US09519133B2
Various embodiments include systems and methods to provide selectable variable gain to signals in measurements using incident radiation. The selectable variable gain may be used to normalize signals modulated in measurements using incident radiation. The selectable variable gain may be attained using a number of different techniques or various combinations of these techniques. These techniques may include modulating a modulator having modulating elements in which at least one modulating element acts on incident radiation differently from another modulating element of the modulator, modulating the use of electronic components in electronic circuitry of a detector, modulating a source of radiation or combinations thereof. Additional apparatus, systems, and methods are disclosed.
US09519125B2
A zoom lens and a photographing apparatus including the zoom lens are provided. The zoom lens includes a first lens group having a positive refractive power, a second lens group having a negative refractive power, a third lens group having a positive refractive power, and a fourth lens group having a positive refractive power, all of which are arranged sequentially from an object side to an image side. The second lens group may include a first negative lens, a second negative lens, and a first positive lens. The second lens group may also satisfy 5.6≦|fG2n2/fw|≦10.0, where fG2n2 is a focal length of the second negative lens therein and fw is an overall focal length of the zoom lens at a wide-angle position.
US09519110B2
A detector is provided for detecting the interruption of a light path, the detector comprising a light emitter, a light receiver, and a light guiding arrangement disposed opposite the light emitter and receiver. A gap is defined between the light guiding arrangement and at least one of the light emitter and receiver to receive a movable part capable of interrupting the light path there between. Also provided is a light guide for use with such a detector and a utility meter comprising such a detector. In one specific embodiment, an opto electronic detector for detecting rotation of a coding wheel in a utility meter is provided.
US09519096B2
Optical devices include a light source and an optical article, where the optical article is an acid-free, non-yellowing pressure sensitive adhesive light guide. The light source is optically coupled to the light guide such that light emitted by the light source enters the light guide and is transported within the light guide by total internal reflection. The light guide includes a plurality of features oriented to extract light being transported within the light guide.
US09519095B2
An optical waveguide includes a coupling optic and a waveguide body. According to one embodiment, the body includes a first curved surface that extends between an input surface and an end surface and a second surface opposite the first surface. The input surface has a first thickness disposed between the first and second surfaces and the end surface has a second thickness disposed between the first and second surfaces less than the first thickness.
US09519094B2
A backlight module is disclosed. The backlight module includes an ambient light collector for collecting ambient lights, at least one optical fiber connecting to the ambient light collector, a light emitting plate arranged closely to an optical plate, at least one fixing sleeve being received in the through hole, and at least one optical fiber sleeve. The light emitting plate includes a plurality of through holes. The optical fiber sleeve is fixed within the fixing sleeve and engages with the light emitting ends of the optical fibers to fix the optical fibers on the light emitting plate. The backlight module utilizes the ambient lights as light source. In addition, by cutting the light emitting end of the optical fibers, the light emitting angle of the lights are greatly enlarged. As such, the brightness difference is decreased and the display performance is enhanced.
US09519092B1
An apparatus includes an illumination module, an end reflector, and a beam splitter. The illumination module launches display light along a forward propagating path within an eyepiece. The end reflector is disposed at an opposite end of the eyepiece from the illumination module and reflects back the display light traveling along a reverse propagating path. The beam splitter is disposed in the forward propagating path between the end reflector and the illumination module. The beam splitter directs a first portion of the display light traveling along the forward propagating path out a first side of the eyepiece. The beam splitter directs a second portion of the display light traveling along the reverse propagation path out a second side of the eyepiece.
US09519088B2
A micromirror array according to the present invention is a corner reflector type micromirror array capable of projecting a mirror image of an object to be projected sharply with high luminance. The micromirror array includes a substrate, and a plurality of unit optical elements (quadrangular prisms) formed in an array on the substrate. Each of the unit optical elements is of a protruding or recessed shape perpendicular to the surface of the substrate. The unit optical elements has two side surfaces orthogonal to each other on opposite sides of a corner of the side surfaces, and the two side surfaces are light reflecting surfaces. Each of the light reflecting surfaces is of a rectangular shape such that the ratio of the vertical length thereof as measured in a substrate thickness direction to the horizontal width thereof as measured in a substrate surface direction is not less than 1.5.
US09519086B2
An anisotropic light diffusion film includes increased uniformity of the intensity of diffused light in the light diffusion angle region, and the light diffusion angle region has been effectively expanded. An anisotropic light diffusion film includes a first louver structure region and a second louver structure region, in which plural plate-shaped regions having different refractive indices are alternately arranged in parallel along any one direction along the film plane, sequentially from the lower side along the film thickness direction, and the anisotropic light diffusion film includes an overlapping louver structure region in which the upper end of the first louver structure region and the lower end of the second louver structure region overlap each other.
US09519077B2
An electronic device may be provided with a touch screen display that is controlled based on information from a proximity sensor. The proximity sensor may have a light source that emits infrared light and a light detector that detects reflected infrared light. When the electronic device is in the vicinity of a user's head, the proximity sensor may produce data indicative of the presence of the user's head. Variations in proximity sensor output due to user hair color and smudges on the proximity sensor can be accommodated by using an electrical sensing mechanism in addition to the light sensing mechanism. The proximity sensor may include a pair of capacitive electrodes for generating an electric field in the vicinity of the device. The presence of a user's head can sufficiently disturb the electric field so as to produce data indicative of the presence of the user's head.
