摘要:
A precursor of a molecular probe for imaging of pancreatic islets is provided. The precursor includes a polypeptide represented by any one of the following formulae (1) to (12), or a polypeptide having a homology with the foregoing polypeptide: *-DLSKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (1) *-LSKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (2) *-SKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (3) *-KQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (4) *-DLSK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (5) *-LSK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (6) *-SK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (7) *-K*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (8) DLSK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (9) LSK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (10) SK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (11) K*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (12)
摘要:
Manual operation means controls a motion of an operation target character in accordance with operation data outputted from an input device. Automatic motion control means controls the motion of the operation target character in accordance with a series of pieces of operation data which are prepared in advance. Game control means performs a first process when a first condition is satisfied as a result of control of the motion of the operation target character by the manual operation means only in a predetermined interval in a game in progress, performs a second process which is different from the first process when a second condition is satisfied, and executes the first when the control of the motion is performed by the automatic motion control means in at least a part of the interval regardless of whichever condition is satisfied.
摘要:
A system effecting a data reproducing method for a plurality of devices, for sending and receiving data by authenticating the plurality of devices with each other, said data reproducing method including: selecting, from a plurality of descrambling methods, a descrambling method corresponding to a type of said data, executing authentication by an authenticating method corresponding to the selected descrambling method, where the authenticating method is selected from a plurality of authenticating methods, and reproducing said data.
摘要:
A DAC unit, connected to a current supply transistor, includes first control transistors connected in parallel to each other, with each being connected in series to the current supply transistor. The first control transistors drive currents at different current values in response to a bias voltage. The DAC unit also includes second control transistors connected in parallel to each other, with each being connected in series to the current supply transistor. Each second control transistor drives the current having the same current value as one of the first control transistors in response to the single bias voltage. The first and second control transistors driving the currents having the same current value operate in a complementary manner based on part of a digital code. The DAC unit generates an output current by selectively combining at least one of the currents driven by the first control transistors.
摘要:
A series regulator circuit for reducing current consumption, enabling switching between different current consumption modes, and suppressing output voltage fluctuations. A constant current source 20, connected to an input voltage line, is connected to a ground voltage line via a resistor element 21 and transistor B1. Gate terminals of transistors M2, M4 are connected between the constant current source 20 and transistor B1. The transistor M2 is connected to the input voltage line via a transistor M1 activated in a high current mode. The source terminals of the transistors M2, M4 function as the series regulator circuit output terminal, which is connected to the ground voltage line via a resistor element 23 and transistor M3, activated in a high current mode, or via resistor elements 24, 25. A connection node between the resistor elements 24, 25 is connected to a base voltage of the transistor B1.
摘要:
A buffer amplifier having a wide output voltage range includes a first source follower circuit having a first current source and a first transistor, and a second source follower circuit having a second current source and a second transistor. The first source follower circuit has an output terminal connected to a gate of a third transistor and a source of a fourth transistor. The second source follower circuit has an output terminal connected to a gate of a fifth transistor and a source of a sixth transistor. First and second voltages are respectively supplied to the gates of the fourth and sixth transistors. The sixth transistor is operated in place of the fifth transistor in a low voltage range, and the fourth transistor is operated in place of the third transistor in a high voltage range.
摘要:
The problem of a specimen being vibrated during supply or drainage of a liquid such as a culture solution can be avoided, thus allowing acquisition of a stable image. The invention provides a culturing system including a main container having an opening facing upward, accommodating a culture vessel containing a biological specimen, and having an inner space maintained at a predetermined incubation environment; and a nozzle fixed to the main container and inserted into the culture vessel through the opening of the culture vessel to supply or drain a liquid into or from the culture vessel. The main container includes a transparent portion through which the biological specimen in the main container can be externally observed.
摘要:
A ripple filter circuit for ensuring the driving of a driving subject while efficiently eliminating ripple even when the operational voltage margin is small. A first transistor, which is connected to a power supply voltage line, is connected to a ground line via a load of the driving subject. A second transistor, which has substantially the same characteristics as the first transistor, and a dummy load are arranged between the power supply voltage line and the ground line. An operational amplifier includes an inverting input terminal, connected between the second transistor and the dummy load, and a non-inverting terminal at which the voltage is decreased by a predetermined voltage from the power supply voltage. The operational amplifier also includes an output connected to the gate terminal of the second transistor and to the gate terminal of the first transistor via a lowpass filter.
摘要:
An oscillator circuit having a relatively simple circuit structure while enabling full swing with low power consumption includes an oscillation core block, a voltage restriction block, and a differential output block. Drain terminals of first and second transistors are each connected to the voltage restriction block. The voltage restriction block restricts the amplitude of an oscillation signal to a reference voltage. Source terminals of third and fourth transistors are connected to drain terminals of fifth and sixth transistors, and source terminals of seventh and eighth transistors are connected to drain terminals of ninth and tenth transistors. This supplies the differential output block with current generated by the amplitude restriction. The differential output block converts the current into drive voltage to ground voltage to perform full swing.
摘要:
A series regulator circuit for reducing current consumption, enabling switching between different current consumption modes, and suppressing output voltage fluctuations. A constant current source 20, connected to an input voltage line, is connected to a ground voltage line via a resistor element 21 and transistor B1. Gate terminals of transistors M2, M4 are connected between the constant current source 20 and transistor B1. The transistor M2 is connected to the input voltage line via a transistor M1 activated in a high current mode. The source terminals of the transistors M2, M4 function as the series regulator circuit output terminal, which is connected to the ground voltage line via a resistor element 23 and transistor M3, activated in a high current mode, or via resistor elements 24, 25. A connection node between the resistor elements 24, 25 is connected to a base voltage of the transistor B1.