly. An illustrative embodiment of a hammer cluster may include at least two hammers each having a connection portion, a contact portion, and a neck connecting the contact and connection portions. The connection portions may include a connection aperture with a relief cavity having a tab on either side thereof. A collar having a collar gap defined by two collar edges may be inserted through connection apertures of each hammer. The collar edges may engage the respective tabs such that the hammers and the collar may rotate about a rod positioned within the collar as a singular unit.
US12186758B2
Provided is an automated analysis device with which sufficient reaction process data can be acquired irrespective of the scale of the device, and with which it is possible to ensure freedom of the device configuration. An automated analysis device 100 is provided with: a reaction disk 1 which circumferentially accommodates a plurality of reaction vessels 2; a specimen dispensing mechanism 11 which dispenses a specimen into the reaction vessels 2; a reagent dispensing mechanism 7 which dispenses a reagent into the reaction vessels 2; a measuring unit 4 which measures a reaction process of a mixture of the specimen and the reagent in the reaction vessels 2; and a cleaning mechanism 3 which cleans the reaction vessels 2 after measurement. Further, the automated analysis device 100 includes a controller 21 which controls the drive of the reaction disk 1 such that in one cycle the reaction vessels 2 move by an amount A in the circumferential direction in such a way that N and A are mutually prime, B and C are mutually prime, and the relationship A×B=N×C±1 holds, where N is the total number of reaction vessels 2 accommodated in the reaction disk 1, the reaction disk 1 moves through C (where C>1) rotations+an amount equivalent to one reaction vessel after B (where B>2) cycles, and the number of reaction vessels 2 moved in one cycle is A (where N>A>N/B+1).
US12186753B2
Described herein is a method for mixing unequal amounts of two reagents to produce a detectable reaction in a microfluidic chip. In one example, there is a fluorescent microfluidic urinary albumin chip (UAL-Chip) that exploits the nonimmunological fluorescent assay. In this chip, we constructed a passive and continuous mixing module, in which the loading process requires only an inexpensive dropper, and the signal is stable over time, as discussed below. We applied a pressure-balancing strategy based on the immiscible oil coverage which highly improves the precision in controlling the mixing ratio of sample and dye. The UAL-Chip has achieved an estimated limit of detection (LOD) of 8.4 μg/ml using albumin standards, which is below the 30 μg albumin per ml urine level considered to be indicative of kidney damage.
US12186746B2
A method for reducing sequencing by synthesis cycle time using a microfluidic device is provided. The microfluidic device comprises a flow cell having an inlet port, an outlet port, and a flow channel extending between the inlet port and the outlet port, wherein the flow channel receives an analyte of interest and one or more reagents for analyzing and detecting molecules. To aid in the acceleration of the reactions, the microfluidic device comprises a mixing device to increase the rates of diffusion of the reagents from the fluid bulk to an active surface of the flow cell. The mixing device comprises at least one of an electrothermal mixing device, an active mechanical mixing device, and a vibrational mixing device.
US12186742B2
The invention relates to a method for regulating the gas velocity of the empty bed in a fluidized bed, wherein solid catalysts are used as fluidized particles or as a part of fluidized particles, characterized in that the gas velocity of the empty bed μ of the reaction zone of the fluidized bed is measured, compared with the bed average catalyst density ρ of the solid catalysts in the reaction zone of the fluidized bed, the gas velocity of the empty bed μ being adjusted as required such that the gas velocity of the empty bed μ and the bed average catalyst density ρ satisfy the formula (I) below: ρ=0.356μ3−4.319μ2−35.57μ+M; wherein M=250−; where μ is provided in m/s and ρ is provided in kg/m3. The method can be used for the industrial production of lower olefin.
US12186736B2
A polymer/activated carbon composite made up of a branched polyethylenimine and magnetic cores involving Fe3O4 disposed activated carbon. The magnetic cores have activated carbonyl groups on the surface. A process for removing organic dyes, such as methyl red, as well as heavy metal ions from a polluted aqueous solution or an industrial wastewater utilizing the composite is introduced. A method of synthesizing the polymer/activated carbon composites is also specified.
US12186735B2
A polymer/activated carbon composite made up of a branched polyethylenimine and magnetic cores involving Fe3O4 disposed activated carbon. The magnetic cores have activated carbonyl groups on the surface. A process for removing organic dyes, such as methyl red, as well as heavy metal ions from a polluted aqueous solution or an industrial wastewater utilizing the composite is introduced. A method of synthesizing the polymer/activated carbon composites is also specified.
US12186728B2
Systems and methods for producing nitrates, nitric acid, salts thereof, or a mixture thereof are disclosed. The systems may include a feed conduit configured for receiving a feed stream comprising molecular oxygen and molecular nitrogen; an inlet conduit configured for receiving an inlet stream; a plasma reactor fluidically coupled to the inlet conduit, the plasma reactor fluidically coupled to a reactor-outlet conduit configured for receiving the reactor-outlet stream, the plasma reactor configured to produce oxidized nitrogen species; and an absorber fluidically coupled to the reactor-outlet conduit, the absorber configured to receive the reactor outlet stream and to produce nitrates, nitrites, nitric acid, salts thereof, or a mixture thereof from the reactor outlet stream. A recycle conduit may be fluidically coupled to the absorber and the inlet conduit, wherein the recycle conduit is configured to receive the gas-phase stream from the absorber and provide the gas-phase stream to the inlet conduit.
US12186724B2
A method for transporting a material (which may be a viscous fluid) in a conduit defined by a conduit-defining surface comprises: flowing a first fluid and a second fluid in a flow direction within the conduit; contacting the first and second fluids to one another at a contact region to thereby facilitate a reaction creating a reaction product in an interface region that extends downstream from the contact region, wherein the reaction product is an elastic-solid; and transporting the material in the flow direction within the conduit. At locations downstream of interface region, the reaction product creates a barrier between the viscous fluid and the conduit-defining surface.
US12186718B2
An insert assembly for a foam generating device includes a first insert and a second insert with a channel defined therethrough. Inserts may be formed by two shell halves that are coupleable to one another to define the channel. A plurality of ribs extends along an interior surface of the channel. The channel is configured to grip porous pad structures by the plurality of ribs for generating foam by breaking-up the cleaning solution and agitating. The ribs may be arranged horizontally relative to a longitudinal axis of the insert assembly. Inserts may be arranged in series along a longitudinal axis of the foam generating device.
US12186717B2
A mixer, a mixer assembly and a mixing method in which the mixer comprises a shell defining a first space, the first space receives engine exhaust, and the shell has a mounting area located on a wall of the shell; a doser mounting base arranged in the mounting area for mounting the doser, wherein the doser mounting base comprises a spray inlet as an inlet end for the spray that is sprayed by the doser entering the first space, and the doser mounting base further comprises a first swirl structure that surrounds the spray inlet to make the exhaust form a swirl around the spray inlet.
US12186712B2
An object of the present invention is to suppress a defect in a carbon membrane for fluid separation use with a dense carbon layer formed on a porous carbon support. The present invention is a carbon membrane for fluid separation use, including a dense carbon layer formed on a porous carbon support, wherein X
US12186708B2
A multi-stage sweeping gas membrane distillation (MS-SGMD) system and a method of use are provided. The MS-SGMD includes a plurality of modules, wherein each module includes a feed chamber fluidically coupled to a feed line and a carrier gas line, wherein the feed line introduces a liquid feed into the feed chamber from a liquid feed tank, and wherein the carrier gas line introduces a carrier gas into the feed chamber. Each module includes a sweeping gas chamber fluidically coupled to a sweeping gas line and a sweeping gas return line, wherein a sweeping gas is passed through the sweeping gas chamber. Each module further includes a membrane separating the feed chamber from the sweeping gas chamber, wherein the membrane allows transportation of vapor from the feed chamber to the sweeping gas chamber while blocking liquid from moving from the feed chamber to the sweeping gas chamber.