US09519070B2
A data acquisition module acquires seismic data actually measured at a plurality of observation points; a pulse calculation module acquires information of a propagation environment where seismic waves propagate from a hypocenter of earthquake to each observation point, and applies time reversal processing on the seismic waves received at the observation points by considering the propagation environment to acquire time reversal pulses at each observation point; a line calculation module calculates a parametric line in a length direction of a fault from a distribution of azimuths of frequency spectra of the time reversal pulses acquired by the pulse calculation module; a head searching module searches a parametric head by analyzing the seismic waves received in the vicinity of the parametric line calculated by the line calculation module; and a monitoring module monitors developments of a crack in the fault by observing the parametric head searched by the head searching module.
US09519069B2
CT detector modules are disclosed that include a module frame and a plurality of tileable detector sensors positioned on the module frame. Each of the tileable detector sensors includes an array of detector elements and a mounting structure directly or indirectly coupled to the detector elements to provide for a mounting and alignment of the detector sensor to the module frame. The mounting structure includes an alignment plate positioned generally opposite the array of detector elements, with the alignment plate having alignment pins forming a datum structure to align the detector sensor on the module frame and one or more threaded bosses configured to receive a fastener therein that secures the detector sensor to the module frame. The module frame includes keyed features that receive the alignment pins when the detector sensors are mounted on the module frame, so as to align the detector sensors on the module frame.
US09519063B2
The technology disclosed relates to implementing a novel-testing framework that combines playback of captured GNSS signals with real-time emulation of assisted global navigation satellite system telemetry (abbreviated A-GNSS) in a test session with a mobile device. In particular, it can be used for testing A-GNSS performance of communication devices, navigation systems, telematics and tracking applications.
US09519061B2
Systems, apparatuses, and methods are provided for developing a fingerprint database for and determining the geographic location of an end-user device (e.g., vehicle, mobile phone, smart watch, etc.) with the database. A fingerprint database may be developed by receiving a depth map for a location in a path network, and then identifying physical structures within the depth map. The depth map may be divided, at each physical structure, into one or more horizontal planes at one or more elevations from a road level. Two-dimensional feature geometries may be extracted from the horizontal planes. At least a portion of the extracted feature geometries may be encoded into the fingerprint database.
US09519060B2
A system and method for classifying vehicles from laser scan data by receiving laser scan data corresponding to multiple vehicles from a laser scanner; extracting vehicle shapes corresponding to the multiple vehicles based on the laser scan data; aligning the vehicle shapes; and generating vehicle profiles based on the aligned vehicle shapes. The system and method can further include aligning the vehicle shapes using sequence kernels, such as global alignment kernels, and constraining the sequence kernels based on determined weights.
US09519059B2
There is provided a limited-area reflection type optical sensor having an emitted light lens and a reflected light lens. An opposite-light-receiver-side portion opposite to a light receiver side constitutes a first curvature surface having a first curvature while a light-receiver-side portion on the light receiver side with respect to the opposite-light-receiver-side portion constitutes a second curvature surface having a second curvature smaller than the first curvature in the emitted light lens provided in an optical path of the emitted light. An opposite-light-emitter-side portion opposite to a light emitter side constitutes a fourth curvature surface having a fourth curvature while a light-emitter-side portion on the light emitter side with respect to the opposite-light-emitter-side portion constitutes a fifth curvature surface having a fifth curvature smaller than the fourth curvature in the reflected light lens provided in an optical path of the reflected light.
US09519058B1
In a computer-implemented method and system for capturing the condition of a structure, the structure is scanned with a three-dimensional (3D) scanner. The 3D scanner generates 3D data. A point cloud or 3D model is constructed from the 3D data. The point cloud or 3D model is then analyzed to determine the condition of the structure.
US09519056B2
The present invention provides a system and method for obtaining data to determine one or more characteristics of a wind field using a first remote sensing device and a second remote sensing device. Coordinated data is collected from the first and second remote sensing devices and analyzed to determine the one or more characteristics of the wind field. The first remote sensing device is positioned to have a portion of the wind field within a first scanning sector of the first remote sensing device. The second remote sensing device is positioned to have the portion of the wind field disposed within a second scanning sector of the second remote sensing device.
US09519047B2
A system of asynchronously-clocked fixed-location devices and a roaming client device can be used for a distance determination of the roaming client device. The system includes a master device, at least one slave device, and any number of roaming client devices. The master device transmits a series of pulses. Once those pulses reach the client device, the client device will begin to count the number of pulses. Once those pulses reach the slave device, the slave device will transmit an acknowledgement pulse. After the client device receives the acknowledgement pulse, the client device will stop counting the pulses from the master device. The total number of pulses counted by the client device will then be used in the distance determination of the client device.
US09519041B2
Systems and methods for calibrating on-die analog current sensors are disclosed. The methods can be routinely applied to perform a calibration such as during a system initialization or boot procedure or during other times when the system is in a sleep or power saving mode of operation. The systems determine a leakage current in the device under present environmental conditions. A baseline load current determined under the present temperature and input voltage is retrieved and used to determine a total leakage current. A reproducible and stable dynamic load is controllably applied to provide a known current to the on-die analog current sensor. A third mechanism permits repeatable adjustments to the known current that span the operational range of the on-die integrated current sensor. The responsiveness of the disclosed mechanisms ensures that temperature induced leakage does not increase significantly during a current sensor calibration.
US09519022B2
A wafer inspection apparatus includes a first and second wafer transfer mechanisms, an alignment chamber, a second wafer transfer mechanism and a plurality of inspection chambers. The first wafer transfer mechanism is installed at a first transfer area to transfer wafers individually from a housing. The alignment chamber has an alignment mechanism configured to align the wafer at an inspection position for an electrical characteristics inspection. The second wafer transfer mechanism is configured to transfer the wafer through a wafer retaining support in a second transfer area formed along the first transfer area and an alignment area. The plurality of inspection chambers is arranged at an inspection area formed along the second transfer area and is configured to inspect electrical characteristics of the wafer transferred by the second wafer transfer mechanism through the wafer retaining support.
US09519021B2
An electrosurgical generator includes primary and test sources. The primary source supplies a primary signal and the test source supplies a test signal. The electrosurgical generator includes an output circuit and an abnormality detection circuit. The output circuit is electrically coupled to the primary and test sources. The output circuit receives the primary and test signals from the primary and test sources, respectively. The output circuit is electrically coupled to a load to supply the primary signal thereto. The abnormality detection circuit is electrically coupled to the output circuit to detect an abnormality therein as a function of the test signal. The abnormality detection circuit can also determine a location of the abnormality within the output circuit.
US09519015B2
Among other things, one or more systems and techniques for transition time evaluation of a circuit are provided herein. In some embodiments, a comparator is configured to receive a circuit signal from the circuit. The circuit signal is evaluated by the comparator based upon one or more control voltages to create one or more voltage waveforms. In some embodiments, the one or more voltage waveforms have substantially similar slopes. A time converter, such as a time-to-current converter or a time-to-digital converter, is used to evaluate the one or more output waveforms to determine a transition time, such as a rise time or a fall time, of the circuit. In some embodiments, the one or more output waveforms are used to reconstruct a transition waveform representing a waveform of the circuit signal.
US09519011B2
An adapter for a sensor measuring a differential signal comprises two electrically conductive test-contact elements which are arranged in each case eccentrically relative to an axis of rotation in order to register respectively one partial signal of the differential signal. Moreover, two adjustment components, each rotatable about one of the two axes of rotation, are provided in the adapter for the adjustment of a variable spacing distance between the two test-contact elements. The two adjustment components are connected to one another in a force-fit manner.
US09519002B2
This disclosure is directed to a device and a system for picking a target analyte of a suspension. A picker introduces at least one force, such as by a magnetic gradient and/or by a pressure gradient, to extract the target analyte from a specimen. The magnetic gradient may be introduced by a magnet, such as a permanent magnet or an electromagnet, and the pressure gradient may be introduced by a pump which moves within a fluid-primed cannula to create the pressure gradient, thereby drawing the target analyte into the cannula. The picker may also expel the target analyte onto or into a substrate, such as a well plate, after the target analyte has been drawn into the picker by reversing the pressure gradient or removing the magnetic gradient.
US09518994B2
The present invention provides methods and kits for diagnosing or monitoring conditions such as schizophrenia and tauopathies in a patient by determining the level of ADNP1 or ADNP2 in a sample from the patient.
US09518992B2
Disclosed herein are kits for diagnosing pre-eclampsia and eclampsia or a propensity to develop pre-eclampsia or eclampsia that include agents for the detection of levels of free placental growth factor in a subject.
US09518990B2
Disclosed is a method aiding in the assessment of cancer. It involves the use of the secernin-1 protein (SCRN1) as a universal marker of different cancer types. More specifically disclosed is a method for assessing cancer from a liquid sample derived from an individual by measuring SCRN1 in the sample. Measurement of SCRN1 can, e.g., be used in the early detection of cancer or in the surveillance of patients who undergo surgery.
US09518989B2
The present invention includes compositions and methods for the diagnosis and treatment of lung cancer with a recombinant tumor-associated antigen loaded antigen presenting cell that generates a cytotoxic T lymphocyte specific immune response to at least one of SP17, AKAP-4, or PTTG1 expressed by one or more lung cancer cells.
US09518987B2
Methods for treatment of a Type I allergy in a mammal comprise administering to an individual in need of such treatment a polypeptide of SEQ ID NO: 1 or the mature protein, amino acids 25-260, of the polypeptide of SEQ ID NO: 1, or a fragment of the polypeptide or the mature protein, which fragment shares epitopes for antibodies with the polypeptide or the mature protein, respectively, or a hypoallergenic form thereof that is modified to abrogate or attenuate its IgE binding response. Diagnostic kits comprise the polypeptide of SEQ ID NO: 1 or the mature protein, amino acids 25-260, of the polypeptide of SEQ ID NO: 1, immobilized on a solid support.
US09518986B2
An aptamer-based SERS detection technique that directly monitors an aptamer-analyte capture event by generating spectroscopic information regarding the identity of the analyte that has been bound to the aptamer from a complex biological sample. A reproducible SERS spectrum is measured for an aptamer-analyte complex formed on a metal surface and this spectral information is used directly to identify the specific aptamer-analyte complex and optionally also to quantify the analyte in the sample, thus enabling discrimination between true and false positives in quantitative analyte assays on complex biological samples. In one embodiment the aptamer is attached directly to the metal surface and surrounded by a self-assembled monolayer (SAM) of amphiphilic molecules. In an alternative embodiment the metal surface is coated with a SAM and the aptamer is attached to the amphiphilic molecules of the SAM.
US09518977B2
Methods and microfluidic apparatus are disclosed for drug prediction. A microfluidic apparatus has (a) a plate, (b) a plurality of wells defined in the plate, (c) a plurality of closed microchannels defined in the plate, and (d) a sample platform defining a plurality of open microchannels, where the plurality of closed microchannels are each in communication with one of the plurality of wells and one of the plurality of open microchannels of the sample platform.
US09518972B2
The invention is directed to methods of detecting lung, gastrointestinal tract, and systemic infections by measuring 13CO2/12CO2 isotopic ratios of gaseous carbon dioxide in exhaled breath samples of a subject after administration of a 13C-isotopically-labeled compound.