US12186698B2
According to the present disclosure, air cleaner assemblies, housings, serviceable filter cartridges and features, components, and methods, relating thereto are disclosed. In general, the features relate to systems that are configured to aid in inhibiting an improper cartridge from being installed in an air cleaner housing, during servicing. A variety of features are characterized, and in many examples, the cartridge includes a seal arrangement having radially directed seal surface with at least a first non-wavy or non-projection/recess section and a second wavy or projection/recess section. Examples are shown and described in detail.
US12186692B2
A filter element for filtering a fluid comprising a filter medium pack having an axial inlet side for receiving the unfiltered fluid and a circumferential side forming a radial boundary of the filter medium pack. The filter medium pack is configured for insertion into a housing of a filter system so as to enclose or partly enclose the circumferential side of the filter medium pack with an outer sidewall of the housing. The filter element comprises a bridge seal arrangement having a first collar-shaped portion comprising a first circumferential sealing surface sealingly coupled to the circumferential side of the filter medium pack or sealingly coupled to a border of the axial inlet side, and a second collar-shaped portion comprising a second circumferential sealing surface configured for encircling and sealingly cooperating with the outer sidewall of the housing.
US12186687B2
A distillation and desalination system can include a refrigeration unit, a distillation unit, and a vacuum source positioned in the refrigeration unit. The distillation unit may include a distillation chamber containing a saline liquid and a headspace above the saline liquid, the headspace comprising a gas. The vacuum source may include a first chamber defining a first chamber volume, where gas transport is permitted into and out of the first chamber and the first chamber is fluidically coupled to the headspace of the distillation unit, and a second chamber defining a second chamber volume, wherein the first chamber and the second chamber are fluidically isolated.
US12186680B2
A bubble machine comprising a core and a housing is provided. Part of the core is located in the housing. A bubble outlet of the core is exposed outside the housing, and the housing is flexible and inflatable. The core includes a core body, a bubble outlet head, and an air guiding pipe. The bubble outlet head is provided with a smearing device which is able to smear liquid onto the bubble outlet to form a layer of liquid film. The smearing device comprises a scraper and a rotating strip. A rotating end is arranged in the core body, a rotating shaft of the scraper is connected to the rotating end in the core body by the rotating strip, and the rotating strip is flexible.
US12186676B2
A movable puzzle platform includes a puzzle board having a top surface and a board accessible unit having a first moving member, a second moving member, and a first bearing unit coupled between the first moving member and the second moving member. A first circumferential surface of the first moving member is engaged with a second circumferential surface of the second moving member via the first bearing unit to enable the second moving member to be coaxially rotated with respect to the first moving member. The first moving member includes a first horizontal flat base and a first rolling surface arranged along the first horizontal flat base. Therefore, a player is able to move the puzzle board on the playing surface at a desired orientation to assemble the puzzle pieces on the top surface of the puzzle board.
US12186675B2
An aggregative dice shaker comprises: providing two or more dice cup devices and a control device. Each dice cup device includes a dice plate, a camera, and a shaking device. A plate surface of the dice plate is for placing the dice thereon. The camera faces toward the plate surface. The shaking device applies a reciprocating force to the dice plate. The control device receives an external control signal and activating the corresponding dice cup device, and outputs the game result as an output. Therefore players can play games using one dice cup device and games using multiple dice cup devices.
US12186672B2
Privacy of a conversation between a computer game player and an entity such as a person or virtual assistant is preserved by various techniques so that other players of the computer game who are not part of the conversation cannot apprehend the conversation. The conversation may be voice or txt but is not an online chat associated with the computer game.
US12186671B2
A competitive game in which a user and an opponent participate is executed, and a rating based on a match record of the competitive game is stored. When an update condition that, after last update, the user wins the competitive game a predetermined number of times that is two or more or the user loses the competitive game a predetermined number of times that is two or more, is satisfied, a temporary change amount of a rating parameter is calculated on the basis of a match record of each competitive game until the update condition is satisfied this time after the last update. If the temporary change amount is equal to or larger than a predetermined threshold, the temporary change amount is determined as a change amount of the rating parameter, and if the temporary change amount is less than the predetermined threshold, the threshold is determined as a change amount of the rating parameter, and the rating is updated.
US12186663B2
A method is provided for indicating build element availability for users. The method includes in response to a determination to display a build element availability status information, displaying, to the first user, the build element availability status information indicating a second set of build elements selected by a second user and which of the second set of build elements is currently available to be built in a virtual scene by the second user, wherein each of the second set of build elements represents the corresponding virtual object of a different type that is controllable by the second user in the virtual scene when a corresponding virtual object of the respective build element is built by the second user.
US12186662B2
A data processing method in a virtual scene, a device, a storage medium, and a program product are provided. The method includes receiving an operation instruction, the operation instruction being an instruction triggered by a route drawing operation on a second minimap that is displayed on a second terminal; generating path information of a target virtual object in a virtual scene based on the operation instruction; and transmitting the path information to a first terminal, the first terminal displaying a path trajectory corresponding to the path information on a first minimap that is displayed by the first terminal.
US12186652B2
A card shuffler and dealing module shuffles eight decks of cards (or less) and delivers Baccarat hands (or other games) to a dealer. Cards are randomly selected from two pre-shuffle bins and delivered to a connected or integral dealing module. The card shuffler initially selects and delivers four cards (the minimum number needed for a hand of Baccarat) to a dealing area of the dealing module. Two additional cards (the maximum number of additional cards needed for a hand of Baccarat) are then selected and delivered to the dealing module rear of the four initial cards. Accordingly, up to six cards are available to be dealt during the Baccarat hand. The smart card shuffler tracks the rank of the cards and discerns the future outcome of the Baccarat game and adjusts the cards made available to the dealer via an automatic dealing module cover and card transport mechanism.
US12186649B2
A skateboard truck includes a metal bolt called a kingpin and a threaded fastener, called a hex nut, which when combined hold the two main components of a truck together: the baseplate, which is mounted to the bottom surface of the skateboard deck; and the turning part of the truck called the hanger, which is mounted onto the baseplate by means of the kingpin, and affixed tightly into the baseplate by means of a threaded hex nut. Two bushings placed along the shaft of the kingpin and on either side of a flange protruding from the hanger hold the hanger in place by the tightening of the kingpin into the threaded shaft nut fastener. The kingpin is oriented such that a threaded portion of the kingpin (on an end opposite a bolt head portion) is generally facing towards a bottom surface of the skateboard deck.
US12186639B2
A substrate is mountable on a lacrosse stick head to form a pocket. The head has a throat attached to a shaft, a ball stop attached to the throat, a scoop distal to the throat, and sidewalls extending between the ball stop and the scoop. The substrate includes a top portion and a bottom portion. The top portion is positioned proximate to the scoop and the bottom portion is positioned between the top and the ball stop. The top and bottom portions include yarn knit to form the substrate. A method of making the substrate includes casting the yarn onto a needle, knitting the top and bottom portions, casting the yarn off the needle, tying off the yarn and attaching the substrate to the head.
US12186637B2
Embodiments of golf club heads comprising a club face with a variable thickness profile to adjust stiffness and characteristic time (CT) are described herein. The variable thickness profile comprises strategically positioned thickened and thinned regions. In many embodiments, variable thickness profile can taper from a thickened region to a thinned region. The thickened region can comprise a maximum thickness of the club face, and the thinned region can comprise a minimum thickness of the club face. The variable thickness profiles described in this disclosure increase stiffness in a high toe area of the club face and decrease stiffness in a heel area of the club face.
US12186635B2
Described herein are embodiments of an iron-type golf club head comprising a suspended weight bar within the interior cavity. The weight bar can be attached to and suspended in front of an internal mass pad. The weight bar overhangs at least a portion of the sole and is spaced away from the strike face. The weight bar thereby provides a low and forward center of gravity (CG) position without hindering the flexure of the strike face or the sole.
US12186632B2
A swim cap with improvements to the design of the exterior surfaces of the cap that result in a decrease in viscous drag while swimming. A swim cap that incorporates scale tiles arranged in an array format on the exterior surface of the swim cap. A swim cap with scale tiles arranged in an array configuration that follow a uniquely defined linear flow pattern. A swim cap with scale tiles arranged in an array configuration to a uniquely defined linear flow pattern that can be formed by molding. A swim cap with scale tiles arranged in an array configuration to a uniquely defined linear flow pattern that conforms to the geometry of the specific human head it is applied to without altering the head form shape.