US09518968B2
An in situ oxygen analyzer having an intrinsically-safe output and a heated probe is provided. The probe is extendable into a source of process gas and has an oxygen sensor and heater disposed therein. The heater is configured to heat the oxygen sensor to a temperature sufficient to operate the oxygen sensor. A housing is coupled to the probe and has first and second chambers. The first chamber is explosion-rated and includes non-intrinsically safe circuitry coupled to the heater to energize the heater. The second chamber contains only intrinsically-safe circuitry that complies with an intrinsically-safe specification. The first and second chambers are isolated from one another. The non-intrinsically-safe circuitry is coupled to the intrinsically-safe circuitry through an energy-limiting isolator.
US09518965B2
A fuel system (12) comprising a vapor trail detection sensor (20) configured to generate a first signal (28) which indicates the optical depth of a vapor trail (35). A control unit (40) is provided responsive to the first signal (28) and configured to generate a second signal (80) in dependence upon the first signal (28). The second signal (80) defines a percentage of at least one of a first fuel composition and second fuel composition required to produce a resultant fuel composition. At least one regulator (42) is provided configured to receive and be responsive to the second signal (80) and regulate the percentage of first and second fuel composition required to produce the resultant fuel composition.
US09518959B2
A method includes: transmitting, via a signal generator, an electrical driving signal, the electrical driving signal having a mean square error; transmitting, via a wave generating component, a Lamb wave, the Lamb wave having many different modes; estimating, via an estimating component, a propagation parameter associated with the Lamb wave; and estimating, via an estimating component, a thickness of a material.
US09518958B2
A circuit for detecting air, a related system, and a related method are provided. The circuit for detecting air includes a receiver connection and an air-detection circuit. The receiver connection is configured to provide a receiver signal. The air-detection circuit is in operative communication with the receiver connection to process the receiver signal to generate a processed signal corresponding to detected air. The air-detection circuit includes one or more active-rectifying elements configured to actively rectify the receiver signal to provide the processed signal.
US09518954B2
A gas sensor control device for controlling a gas sensor, the gas sensor including a gas sensor element that includes a cell including a pair of electrodes and a solid electrolyte, the gas sensor control device including a circuit board connectable to the gas sensor. The circuit board has mounted thereon a voltage control unit mounted on the circuit board and configured to control a voltage developed across a pair of electrodes of the cell to a constant voltage; a temperature detecting unit mounted on the circuit board and configured to detect a temperature of the circuit board; and a voltage correcting unit mounted on the circuit board and configured to apply a correction voltage to the voltage control unit compensating for a temperature-dependent variation in the constant voltage based on the temperature detected by the temperature detecting unit.
US09518952B2
A membrane electrode assembly for a gas sensor is described that includes a membrane disposed between a sensing electrode and a counter electrode. The membrane is a polymer membrane, such as an ionomer, having an ionic liquid retained therein.
US09518949B1
A system and method for enabling measurement of desired environmental criteria of an instrument during storage, including in some situations storage within a closely conforming instrument case. A humireader includes a planar body forming a “T” with a support face. The support face enables a user to suspend and support the body between a pair of adjacent strings allowing the body to extend through a sound hole. An environment sensing system disposed within the body collects environment data of the instrument and presents it to the user using an output system (e.g., a display) that is part of the support face.
US09518948B2
A detection device, including: one or a plurality of magnetic coupling elements configured to have one or a plurality of coils; and a detection unit that measures or calculates an effective resistance values of the magnetic coupling elements or an effective resistance value of a circuit including at least the magnetic coupling elements and determines a presence or absence of a foreign substance based on a change in the effective resistance value.
US09518941B1
Methods and systems are provided to improve PGNAA substance analyzers. In one aspect, an analyzer includes: a source of neutrons; an opening to receive a substance; a gamma ray detector; and computational device(s) configured to receive spectral data of detected gamma rays, perform a regression algorithm on the spectral data using spectral responses for known atomic elements to determine coefficients of spectrum, sum effective weight values (corresponding to the coefficients of spectrum) together to form a total effective weight value for the substance being analyzed, divide effective weight values by the total effective weight value for the substance to generate effective weight-percent values corresponding to two or more respective ones of the atomic elements detected in the spectral data, and generate final weight-percent values based on a correlation of previous effective weight-percent values obtained for known samples with elemental or molecular weight-percent values obtained for the known samples.
US09518937B2
A method of inspecting articles of transparent/translucent material with a vision system comprises illuminating the articles with a light source having an angular spectrum that is adapted to the contrast selected for refractive items presented by the articles. An image sensor picks up the light that has passed through the articles to make images of the articles. During a stage of referencing the vision system, a reference standard is in the field of view of the image sensor, the standard including at least one standard item that refracts light in a known range of angles. An image of the standard is taken to measure at least the contrast in the image produced by at least one standard item. During at least one stage of qualifying the vision system, the standard is placed once more in front of the light source and in the field of view of the image sensor.
US09518935B2
A reticle that is within specifications is inspected so as to generate a baseline event indicating a location and a size value for each unusual reticle feature. After using the reticle in photolithography, the reticle is inspected so as to generate a current event indicating a location and a size value for each unusual reticle feature. An inspection report of candidate defects and their images is generated so that these candidate defects include a first subset of the current events and their corresponding candidate defect images and exclude a second subset of the current events and their corresponding excluded images. Each of the first included events has a location and size value that fails to match any baseline event's location and size value, and each of the excluded second events has a location and size value that matches a baseline event's location and size value.
US09518931B2
An inspection apparatus includes: an imaging section for capturing a first reference image by simultaneously turning on three or more illumination sections, and a second reference image at imaging timing temporally after the first reference image; a tracking target image designating section for designating a tracking target image in the first reference image and is used for tracking a position of the workpiece; a corresponding position estimating section for searching a position of the tracking target image designated by the tracking target image designating section from the second reference image, and specifying a position including the tracking target image in the second reference image, to estimate a corresponding relation of pixels that correspond among each of the partial illumination images; and an inspection image generating section for generating an inspection image for photometric stereo based on the corresponding relation of each of the pixels of the partial illumination images.
US09518921B2
Provided herein are magnetic silica fluorescent nanoparticles and fluorescent silica nanoparticles comprising an aggregation induced emission luminogen and magnetite nanoparticles and use of the same as a fluorescent bioprobe for intracellular imaging and a protein carrier. Also provided are processes for preparing and fabricating the same.
US09518915B2
A corrosivity associated with each of multiple locations near, on, or within a structure exposed to an environment that can corrode the structure is determined. Each of multiple sensor nodes is mounted at a corresponding one of the locations and measures environmental sensor information using one or more environmental sensors and corrosion sensor information using one or more corrosion sensors. The environmental sensor information is processed to obtain for the sensing node a first atmospheric corrosivity category value in accordance with a corrosivity classification system, and the corrosion sensor information is processed to obtain a second atmospheric corrosivity category value for the sensing node in accordance with the corrosivity classification system. One or more of the first and second atmospheric corrosivity category values is provided for use in determining a corrosion classification value for each of the locations.
US09518908B2
An object is to measure a mechanical property of a fluid at a temporal resolution of at least 100 [μs]. Therefore, a method comprising: causing a droplet 21 to fly by ejecting a fluid to be measured from a nozzle 11a as the droplet 21; generating an electric field in a space around a flight path 22 of the droplet 21 by applying a voltage to an electrode arranged in the vicinity of the flight path 22; deforming the droplet 21 in a way of contactless deformation with a dielectric force induced by the electric field; and measuring a mechanical property of the fluid based on temporal variation of deformation state of the droplet 21 after deforming the droplet 21.
US09518899B2
A system and method that enables automated reagent dispensing for tissue stainers. The stainers receive staining protocols from a central controller. The central controller may control a plurality of stainers simultaneously. The stainers obtain information provided on slide identifiers which is communicated to the central controller. The central controller determines a particular staining protocol to apply to a particular slide. The staining protocol is downloaded to the stainer which enables the stainer to operate without additional communication with the central controller. A user may manually initiate a staining protocol or the central controller may operate the stainers on a scheduled basis.
US09518891B2
Testing methods and equipment are provided for fast, non-destructive testing of the quality of seal and/or integrity of a package. According to certain embodiments, dynamic impact characterization is used to determine whether a loss of pressure due to a leak in the package occurs. The methods and equipment can be used in-line with product packaging processes. According to one embodiment, an initial pressure is applied to a package under test. A region of the package is impacted with a force sufficient to create a disturbance to the package while not destroying the package by using an impacting rod. Force sensors/transducers contact with the package and spaced a distance away from the impact region of the package detect a force signature from the impact. The existence of a leak is determined by evaluating the force signature.
US09518867B2
The invention discloses a detecting device combining images with spectra in an ultra-wide waveband, comprising a scanning rotating mirror, a Cassegrain mirror assembly, three spectroscopes, a reflector, four broadband lens assemblies, a visible and near-infrared lens assembly, a long wave lens assembly, a CCD imaging unit, an FPA imaging unit, a Fourier spectrum measuring unit and a grating spectrum measuring unit. The invention is able to recognize a target accurately by spectrum measurement under the guidance of a preliminary recognition process by imaging in visible, near-infrared and long wave infrared wavebands and can solve the problems of incomplete waveband imaging, restricted optical layout, large device size, and poor ability to detect moving objects and dynamic behaviors in prior art. The invention features small size, high integration and being convenient and flexible to use, and can realize image and spectrum detection of moving objects and dynamic behaviors in an ultra-wide waveband and switch a tracking and recognition process for different targets automatically and therefore can be widely used in national economy and national security.
US09518865B2
A device and method for measuring a power density distribution of a radiation source is provided. The device includes a radiation source designed to emit a light beam in a radiation direction; a substrate disposed downstream of the radiation source in the radiation direction and having an extent in an x-direction and a y-direction, the substrate having a first region and at least one further second region, and the first region comprises a diffractive structure designed to separate the light beam impinging on the substrate into a zeroth order of diffraction and at least one first order of diffraction; and a detector unit disposed downstream of the substrate in the radiation direction and designed to measure the intensity of the first order of diffraction transmitted through the substrate and to derive a power density distribution therefrom.
US09518859B2
A method and a system for automatically mapping obstacles within a bin that stores content, the system may include a location estimator that is arranged to calculate, in response to detection signals, multiple estimates of shapes of the upper surface of the content at different time periods; wherein the detection signals are generated by a receiver in response to radiation signals reflected or scattered within the bin; and an obstacle detector that is arranged to detect an obstacle in response to relationships between the multiple estimates of shapes of the upper surface of the content.
US09518857B2
A radar level gauge system comprising a single conductor probe extending through a tubular mounting structure towards and into the product in the tank, a shielding structure radially spaced apart from the single conductor probe and extending along a top portion of the probe inside the mounting structure and past the lower end of the mounting structure, and processing circuitry connected to the transceiver for determining the filling level of the product in the tank. The shielding structure at least partly encloses the top portion of the single conductor probe, and is open in a radial direction to allow entry of the product. The shielding structure exhibits a total enclosing arc angle around the single conductor probe greater than 180° inside the tubular mounting structure, and a total enclosing arc angle around the single conductor probe that decreases with increasing distance from the lower end of the mounting structure.
US09518852B2
A wireless field device assembly comprises a process sensor, a housing, a power module, and a processor. The process sensor is configured to monitor a process variable and produce a sensor signal. The housing encloses an interior space of the wireless field device. The power module comprises an energy storage device and a connection to a local power source, and is configured to be housed in the wireless field device. The processor is located within the interior space, and is powered by the power module. The processor produces a fault signal value used to differentiate between energy storage device faults, local power source faults, and no-fault states.