US12186630B1
A rope edge protection system having a rope protection mat, an edge protection mat, and/or a replaceable abrasion pad in combination for the protection of rope. The rope protection mat is a generally rectangular sheet that may be secured in a sleeve-like configuration around a climbing rope and move along the rope with the user. The rope protection mat and/or replaceable abrasion pad are configured to be replaceable after it is sufficiently worn down from use. The replaceable abrasion pad is configured to be laid flush overtop the edge protection mat. The edge protection mat is a generally rectangular sheet that has one or more frictional sections positioned on a bottom side that add resistance to horizontal force vectors to the edge protection mat during use. The edge protection mat is a multi-layer sheet with a high loft layer to decrease the bend radius of the rope across a ledge.
US12186616B2
A physical training apparatus includes a housing, a flywheel mechanism accommodated in the housing, the flywheel mechanism including a spindle, at least one flywheel mounted on the spindle and bearings to support the spindle in the housing, and a windable pull element, such as a pull cord or band, which is arranged to be wound up the spindle and unwound from the spindle. The spindle includes a spindle end portion. The flywheel is exchangeably mounted on the spindle end portion against a stop located on the spindle. A fastening knob is releasably coupled to the spindle end portion and adapted to engage the flywheel and force it against the stop located on the spindle. The housing includes at least on one lateral side a covering lid.
US12186603B2
A waterproof driving shaft includes an inner tubular member defining an accommodation space and extending along an axis, an electrical driving unit disposed in the accommodation space to actuate a movement of a moving shaft member along the axis relative to the inner tubular member. A shield unit is securely connected with the moving shaft member and seals the accommodation space to prevent moisture and humidity from entering the inner tubular member so as to prolong the service life of the driving unit.
US12186602B1
Apparatus contemplating a damper apparatus for controlling airflow through a ductwork in an air handling system. The damper has a stationary plenum having a collar defining a through opening. A damper blade assembly has a rigid damper blade defining a substantially flat area sized larger than a cross-sectional area of the through opening. The damper blade is selectively positionable between an open position in which the flat area is retained parallel to the collar and thereby clearingly disengages the plenum to open the through opening an thereby permit the airflow to pass through the plenum, and a closed position in which the flat area is perpendicular to the collar and engages against the collar to close the through opening and thereby prevent the airflow from passing through the plenum.
US12186591B2
The present disclosure may provide a radiation system. The radiation system may include a treatment head, a detector, a plurality of imaging sources, and a gantry. The treatment head, the detector, and the plurality of imaging sources may be mounted on the gantry. The treatment head may be configured to deliver a treatment beam toward an object. The plurality of imaging sources may be configured to deliver a plurality of imaging beams toward the object. At least two of the plurality of imaging sources may share the detector. The detector may be configured to detect at least two of the plurality of imaging beams. The detected at least two imaging beams may be emitted by different imaging sources of the at least two imaging sources.
US12186590B2
The invention provides methods of treating metastatic or unresectable pancreatic cancer through the administration of a combination of an immune modulator and radiation therapy.
US12186589B2
A mount for an array of leaf drive units corresponding to a single leaf bank of a multi-leaf collimator comprises a plurality of separable mounting plates. Each mounting plate comprises an array of mounting holes, and each mounting hole is arranged to receive a respective one of the leaf drive units.
US12186580B2
A patch-type skincare device is provided. A patch-type skincare device according to an exemplary embodiment of the present invention comprises: a light source part comprising a flexible plate-shaped substrate member having a circuit pattern formed on at least one surface thereof, and at least one LED mounted on one surface of the substrate member; a pair of cover members disposed on both surfaces of the substrate member so as to prevent the light source part from being exposed to the outside; and a connection cable for supplying the light source part with power that is externally supplied.
US12186573B2
Embodiments of a wearable device are provided. The wearable device comprises a reusable component and a disposable component. The disposable component comprises a patient engagement substrate comprising adhesive on a bottom side, an electrode on the bottom side, a disposable component electrical connector, and a disposable component mechanical connector. The reusable component comprises a plurality of sealed housings mechanically coupled to each other and movable with respect to each other, each of the plurality of housings containing one or more of a capacitor and a controller, a reusable component mechanical connector adapted to removably connect to the disposable component mechanical connector, and a reusable component electrical connector adapted to removably connect to the disposable component electrical connector. The device can comprise a cardiopulmonary physiologic monitor or an automatic external defibrillator, among other types of devices.
US12186562B2
An example of a system may include an electrode arrangement and a neuromodulation device configured to use electrodes in the electrode arrangement to generate a neuromodulation field. The neuromodulation device may include a neuromodulation generator, a neuromodulation control circuit and a storage. The storage may include a stochastically-modulated neuromodulation parameter set and the stochastically-modulated neuromodulation parameter set may include at least one stochastically-modulated parameter. The controller may be configured to control the neuromodulation generator using the stochastically-modulation parameter set to generate the neuromodulation field.
US12186559B2
Arrangements are described for monitoring cochlear implantation surgery. During surgical insertion of a cochlear implant electrode array into a patient cochlea, at least one measurement difference value is determined for at least one electrode contact currently located at a given insertion depth into the patient cochlea based on comparing current stimulus response data for the at least one electrode contact to prior stimulus response data for at least one prior electrode contact previously located at the given insertion depth. A potential trauma response is identified when the at least one measurement difference value exceeds a defined difference value.
US12186549B2
A subcutaneously implantable device includes a housing, a clip attached to a top side of the housing, a first prong with a proximal end attached to the housing and a distal end extending away from the housing, and a first electrode on the first prong. The clip is configured to anchor the device to a muscle, a bone, and/or a tissue. The first prong is configured to contact a heart. The first electrode is configured to contact the heart. Sensing circuitry in the housing that is configured to sense an electrical signal from the heart, and therapeutic circuitry in the housing is in electrical communication with the first electrode and is configured to deliver electrical stimulation to the heart through the first electrode.
US12186545B2
Apparatus and methods are described including a blood pump that includes an impeller configured to pump blood through a subject's body, and a frame disposed around the impeller. In a radially-non-constrained configuration of the frame, the frame defines a proximal conical portion and a cylindrical portion disposed distally to the proximal conical portion. During operation of the blood pump, the impeller moves with respect to the frame, and a range of movement of the impeller is such that at least a first portion of the impeller is disposed within the proximal conical portion of the frame during at least some of the operation of the blood pump, and at least a second portion of the impeller is disposed within the cylindrical portion of the frame during at least some of the operation of the blood pump. Other applications are also described.
US12186543B2
A cannula cartridge for receiving a cannula includes a needle assembly, a cannula and a protector. The needle assembly is movable within the protector between first and second positions. In the first position the needle is covered by the protector and a retainer of the protector engages an engagement element of the needle hub by a form fit connection. In the second position the needle at least partially extends from the protector. An inserter can move the needle assembly between the first position and to the second position and then back to the first position. The retainer and the engagement element are configured such that a holding force of the retainer is overcome by applying forces parallel to the axis of the needle. An inventive kit that includes an inserter and a driver for moving the needle assembly and a method of manufacturing the cannula cartridge are also disclosed.
US12186537B2
A cartridge assembly for a drug delivery device is described. The cartridge assembly includes (i) a cartridge containing a drug, the cartridge including a dispensing end; (ii) a cartridge holder, the cartridge holder defining an interior cartridge holding section, in which the cartridge is arranged within the cartridge holding section; and (iii) a fixing member. The fixing member includes a fixing surface arranged to abut a cartridge surface of the cartridge, in particular a radially oriented surface. The cartridge surface is a proximal surface which faces away from the dispensing end of the cartridge, and the cartridge surface is arranged between the dispensing end of the cartridge and the end opposite of the dispensing end. The fixing member includes a securing surface which is arranged to abut a holder surface of the cartridge holder. Further, a drug delivery device and a method for assembling the cartridge assembly are described.
US12186535B2
An auto-injector for injecting a fluid medicament into a patient from a pre-filled syringe requires a disposable cassette that is selectively engageable with the reusable injector. The syringe is latched onto the cassette, and the cassette is then engaged with the injector. Activation of the injector causes a first motor to move the syringe so its needle is extended from a concealed position inside the cassette for injection of the medicament. A second motor on the injector is then activated to expel fluid medicament from the syringe. Then, the first motor is again activated to withdraw the syringe into the cassette for disposal of the cassette/syringe after an injection.
US12186534B2
A co-reactive liquids delivery applicator, including first and second hollow cylindrical cartridges, each including a stopper at a proximal end and a sealing septum on a distal end and the cartridges containing co-reactive liquids therein, an applicator body including two adjacent chambers configured to secure the first and second cylindrical cartridges, a manifold positioned at a distal portion of the applicator body, the manifold including a pair of hollow needles extending from a proximal portion and a tip connection positioned at a distal portion thereof, and a toggle configured to advance the manifold towards the distal end of the cartridge, wherein upon advancing the manifold each hollow needle penetrates the sealing septum and establishes fluid communication with one of the liquids of the first and second cylindrical cartridges.
US12186526B2
A drug solution administration unit including a drug solution administration module having a first flow path unit, a second flow path unit, and a drive mechanism unit, and a drug solution administration device having a branch path and a main path. The first flow path unit includes an upstream side main body where a first flow path to store drive solution is formed, and the second flow path unit includes a downstream side main body where a second flow path to store drug solution is formed. The drive mechanism unit includes a pair of electrodes and a porous body sandwiched between the pair of electrodes, the drive mechanism unit has a connecting flow path connecting a downstream end of the first flow path and an upstream end of the second flow path.
US12186524B2
A chemical liquid injector that can easily set various injection conditions according to a region and an objective to be imaged. The chemical liquid injector includes two piston driving mechanisms for operating syringes filled with a first chemical liquid and a second chemical liquid, respectively, an input unit for receiving an input of a data, and an injection control unit for controlling an operation of the piston driving mechanisms. The injection control unit is set with a multistage injection mode in which injection operations are performed in a plurality of injection phases. In the multistage injection mode, the injection control unit is configured to receive the input of the mixing rate of the first chemical liquid and the second chemical liquid for each of the plurality of injection phases, set injection conditions of the first chemical liquid and the second chemical liquid so that the first chemical liquid and the second chemical liquid are injected at the received mixing rate, and control the operation of the driving mechanisms according to the set injection condition.
US12186518B2
Fluid connector systems including first and second connector portions couplable together to form a fluid pathway therethrough and can resist separation or permit separation as desired. A connector portion can include a connector housing and a cover portion. The connector housing includes a connector body and an engagement portion. The connector body defines a tubing opening and a mating opening. The connector body defines a flow path between the tubing opening and the mating opening. The engagement portion at least partially surrounds the connector body. The engagement portion defines an engagement lip extending radially toward the connector body and is configured to releasably engage the connector housing. The flow path includes at least one portion that is normal to the engagement portion. Fluid flow through the flow path exerts a normal force on the connector housing and prevent release of the connector housing with the mating connector portion.
US12186517B2
An introducer sheath assembly for percutaneously delivering a medical device that maintains hemostasis in a patient. The assembly has a hub, a hub cap and a hemostasis valve. The introducer sheath assembly has a longitudinal axis and a lumen formed therein. The hemostasis valve has a frame portion and a valve portion, the valve portion having a plurality of slits that are offset through the thickness of the valve portion therein and an extension of the frame portion formed from an incompressible material. The extension of the frame portion is received by a valve seat feature in the hub, when the valve is received by the hub. The valve seat feature also receives a seating portion of the hub cap as the hub and hub cap are advanced into engagement, the seating portion of the hub cap advanced into the valve seat feature subjecting the incompressible extension of the frame portion to a compressive force.
US12186494B2
Guidewire-management devices and systems thereof are disclosed herein. A guidewire-management device can include a guidewire, a first sleeve, and a second sleeve. The first sleeve can be configured for distally feeding the guidewire out of the guidewire-management device. The first sleeve can also be configured for proximally feeding the guidewire into the guidewire-management device. The second sleeve can be proximal of the first sleeve in the guidewire-management device. The second sleeve can be configured for feeding the guidewire in concert with the first sleeve. At least a length of the guidewire extending between the first sleeve and the second sleeve can be disposed within a sterile barrier configured to maintain sterility of the guidewire.
US12186493B2
A method of manufacturing an elongate shaft for delivery of a medical device may include disposing a polymeric sheath having a lumen extending therethrough over a mandrel; sliding a proximal portion of the polymeric sheath into a lumen of a metallic tubular member; placing a polymeric tubular member over the distal portion of the polymeric sheath and a distal portion of the metallic tubular member; fixedly attaching a proximal coupler to a distal end of a longitudinal support filament; inserting a proximal end of the longitudinal support filament between the polymeric sheath and the polymeric tubular member to position the longitudinal support filament alongside the distal portion of the metallic tubular member and a distal portion of the polymeric sheath; and reflowing the polymeric tubular member to secure the longitudinal support filament relative to the polymeric sheath and the metallic tubular member.
US12186484B2
A patient interface may include a plenum chamber pressurisable to a therapeutic pressure, a seal-forming structure constructed and arranged to form a seal with a region of the patient's face surrounding an entrance to the patient's airways, a positioning and stabilising structure to provide a force to hold the seal-forming structure in a therapeutically effective position on the patient's head, and a vent structure to allow a continuous flow of gases exhaled by the patient from an interior of the plenum chamber to ambient, wherein the patient interface is configured to leave the patient's mouth uncovered during therapy, wherein the seal-forming structure comprises two lateral support regions, each located at a lateralmost side of the seal-forming structure, and a medial region positioned between the lateral support regions, the hole passing through the medial region, and wherein the lateral support regions are thicker than the medial region.
US12186481B2
A hypoxic training system is provided that dynamically adjusts the oxygen ratio in the gas provided to the user during a hypoxic training session based on the blood oxygen saturation (SPO2) level of the user. During a first training period, the hypoxic training system provides gas according to a first oxygen ratio. When it is determined that the SPO2 level of the user has reached a target SPO2 level, the hypoxic training system may provide a recovery period, during which gas according to a second oxygen ratio is provided to the user. When it is determined that the SPO2 level of the user has fallen more than a predetermined threshold below the target SPO2 level during the recovery period, the hypoxic training system may provide gas according to an increased first oxygen ratio during a subsequent training period.
US12186480B2
The invention relates to a device comprising a body (10), a reservoir (100) mounted in an axially slidable manner relative to said body (10), a metering valve (200) assembled on said reservoir (100), said device comprising: —a blocking element (500), —a triggering element (600), —a triggering system controlled by inhalation (60) cooperating with said triggering element (600), and —an actuating member (800) cooperating with said blocking element (500), said device comprising an automatic valve release system which automatically returns said valve (210) of said valve (200) to its rest position after actuation of the valve regardless of the position of said actuating member (800).
US12186479B2
Disclosed herein is a device configured to impart flavoring to an airstream admitted the device prior to the airstream reaching an aerosol generator of the device, the device thereby operable to deliver a flavored aerosol from an outlet.
US12186478B2
The invention relates to the field of inhalation devices for liquids. In particular, the invention relates to a fixture for a nebulizing nozzle to be used in such an inhalation device. A nozzle fixing assembly (1) for an inhalation device, comprising an elastically deformable seal element (2), having a continuous opening (3) capable of receiving a nozzle body (4), said seal element (2) and said nozzle body (4) each having a high pressure side (2A, 4A) and an outlet side (2B, 4B); and a pressure element (5) with a high pressure side (5A), said side being arranged to face the high pressure side (2A) of the seal element (2); wherein (i) the high pressure side (2A) of the seal element (2) is substantially flat, and (ii) the high pressure side (5A) of the pressure element (5) is chamfered in a way that, in the assembled state, the distance between these high pressure sides (2A, 5A) is higher in a central region (C) than in a peripheral region (P).