US09518850B2
A method for installing a probe assembly in a case of a gas turbine engine is disclosed. The method may include installing a first portion of the probe assembly within a first section of the case, and installing a second portion of the probe assembly within a second section of the case. A case assembly within a gas turbine engine is also disclosed. The case assembly may include a case in at least one of a compressor and a turbine, and a probe assembly. The probe assembly may include a first portion positioned within a bore of the case, and a second portion positioned within an inset of the case, the bore having a smaller diameter than the inset.
US09518838B2
The slave is used in an energy management system for collecting meter-reading data from an energy meter for measuring an amount of electric energy supplied from a power source to a predetermined place through a distribution line. The slave includes: a first interface unit configured to communicate with an upper device; a second interface unit configured to communicate with an electric appliance installed in the predetermined place; and a third interface unit configured to perform first wireless communication using an electric wave with a communication terminal. One of the first interface unit and the second interface unit is a wired communication unit configured to perform power line communication using the distribution line, and the other of the first interface unit and the second interface unit is a wireless communication unit configured to perform second wireless communication using an electric wave.
US09518834B2
An apparatus and a method search a route using a portable terminal. A controller establishes a call connection with another party and exchanges positional information with the other party. An analyzing unit analyzes the route information using a first positional information of the portable terminal and a second positional information of the other party. A displaying unit outputs the route information analyzed by the analyzing unit. The controller provides the route information analyzed by the analyzing unit.
US09518824B2
A control device comprises a sensor unit, which outputs a measurement signal, which reflects a deviation of an oscillator along a direction of excitation. A controller main unit derives a control signal for an actuator unit from the measurement signal and a harmonic set point signal such that the actuator unit counteracts a deviation of the deflection of the oscillator from a set amplitude of a harmonic resonance oscillation. A controller extension unit estimates actual-phase and actual-amplitude of a residual oscillation of the oscillator and synchronizes the harmonic set point signal with the residual oscillation at a deactivated actuator unit. The residual energy contained in the residual oscillation is used, in order to arrive faster at a defined operation state of the oscillator.
US09518819B2
The present invention discloses an optical testing device includes a base, a holder, and a number of illuminating modules. The base defines a sliding groove extending along a first direction in a top surface thereof. The holder slides along a second direction on the top surface of the base. The interval regulator is connected to the holder. The illuminating modules are slidably received in the sliding groove. Each of the illuminating modules comprises a circuit board and a single lighting element set on the circuit board. The interval regulator drives the holder to slide along a second direction so that a distance between the holder and the illuminating modules is regulated. The first direction is not parallel to the second direction.
US09518814B2
A single housing with a non-ferromagnetic piezo-driven flexure has primary and secondary coil forms of different diameters, one coaxially inside the other, integrated in the flexure. The cylinders defining the planes of the primary and secondaries do not spatially overlap. The secondary coil forms may be wound in opposite directions and wired to provide a transformer device. Movement of the primary relative to the secondaries in the direction of the central axis of the coils can be differentially detected with high precision.
US09518813B2
A fluidic media detection system for detecting a presence of fluidic media includes a first housing portion adapted to be carried by a user; a second housing portion configured to be selectively operatively engaged with and disengaged from the first housing portion, the second housing portion for supporting a reservoir having an interior volume for containing fluidic media; a fluid conduit supported by one of the first housing portion and the second housing portion for providing fluid communication between the reservoir and the user when the first housing portion and the second housing portion are operatively engaged; and at least one interactive element, positioned near a portion of the fluid conduit, that interacts with the fluidic media when the fluidic media is present in the fluid conduit.
US09518811B2
A measuring force includes a stem, an arm, a detector, a rotation fulcrum, and a measuring force adjuster. A probe which makes contact with a workpiece is provided on the stem. An end portion of the arm is joined to the stem. The rotation fulcrum acts as a fulcrum for a rotating motion of the stem and the arm. The detector detects a displacement amount of the rotating motion of the arm. A crossed spring of the rotation fulcrum imparts on the stem and the arm a torque around an axis of the rotating motion in accordance with the displacement amount of the rotating motion. The measuring force adjuster imparts on the arm and the stem a torque, in a reverse direction of the torque generated by the crossed spring, by an attraction force generated by a magnetic force between at least two magnetic members mutually arranged at opposite ends.
US09518807B2
A method of controlling a projectile includes initiating an execution mode if a roll control authority parameter is outside of a pre-determined operating range for a projectile. The execution mode includes bypassing a guidance command and sending a modified command to execute a coning maneuver to improve control response of the projectile. A projectile control system includes a processor operatively connected to a memory. The memory has instructions recorded thereon that, when read by the processor, cause the processor to execute the method operations described above.
US09518804B2
A rangefinder having improved display capabilities. The rangefinder has a ranging system, a processor, and a display. The rangefinder may have a multi-position button for inputting data, and may also have an inertial navigation unit. The rangefinder has improved input and tracking of wind direction and speed, allowing for improved ballistic compensation for wind.
US09518801B2
A hand guard is provided for a firearm, such as a rifle, and may be suitable for maintaining the alignment of the hand guard, and any accessories coupled thereto, relative to the rifle. The hand guard may be configured so that at least a portion of the hand guard can be removed from the firearm and then re-installed on the firearm without significant change in the orientation and position of the hand guard. The hand guard may also be suitable for coupling accessories such as lights, scopes, laser sights, and other firearm accessories to the firearm.