US12186472B2
The invention relates to a blood treatment device configured to dephosphorylate extracellular adenosine triphosphate (ATP), adenosine diphosphate (ADP), adenosine monophosphate (AMP) and/or lipopolysaccharide (LPS) in the blood of a patient in need thereof in an extracorporeal blood circuit, wherein the device comprises a matrix having alkaline phosphatase (AP) immobilized thereon. The invention further relates to an extracorporeal blood circuit comprising a blood treatment device of the invention and to the blood treatment device for use as a medicament or to methods of treating an infection, preferably a blood or systemic infection, such as sepsis, and/or for the treatment of sepsis-associated acute kidney injury (AKI).
US12186470B1
A device for positioning and inserting a medical needle assembly into a patient. The device includes a base configured to be placed adjacent to a needle insertion site on the patient which includes a plurality of positioning features configured to be used for positioning and aligning the device on the patient. The device includes a needle channel and a needle guidance protrusion disposed on the top of the base. The needle guidance protrusion includes a sloped surface having a first end disposed adjacent to the needle channel and a second end displaced from the first end and is sloped such that the second end is disposed higher than the first end. A needle assembly is configured to be pushed down the sloped surface such that the needle of the needle assembly travels through the needle channel to the needle insertion site.
US12186459B2
An air treatment system includes a lower cowling configured to be suspended from a ceiling, the lower cowling defining an interior lower cowling surface and configured to be disposable radially outward from and around a fan configured to induce airflow. Further, the air treatment system includes an upper cowling configured to be disposed vertically above the lower cowling and define an interior upper cowling surface. A gap between the interior upper cowling surface and the interior lower cowling surface forms a fluid passageway comprising an intake opening, an exhaust opening, and a chamber. The fluid passageway is contoured to receive airflow from the fan via the intake opening and direct the airflow through the chamber to exit the exhaust opening. Moreover, the air treatment system includes at least one air treatment device secured within the chamber, the air treatment device configured to treat air passing through the chamber.
US12186456B2
To provide an artificial bone having a porous structure with an improved affinity to osteogenic cells, an artificial bone (1) includes: a base material (2) containing porous ceramics provided with mutually interconnected multiple pores (6); a carbonaceous thin film (10) formed on an outer surface of the base material and wall surfaces (7) of the pores; and functional groups (13) including amino groups (12) provided on a surface and in an interior of the carbonaceous thin film.
US12186454B2
A scaffold comprising electrospun decellularized ECM of an organ, wherein the decellularized ECM has a similar protein composition to native ECM of the organ. Methods of generating same are also disclosed as well as uses of same.
US12186452B2
The present invention relates in part to compositions and methods for treating a wound, or location of interest, in mammal by administering a decellularized extracellular matrix (ECM) lacking thrombospondin-2 (TSP-2-null ECM). In certain embodiments, the invention provides an acellular composition comprising a decellularized TSP-2-null ECM. In certain embodiments, the invention provides a tunable hydrogel comprising a decellularized TSP-2-null ECM. The invention also provides, in certain embodiments, methods for accelerating cellular migration, methods for enhancing cellular invasion, methods for enhancing vascular growth and maturation of a region to be treated, and/or methods for enhancing a wound repair in a mammal in need thereof.
US12186431B2
The present invention relates to a pharmaceutical dosage form for application to a mucous membrane, in particular to a buccal, intestinal, rectal or vaginal mucous membrane, comprising at least one sheet like, in particular film shaped, foil shaped or wafer shaped preparation comprising the active pharmaceutical ingredient, a release mechanism, and a trigger mechanism, wherein the trigger mechanism is adapted to trigger, at a predetermined site of action, in particular of the gastrointestinal tract, of the rectum or of the vagina, the release of the sheet like preparation by the release mechanism.
US12186414B2
Provided herein are compositions and kits including trichloroacetic acid, and methods of using the same for debridement during endodontic treatment.
US12186412B2
An apparatus includes a support, including an outer surface and configured for insertion into a body of a subject. The apparatus further includes multiple atoms of a radionuclide, which radioactively decays to produce a daughter radionuclide, coupled to the outer surface, and a layer of a polymer, which covers the atoms so as to protect the atoms from being washed away, yet allows diffusion of the daughter radionuclide through the layer. Other embodiments are also described.
US12186411B2
The present disclosure provides for methods and compositions useful for imaging inflammation and inflammatory disease markers with an affinity for TREM-1 antibodies. The methods and compositions can include a labeled probe having a TREM-1 antibody and a radiolabel.
US12186409B2
The present disclosure provides methods of screening for a sortilin binding antagonist. In some embodiments, the methods include incubating an agent with a sortilin protein and a sortilin ligand, where the sortilin protein and sortilin ligand are each attached to a member of a fluorescence donor/acceptor pair, exciting the fluorescence donor of the fluorescence donor/acceptor pair, and detecting fluorescence emitted by the fluorescence donor at a second wavelength and fluorescence emitted by the fluorescence acceptor at a third wavelength. A decrease in the ratio of the fluorescence emitted by the fluorescence acceptor at the third wavelength to the fluorescence emitted by the fluorescence donor at the second wavelength, as compared to the ratio in the absence of the agent, indicates that the agent is a sortilin binding antagonist.
US12186407B2
Provided herein are compositions and methods for generating an immunogenic response in humans. Further provided are methods for designing such compositions, e.g., for vaccines.
US12186402B2
Provided herein are polymer materials that find use in, for example, delivery of short-chain fatty acids. In particular, polymers are provided that form stable nanoscale structures and release their payload, for example, by cleavage of a covalent bond (e.g., via hydrolysis or enzymatic cleavage). The polymers are useful, for example, for delivery of payloads (e.g., SCFAs) to the intestine for applications in health and treatment of disease, and have broad applicability in diseases linked to changes in the human microbiota including inflammatory, autoimmune, allergic, metabolic, and central nervous system diseases, among others.
US12186394B2
The present disclosure encompasses compositions and methods for the treatment of precancerous skin lesions. Compositions of the invention comprise a cytotoxic agent and a thymic stromal lymphopoietin (TSLP) inducer.
US12186392B2
The present invention is directed to the combination therapy of an anti-CD20 antibody with a BTK inhibitor for the treatment of cancer, especially to the combination therapy of CD20 expressing cancers with a type I anti-CD20 antibody or an afucosylated humanized B-Ly1 antibody and a BTK inhibitor.
US12186391B2
The present invention provides for a new therapeutic tools capable of treating infectious diseases, in particular, a new pharmaceutical composition comprising an IgM-enriched immunoglobulin preparation for use in the adjunctive treatment of severe Community Acquired Pneumonia (sCAP).
US12186389B2
The present invention is directed to nucleic acids suitable for use in treatment or prophylaxis of an infection with a coronavirus, such as a Coronavirus SARS-CoV-2 variant, or a disorder related to such an infection, such as COVID-19. The present invention is also directed to compositions, and vaccines. The compositions and vaccines comprise at least one of said nucleic acid sequences, and nucleic acid sequences in association with a lipid nanoparticle (LNP). The invention is also directed to first and second medical uses of the nucleic acids, the composition, the vaccine, and the kit, and to methods of treating or preventing a coronavirus infection, such as a Coronavirus infection from a SARS-CoV-2 variant.
US12186380B2
The present invention relates to a vaccine V comprising (A) at least one isolated polypeptide strand P comprising or consisting of at least nine consecutive amino acid moieties of the repetitive organellar protein, putative of Plasmodium falciparum or the hypothetical protein PVNG_04523 of Plasmodium vivax or a polynucleotide strand encoding for such polypeptide; and (B) at least one pharmaceutically acceptable carrier or excipient. Furthermore, the present invention refers to an antibody binding to the repetitive organellar protein, putative of Plasmodium falciparumor the hypothetical protein PVNG_04523 of Plasmodium vivax or a polynucleotide strand encoding therefor, to a method of generating such antibody and uses thereof.