US09518785B2
A receptacle assembly includes a cage having an interior cavity and a divider that divides the interior cavity into first and second ports. The cage has a front end that is open to the first and second ports, which are configured to receive first and second pluggable modules, respectively, therein through the front end. The divider includes an internal compartment that extends between the first and second ports. The receptacle assembly includes a thermal transfer assembly having a base and a spring. The base is received within the internal compartment of the divider and includes a module side that faces the first port. The spring is operatively connected between the divider and the base such that the spring is configured to bias the base toward the first port and thereby press the module side of the base into thermal communication with the first pluggable module.
US09518775B2
A cooling appliance or refrigeration unit having at least one refrigeration compartment that is contained in a housing and is accessible from above via at least one laterally movable sliding lid containing a transparent window, which has a heat-reflecting inner coating and at least in its front longitudinal region, via an outwardly convex curvature perpendicular to the longitudinal direction, comes to an end in a longitudinal edge that has a front frame. An effortless sliding action with a simultaneously reliable seal is achieved by the front frame having a bearing surface that is oriented horizontally relative to a vertical direction of gravity.
US09518768B2
An evaporator having a phase change material clam shell housing is provided. The evaporator includes an upper manifold, a plurality of refrigerant tubes extending from the manifold, and a louvered clam shell housing defining a chamber for storing a phase change material. The louvered clam shell housing is disposed between and in thermal communication with the upper portion of two adjacent refrigerant tubes. The louvered clam shell housing is formed of two clam shell plates, each having louvers defined by slats folded into the phase change chamber. The folded slats define louver openings in the clam shell housing enabling the phase change material to make direct contact with the adjacent refrigerant tubes, thereby improving thermal communication between the refrigerant flowing in the tubes and the phase change material in the clam shell housing.
US09518766B2
A thermoelectrically cooled system and method is disclosed, which includes a thermoelectrically cooled sleeve, which is configured to hold one or more cylindrical cans of a retail product. The thermoelectrically cooled sleeve includes an outer cylindrical body, an inner cylindrical body, a thermoelectric element located between the outer cylindrical body and the inner cylindrical body, and at least one pair of electrical leads attachable to the thermoelectrically cooled sleeve, and upon application of a source of electrical power to the pair of electrical leads heat moves through the thermoelectric element from the inner cylindrical body to the outer cylindrical body of the thermoelectrically cooled sleeve.
US09518756B2
An external suspension system for supporting an inflatable air duct includes a series of external hangers that help hold the duct open while the duct is deflated. In some embodiments, the suspension system supports the duct at a series of points that are broadly distributed in a staggered pattern across the duct, yet the entire duct can be suspended from a single overhead cable, even if the duct is a stepped tube with multiple diameters. The system includes novel ways of locking the hangers to the duct and to the overhead cable.
US09518754B2
A first flow switching device causes part of a refrigerant discharged from an injection compressor to flow through a first bypass pipe and be supplied to an outdoor heat exchanger targeting for defrosting. A second flow switching device causes part of the refrigerant supplied to the outdoor heat exchanger targeting for defrosting to enter a second bypass pipe.
US09518753B2
A modeling framework for evaluating the impact of weather conditions on farming and harvest operations applies real-time, field-level weather data and forecasts of meteorological and climatological conditions together with user-provided and/or observed feedback of a present state of a harvest-related condition to agronomic models and to generate a plurality of harvest advisory outputs for precision agriculture. A harvest advisory model simulates and predicts the impacts of this weather information and user-provided and/or observed feedback in one or more physical, empirical, or artificial intelligence models of precision agriculture to analyze crops, plants, soils, and resulting agricultural commodities, and provides harvest advisory outputs to a diagnostic support tool for users to enhance farming and harvest decision-making, whether by providing pre-, post-, or in situ-harvest operations and crop analyses.
US09518737B2
A combustion chamber comprises an outer wall and an inner wall spaced from the outer wall. The outer wall has at least one mounting aperture extending there-through and the inner wall has threaded studs extending there-from. The threaded studs extend through the mounting apertures in the outer wall. Cooperating nuts locate on the studs and washers are positioned between the outer wall and the cooperating nuts. Each washer has a rim and a bore. The washers have one or more passages extending there-through from the rim to the bore of the washer to provide a flow of coolant through the passages in the washers, the mounting apertures in the outer wall and around the threaded studs to cool the threaded studs to increase the working life of the inner wall. Other cooling arrangements for the threaded studs are disclosed.
US09518736B2
A water-containing solid fuel drying apparatus that can efficiently dry with low energy consumption by effectively utilizing sensible heat and latent heat of a heating medium for drying, etc. is provided. A drying apparatus (10) that dries water-containing solid fuel includes a dryer (20) that injects scavenging gas into the interior of a drying vessel (21) in which a heat transfer pipe (22) is disposed; a dust collector (13) that removes microparticles from microparticle-containing mixed gaseous fluid that has flowed out of the drying vessel (21); a compressor (30) that compresses vapor-containing mixed gaseous fluid; a vapor heat exchanger (31) that preheats low-pressure mixed gaseous fluid with high-pressure mixed gaseous fluid compressed at the compressor (30); and a gas-liquid separator (14), in which the high-pressure mixed gaseous fluid is employed as drying gas that radiates heat by passing through the heat transfer pipe (22), that performs gas-liquid separation of water-containing scavenging gas that has flowed out of the heat transfer pipe (22) while containing condensed water of vapor generated due to heat radiation, wherein the water-containing solid fuel is dried by heating the water-containing solid fuel in the drying vessel (21) utilizing latent heat and sensible heat of the mixed gaseous fluid.