US12186364B2
The disclosure relates to therapeutic proteins and pharmaceutical compositions comprising said proteins, which have utility in treating various human diseases. In particular aspects, the disclosed therapeutic proteins are useful for treating human gastrointestinal inflammatory diseases and gastrointestinal conditions associated with decreased epithelial cell barrier function or integrity. Further, the disclosed therapeutic proteins are useful for treating human inflammatory bowel disease, including inter alia, Crohn's disease and ulcerative colitis.
US12186363B2
Embodiments herein report compositions, uses and manufacturing of dengue virus constructs and live attenuated dengue viruses. Some embodiments concern a composition that includes, but is not limited to, a tetravalent dengue virus composition. In certain embodiments, compositions can include constructs of one or more serotypes of dengue virus, such as dengue-1 (DEN-1) virus, dengue-2 (DEN-2) virus, dengue-3 (DEN-3) or dengue-4 (DEN-4) virus constructs. In other embodiments, constructs disclosed herein can be combined in a composition to generate a vaccine against more one or more dengue virus constructs that may or may not be subsequently passaged in mammalian cells.
US12186362B2
Provided herein are peptide formulations comprising polymers as stabilizing agents. The peptide formulations can be more stable for prolonged periods of time at temperatures higher than room temperature when formulated with the polymers. The polymers used in the present invention can decrease the degradation of the constituent peptides of the peptide formulations.
US12186360B2
Provided herein are stable lisinopril oral liquid formulations. Also provided herein are methods of using lisinopril oral liquid formulations for the treatment of certain diseases including hypertension, heart failure and acute myocardial infarction.
US12186359B2
The present invention relates to compositions comprising branched-chain amino acids (BCAA) and the dipeptide L-Alanyl-L-alanine and their use for improving the performance and recovery during physical activity and for the prevention and/or treatment of muscle wasting associated to pathological or age-related conditions.
US12186358B2
Various embodiments provide a method of increasing immunity to a virus in a subject. The method can comprise: administering to the subject one or more effective doses of an immune-enhancing natural-based composition; thereby stimulating increased expression one or more of IFN-γ, IL-1B, IL-6, IL-10, IL-12p40, IL-12p70, and TNF-α; inhibiting replication of the virus inside a cell of the subject, and preventing entry of virus into the cell. The method of increasing immunity can further comprise increasing immunity to an upper respiratory tract viral infection. The upper respiratory tract viral infection can be COVID-19. According to some aspects of the method of increasing immunity, the effective dose of the immune-enhancing natural-based composition comprises: 30-70 mgs of cyanidin-3-glucosides; 40-80 mgs of andrographolides; 75-125 mgs of ascorbic acid; 400-600 mgs of beta glucans; 300-500 mgs of polysaccharides; and 75-125 mgs of a blend of antioxidants.
US12186357B2
A method of treating skin is disclosed. The method includes topically applying to the skin a composition comprising 0.0001 wt. % to 5 wt. % of a kakadu plum fruit extract, and 0.0001 wt. % to 5 wt. % of an acai berry fruit extract.
US12186349B2
The present disclosure provides compositions and methods for treating Clostridium difficile infection (CDI) including primary and recurrent CDI. In particular, the compositions and methods described herein are capable of achieving a CDI clearance rate of at least 80% through a single oral dose of a pharmaceutical composition comprising a freeze-dried fecal microbiota preparation.
US12186346B2
Disclosed is a topical anhydrous, homogenous pharmaceutical composition for treating skin disorder and wounds comprising cod liver oil, hempseed oil, monolaurin, medium chain triglycerides (“MCT”), free fatty acids, sea salt, and vegetable oil selected from the group consisting of red palm concentrate, coconut oil, and red palm oil and combination thereof and optionally fish collagen, ascorbyl palmitate, thickening agent, such as beeswax, red palm concentrate and cetyl ester.
US12186343B2
Provided in the present invention are a composition of immune effector cells and a treatment kit including the composition of immune effector cells, wherein the composition of immune effector cells comprises an initial dose of immune effector cells and a subsequent dose of immune effector cells.
US12186339B2
A system and method of use for an operational halotherapy device and red light device in an enclosed space. The halotherapy and red light system generally comprise a machine disposed in the enclosed space that disperses salt particles into the air, and includes a red light device that emits red light waves. The combination of both devices produces a refractory phenomenon when the red light waves make contact with the salt particles dispersed in the air to cause a plethora of multi-dimensional dispersions of light waves. Moreover, every time a salt particle makes contact with a red light wave, a portion of the wave light is absorbed by the particle and its temperature increases, lessening the moisture in the particle. The lessening of moisture in the particle dries the particle further, which enhances the therapeutic properties of the inhalable salt particle.
US12186334B2
High-molecular-weight fucan compositions comprising a therapeutically effective, medically acceptable fucan in a composition comprising wherein the fucan, for example, has a molecular weight distribution in which more than 60% w/w of the composition has a molecular weight above 100 kDa.
US12186332B2
The present disclosure provides, inter alia, methods for treating cancers including leukemia using low doses of an anthracycline such as doxorubicin.
US12186331B2
This invention relates to compositions for use in the promotion of the development and/or of the growth of the surface area of the small intestine and in the associated improvement of the digestive capacity in an infant or in a young child.
US12186330B2
This invention relates to methods and compositions for use improving cell viability, particularly neural cell viability, and more particularly to methods and compositions for use improving cell viability by reducing reactive oxygen metabolite-mediated oxidative damage in a cell, regulating redox homeostasis in a cell, or reducing mitochondrial dysfunction in a cell. The invention further relates to the administration of the bile acid tauroursodeoxycholic acid (TUDCA) in combination with phenylbutyric Acid (PBA) to improve cell viability, and treat at least one symptom associated with, prevent the time of onset of, or slow the development of a disease related to oxidative stress.
US12186329B2
Provided are methods of treating diabetes and/or obesity in a subject in need thereof, and methods of increasing the amount of cholic acid-7-sulfate (CA7S) in a subject. Further provided herein are methods of administering CA7S to a subject. Also provided are compositions and kits comprising cholic acid-7-sulfate, or a salt thereof for use in the treatment of diabetes and/or obesity.
US12186328B2
The present disclosure describes compositions and methods for regenerating tissue and/or preventing tissue loss by stimulating stem cells. A method includes providing a treatment composition including one or more CSA compounds and a carrier, applying the treatment composition to a targeted tissue region of a subject, and the treatment composition stimulating tissue regeneration and/or preventing tissue degradation at the targeted region of the subject.
US12186326B2
The invention relates to a sprayable liquid composition for transdermal delivery of testosterone and/or estradiol, and to methods of treatment using this composition.
US12186323B2
A combination drug contains hypoxanthine and human immunoglobulin (HIg). HIg has a therapeutic effect on radiation injuries, and the combination of hypoxanthine and HIg can further enhance this therapeutic effect. The combination drug can be administered to patients undergoing radiotherapy and to those who accidentally have excessive irradiation.
US12186320B2
Provided is an anti-tumor agent for the treatment of a HER2-positive tumor that is tolerant to other anti-tumor agents or an intractable HER2-positive tumor. More specifically provided is a therapeutic agent for a HER2-positive tumor that is tolerant to other anti-tumor agents or an intractable HER2-positive tumor, which contains a pyrazolo[3,4-d]pyrimidine compound or a salt thereof as an active ingredient.
US12186319B2
The invention provides novel compounds, pharmaceutical compositions and methods of preparation and therapeutic use thereof. The invention also provides novel gel compositions comprising hyaluronic acid (HA) polymers that are crosslinked with appropriate reversible crosslinkers and encapsulation of therapeutics or other payloads in such gel composition and nanoparticles thereof. The invention also relates to targeted delivery of such gel compositions and nanoparticles to specific cell types in a controllable delivery and release. The invention additionally relates to methods of therapeutic use of such gel compositions and nanoparticles in treatment of various diseases and conditions. The invention further relates to methods of preparation of the gel compositions and nanoparticles disclosed herein.
US12186316B2
Provided are pharmaceutical compositions which include a mixture of a lipophilic active pharmaceutical ingredient such as nilotinib, a hydrophilic polymer, one or more surfactants, and optionally an adsorbent. Also described are methods for preparing and using such pharmaceutical compositions. In one aspect, disclosed herein is an amorphous solid dispersion comprising the active pharmaceutical ingredient.
US12186307B2
In various aspects and embodiments the invention provides a method of treating epilepsy in a subject in need thereof, the method comprising providing to the subject an effective amount of an FLNA modulator. In various embodiments, the FLNA modulator is PTI-125 or kartogenin. In various embodiments, the epilepsy is epilepsy associated with focal cortical dysplasia (FCD) type II or tuberous sclerosis complex (TSC).
US12186305B2
The present disclosure relates to improved methods of treatment with nirogacestat.
US12186301B2
The disclosed subject matter provides N-substituted hydroxylamine derivative compounds, pharmaceutical compositions and kits comprising such compounds, and methods of using such compounds or pharmaceutical compositions. In particular, the disclosed subject matter provides methods of using such compounds or pharmaceutical compositions for treating heart failure.
US12186291B2
Nootropic compositions and methods of providing or using the same are provided herewith. Some preferred compositions include a combination of free amino acids and one or more peptides. Compositions may optionally include one or more of an anti-adherent, a B vitamin, shilajit, a sugar, a fatty acid, ashwagandha, ginseng, or rodiola, among other things.
US12186290B2
Methods for the treatment of cancer, including glioblastoma multiforme (GBM) and recurrent glioblastoma multiforme (RGBM). The method includes administering to a patient a plurality of extraneous antineoplastons and a plurality of targeted agents. The plurality of extraneous antineoplastons may include two or more antineoplastons selected from phenylacetylglutaminate sodium (PG), phenylacetylisoglutaminate sodium (iso-PG), and phenylacetate (PN). The plurality of targeted agents may include two or more agents selected from bevacizumab, pazopanib, sorafenib, dasatinib, and everolimus.
US12186289B2
The present invention pertains to the field of maximizing performance of animals, particularly of pregnant animals and their offspring, particularly of pregnant sows and their offspring. Particularly the present invention is in the field of increasing the colostrum production of a sow, increasing average daily gain of the offspring, and/or improving neonatal survival of the offspring.
US12186280B2
The present disclosure relates to the transdermal administration of cannabidiol (CBD) for the reduction of seizure frequency in the treatment of “treatment-resistant epilepsy” (TRE).
US12186277B2
The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules.
US12186275B2
The present invention generally embraces the treatment of diseases by targeting cells expressing an antigen on the cell surface. In particular the invention relates to a method for stimulating, priming and/or expanding in vivo T cells genetically modified to express a chimeric antigen receptor (CAR) targeted to an antigen, comprising contacting the T cells with the antigen or a variant thereof in vivo. In one embodiment, the antigen or variant thereof is provided by administering a nucleic acid encoding the antigen or variant thereof.
US12186268B2
An envelope is configured to hold, support, and protect an article such as a blood bag during transportation under cryogenic temperatures. The envelope includes a single piece component (e.g., a monolithic component), including multiple panels that are configured to fold to form an enclosure that surrounds the article such as the blood bag for support and protection of the article such as the blood bag.
US12186261B2
The present invention discloses an ion pulse treatment apparatus for eye, which includes a carrier for carrying conductor elements to the eye acupoint regions; a power supply provided on the carrier and electrically connected to a control board; a high voltage generating element on the carrier and electrically connected to the control board; and two conductor elements carried by the carrier and used for treatment, wherein the two conductor elements are provided to contact with the surface skin of the eye acupoint regions, wherein one conductor element of the two conductor elements is electrically connected to a ground terminal of the high voltage generating element, and the other conductor element is electrically connected to a high voltage terminal of the high voltage generating element, wherein the negative ions (electrons) generated by the ion pulse treatment apparatus for eye of the present invention have the function of promoting microcirculation in the eye regions after entering the eye acupoint regions, so as to accelerate cell metabolism, effectively relieve eye fatigue, and promote eye health.
US12186258B2
An improved orthopaedic external fixation system with removable rails or skates and may include: at least a distal foot fixation element; at least a pair of rails or skates removably connected to the foot fixation element; at least a load sensor associated to at least one of the rails or skates; an electronic apparatus coupled to the load sensor and receiving an electric signal from the load sensor; an electronic controller coupled to the apparatus and issuing at least a flag signal upon detection of a threshold pressure force on said at least one of said rails or skates. This electronic controller may be mounted on the orthopaedic system or may be a structurally independent host device including a controller that is in signal communication with the load sensors.
US12186254B2
A system and method for voice-based control of sexual stimulation devices. In some configurations, the system and method involve receiving voice data, analyzing the voice data to detect spoken commands, and generating control signals based on the commands. In some configurations, the system and method involve receiving voice data, analyzing the voice data for non-speech vocalizations, detecting voice stress patterns, and generating control signals based on the detected patterns. In some configurations, the analyses of the voice data are performed by machine learning algorithms which may be trained on associations between speech and non-speech vocalizations of a user while the user engages in one or more voice-based training tasks, associating speech and non-speech vocalizations with controls of the sexual stimulation device. In some configurations, machine learning algorithms are used to make the associations. In some configurations, data from other biometric sensors is included in the associations.
US12186253B2
A trauma gurney includes a base connected to a frame by a vertical adjustment mechanism. The base is configured that it can be maneuvered over a receiving table. The frame holds a detachable platform suitable for the positioning of a patient thereon. Actuation of the adjustment mechanism allows the frame to be lowered and the patient platform to be detached. The patient platform is configured to be non-interfering with various procedures such as MRI procedures so the patient platform can remain with the patient after the patient has been transferred without adverse effects to the procedures. The patient platform can also be reattached to the frame after it has been removed. The trauma gurney beneficially allows a patient to be transferred from the gurney to another surface, such as for imaging, without requiring a conventional lateral transfer. Similarly, the trauma gurney allows a patient to be transferred back to the gurney.
US12186249B2
A patient support apparatus, such as a hospital bed, includes an alert light assembly or an alert light module having separate zones that are individually illuminated to convey information regarding respective alert conditions. The zones each have indicia related to a particular condition of the patient support apparatus. The illuminated zones are each sufficiently large so as to be seen from afar, such as on the order of ten feet or more. Alternatively or additionally, a GUI of the patient support apparatus displays alert indicia as part of a screen saver. Further alternatively or additionally, the patient support apparatus illuminates an alert light in a manner indicating an optimal time for taking a patient's vital signs.
US12186247B2
A hospital bed comprising: a frame; a plurality of extendable patient support panels mounted to the frame, each patient support panel including a central section and at least one side section selectively movable laterally towards and away from the central section; a movement transmission assembly including at least one transmission member connecting at least two of the movable side sections for laterally moving at least one of the movable side sections when another one of the movable side sections is moved.
US12186243B2
A surgical frame and method for use thereof is provided. The surgical frame is capable of reconfiguration before, during, or after surgery. The surgical frame includes a translating beam that is moveable between at least a first lateral position and a second lateral position. The translating beam is used to join a first support portion and a second support portion of the surgical frame to one another, and movement of the translating beam affords access to a patient receiving area.
US12186235B2
Methods and systems for displaying an overlay superimposed with an intraoperative image of surgical field in a medical ophthalmic procedure, such that the overlay appears at a desired depth within the image are provided. Methods and system for displaying an overlay superimposed with a stereoscopic intraoperative image pair of a surgical field in a medical ophthalmic procedure are provided.
US12186223B2
A wearable device an intelligent health promotion service system (IHPSS) is disclosed. One embodiment of the wearable device (10) is configured to interface plurality groups of skin-mounted sensor pads (130) over a body part (140) of a wearer, and comprises: a modular brace (110) structurally separated from the sensor pads, and a plurality of sensor modules (120). The modular bracing is provided with a plurality groups of orienting slots (111) arranged thereon configured to maintain intra-group orientation between the sensor pads, and is configured to allow inter-group distance adjustment between the groups of the sensor pads over the body part of the wearer. The plurality of sensor modules is configured to be detachably coupled to the groups of sensor pads through the orienting slots in the modular bracing member. The sensor modules are provided with physiological sensing circuits wirelessly communicative with the intelligent health system.
US12186221B2
The invention is directed to a light source device comprising a light emitting element for emitting a blue light having a wavelength ranging from 435 to 500 nm, the light source device being configured to provide the blue light to at least one cell at a transmitted fluence ranging from 0.01 to 18. J/cm2 to promote or induce growth and proliferation of the cell and wherein the light emitting element has a power density ranging from 0.05 to 30 mW/cm2. The invention is also directed to a light source assembly comprising a product adapted to be in contact with the skin or a wound and a light source device connected to the product for providing blue light to at least one skin cell, preferably of the wound.
US12186215B2
A locking assembly for releasably coupling a first elongate member to a second elongate member is provided. The locking assembly can include a first lumen for anchoring the locking assembly to a catheter and a second lumen for releasably retaining a guidewire to the locking assembly. A release member can interface with the locking assembly and apply a force that decouples the guidewire from the locking assembly.
US12186214B2
An endovascularly deployed prosthetic includes a portion for being positioned within an ascending aorta. The prosthesis includes a replacement aortic valve on a proximal end thereof. The prosthesis includes an increased diameter portion that seals against the aorta at a more distal portion, and a pair of conduits extend from the increased diameter portion to the coronaries for fluidly coupling the coronaries to the prosthesis.
US12186213B2
A prosthetic socket, comprising a base for distal connection means for attaching a prosthesis component to the prosthetic socket and comprising at least one side wall, which extends from the base in the proximal direction and at least partially extends around a stump to be held in the prosthetic socket, and at least one support for fastening the side wall to the base being arranged on the base.
US12186212B2
Technology is described to provide a foot and ankle prosthesis for individuals with lower limb loss. This technology is able to store and release energy and individuals or patients who are using the foot/ankle prosthesis may be able to expend less energy when walking. The system includes a hydraulic damper attached to dynamic energy storing spring elements. The axis of rotation of the system can be near to that of an intact human ankle, providing biomimetic function. The system can utilize spring elements based on the vertical displacement of the center of pressure of an intact normal foot. A hydraulic system can provide user adjustable heel height and adaptation to inclines. The dorsiflexion and plantar flexion resistances can be independently adjusted manually or electrically. In addition, the system can be automatically locked in dorsiflexion when loaded and unlock when unloaded.
US12186209B2
A method for manufacturing an orthopedic product for a body part of a patient is disclosed, the method comprising the following steps: a) providing body-part data containing information about an internal structure of the body part, b) detecting a current line of vision from which a user of the method sees the body part, c) displaying the body part data from the current line of vision by means of the display device so that the user sees the body part and the body part data superimposed, d) generating production data for the orthopedic device on the basis of the displayed data and e) providing an orthopedic product manufactured on the basis of the production data.
US12186208B2
A dampening device that can be coupled to a medical implant to eliminate harmful electrical oscillations. The device includes circuity that detects harmful electrical oscillations in the implant. The device also includes circuity that generates cancelling electrical signals that counter the detected electrical oscillations. Alternatively, in a medical implant having a taper junction such as a standard hip implant, resistance welding of the taper junction just prior to surgical implanting may be performed after the appropriately dimensioned components are selected to eliminate a metal on metal interface where corrosion is most likely to occur.
US12186202B2
An expandable interbody fusion device and an associated instrument for inserting the device into an intervertebral disc space, expanding the device and for use in delivering graft material into the device once expanded in the disc space. The device is small enough to fit through Kambin's triangle yet is capable of expanding both in the vertical direction to accommodate spinal lordosis and in the lateral direction to provide sufficient structural support for opposing vertebral bodies laterally within the disc space. A process of forming textured top and bottom surfaces of the device by initially laser ablating each surface with a nano-second pulsed laser followed by laser ablating those surfaces with a femto-second pulsed laser.
US12186192B2
A delivery system for delivery of a radially expandable device to an implantation site in a patient, the delivery system including an elongated tubular member comprising a distal tip and an outer surface, first and second balloon portions spaced proximally from each other and the distal tip along a length of the tubular member, an annular space between the first and second balloon portions, a plurality of clip deployment tubes extendably moveable relative to the outer surface of the tubular member, and a plurality of clips, wherein each clip is moveable within a length of one of the clip deployment tubes between a retracted position and a deployed position.
US12186182B2
Various aspects of the present disclosure are directed toward apparatuses, systems, and methods that include a valved conduit. The valved conduit may include at least one leaflet and an interior surface that mitigates against thrombus formation within the conduit.
US12186178B2
Disclosed herein is a device and method for securing soft tissue such as the long head of the biceps tendon (or similar) as well as free grafts or allografts directly to bone. The device is directly crimped to the preferred soft tissue. This is accomplished by the application of a crimping device to the implantable device and application of sufficient force to crimp the implantable device thereby fixing said device to the tissue in question. The complex of the device and the tissue/tendon can then be directly fixed to bone as necessary. Additionally, the same device and method can be used to connect one tendon to another as indicated.
US12186177B2
The implant includes an aortic portion and a branch, which is intended to be placed in a first of the three arteries that lead into the aortic arch. The aortic portion and branch are formed by two separate sub-assemblies which are capable of being mounted together; the aortic portion has a first opening capable of receiving the branch and a second opening arranged such that it is located substantially opposite the outlets of the other two arteries when the first opening is located opposite the outlet of the left subclavian artery. The second opening has a specific shape such that the edges of the membrane that define it follow the segments of the underlying annuli, which are in a broken line.
US12186176B2
Interatrial shunts are described herein that are designed to benefit both the left side of the heart and the right side of the heart. The interatrial shunt is anchored in the atrial septum to permit blood to flow between atrial heart chambers across the atrial septum. In accordance with some aspects, the lumen of the shunt has an effective orifice area selected to permit blood flow across the atrial septum to unload the patient's left ventricle with beneficial effects on the patient's right ventricle. The shunts are structured to be suitably anchored at the atrial septum for long-term implantation. Further, the shunts preferably have insignificant late lumen loss. The interatrial shunts are expected to treat pathologies such as heart failure and pulmonary hypertension.
US12186173B2
The present invention is a disposable absorbent undergarment, such as an adult brief or baby diaper, having an exterior surface designed to provide improved attachment for one or more fastener members, thereby resulting in improved closure and securement of the undergarment to a wearer.
US12186160B2
A dressing including a film which is impermeable to fluids and permeable to water vapor, and the entire surface of which is covered by a perforated reinforcement coated with a medically acceptable adhesive which is the same or different on each of the faces thereof, the face opposite to the face in contact with the impermeable film of an adhesive being partially covered by an absorbent pad, The dressing further includes a layer for distributing the fluids which is positioned between the impermeable film and the perforated reinforcement.
US12186157B2
A wound dressing is disclosed. A wound dressing comprises a first adhesive layer, an electrode assembly, a monitor interface and a multiplexer. The first adhesive layer comprises a proximal surface configured for attachment of the wound dressing to a skin surface of a user. The electrode assembly comprises a plurality of electrodes including a first set of first electrodes. The monitor interface is configured to form a mechanical and electrical connection with a monitor device. The monitor interface comprises a coupling part and a plurality of terminals including a first terminal. The multiplexer comprises a number of N input pins and a number of M output pins. The N input pins include a first set of first input pins for connection to first electrodes of the first set of first electrodes, the first set of first pins including a first primary input pin and a first secondary input pin, and the M output pins include a first output pin. The first primary input pin is connected to a first primary electrode of the first set of first electrodes and the first secondary input pin is connected to a first secondary electrode of the first set of first electrodes, and the first output pin is connected to the first terminal of the monitor interface. The multiplexer is configured to connect the first primary input pin to the first output pin in a first multiplexer configuration and to connect the first secondary input pin to the first output pin in a second multiplexer configuration.