US09518722B1
An edge-lit lighting structure includes a first end panel and a second end panel. The edge-lit lighting structure further includes a first side panel extending between the first end panel and the second end panel at a first longitudinal side of the edge-lit lighting fixture. The edge-lit lighting structure also includes a second side panel extending between the first end panel and the second end panel at a second longitudinal side of the edge-lit lighting fixture opposite the first longitudinal side. Further, the edge-lit lighting structure includes a center beam having a hollow portion. The center beam is positioned between the first side panel and the second side panel and is attached to the first end panel and the second end panel.
US09518721B1
According to an exemplary embodiment, an apparatus for light signaling may be provided. The apparatus may include, but not be limited to, a number of LED arrays and OLEDs, a number of LED lighting controllers connected to the number of LED arrays and OLEDs, a power supply connected to the number of LED lighting controllers, a number of protective elements covering the number of LED arrays and OLEDs, a housing containing the number of LED arrays and OLEDs, an electrical box attached to the housing and containing the power supply and the number of LED lighting controllers, and a number of mounting element connected to the housing.
US09518716B1
A linear wide area lighting system includes an elongated substrate having a linear light emitter array disposed on the substrate. The array includes a plurality of light emitters such as light emitting diodes or lamps. An elongated refractive lens is positioned over the substrate and linear light emitter array such that light emitted from the emitters is incident on the refractive lens and is refracted through the lens into a wide illumination area. The lens is extruded in some embodiments providing the lens with a substantially uniform extruded cross-sectional profile in some embodiments. The substrate is housed either between a base and the lens in some embodiments, or in an integrally formed bore in the lens body in other embodiments. One or more end caps are located on the longitudinal ends of the lens and base to fully enclose and seal the substrate and linear light emitter array.
US09518710B2
An electronic flameless candle including a body having a top surface, a bottom surface, a sidewall between the top surface and the bottom surface, and a cavity defined by the top surface, the bottom surface and the sidewall, the body configured in shape and size to simulate a true flame candle. The candle may also include a light source operably connected to the body, the light source electrically operated to illuminate in a way that simulates a natural flicker of a real candle flame. The candle may also include a scent component, operably connected to the body, the scent component configured to emit a scent when heated and/or a sensor component, operably connected to the body, the sensor component configured to sense an environmental condition and affect a mode of the light source upon the sensing of the environmental condition.
US09518708B2
A lighting apparatus includes a plurality of LEDs arranged in a row; an elongated wiring board on which the LEDs are mounted; and an optical lens covering all the LEDs and controlling distribution of light emitted from each LED. The light emitted from each LED has an optical axis orthogonal to the wiring board. The optical lens is a converging lens and includes a first light incident surface on which the light emitted from the LED is incident, a medium that guides the light incident from the light incident surface, a light emitting surface, and a diffusion section that contains diffusing particles for causing the light incident from the LED to diffuse. The concentration of the diffusing particles in the diffusion section is high in the vicinity of the optical axis of the light emitted from the LED and gradually decreases as a distance from the optical axis increases.
US09518703B2
A disposable compressed gas cartridge has an envelope formed of a cylindrical wall portion, an end wall portion enclosing a first end of the cylindrical wall portion, a neck portion formed at a second end of the cylindrical wall portion, and a membrane spanning across the neck portion such that the envelope is arranged to contain gas under pressure therein. A resilient sealing member is integrally and externally supported on the second end of the envelope so as to abut the seat surface about a charging pin of a compressed gas consuming device. Sealing engagement between the cartridge and the device being charged with compressed gas by the cartridge is provided primarily by the sealing member on the cartridge which is replaced together with the cartridge to always ensure that the sealing between the cartridge and the device is accomplished with a new and effective sealing member.
US09518699B2
The truss mounting bracket simplifies installation of electronic type equipment below fabricated trusses commonly used in warehouse and other buildings. The mounting bracket includes a housing having at one end thereof a structure for connecting with an electrical conduit section. The opposite end of the housing is adapted to allow securement below a fabricated truss. A head portion extends from a center portion of the housing and has a thread connection therewith. The head portion engages the truss and allows the housing to be tightened against the lower surface of the truss. The conduit and the housing allow electrical cables to pass through the conduit and at least partially through the housing.
US09518693B2
A pig receiver and method retrieve pigs in pipeline pigging operations. In one embodiment, a pig receiver includes a pig receiver unit. The pig receiver also includes a pig gate valve assembly disposed on the pig receiving unit. The pig gate valve assembly includes a gate valve. The pig gate valve assembly also includes a first actuator and a second actuator. The pig gate valve assembly further includes a cylinder guide. In addition, the pig gate valve assembly includes a tie bar. Actuation of the tie bar actuates the gate valve. An end of the tie bar is attached to the first actuator, and an opposing end of the tie bar is attached to the second actuator. The pig receiver also includes a system for removing contaminants from the pig receiver.
US09518690B2
A girdle for a hose coupling has two halves. Each half has a rounded outer surface and a hollow cylindrical center portion configured to house a hose coupling. The center portion of the girdle has stepped shoulders on each end that engage with the hose coupling to maintain the position of the girdle over the hose coupling. The two halves of the girdle are joined around the hose coupling by one or more fasteners to form a prolate spheroid.
US09518687B2
A device can be housed coaxially inside a sleeve in which the supplies are situated, and includes: a hollow cylindrical body that fits inside the sleeve and accepts the mechanism in the housing of the hollow body, with passages for respectively connecting the supplies to said mechanism; and a cover which is integrated or fixed, removably, on the front side of the cylindrical body and connects the hidden supplies to the respective passages of the body.
US09518682B2
A bottom-to-surface connection installation between a common floating support and the sea bottom, having a plurality of flexible lines such as flexible pipes extending between said floating support and the sea bottom. The flexible lines are supported by respective ones of a plurality of troughs each trough lying between two pipe portions defining a first flexible line portion in a hanging double catenary configuration between the floating support and the trough, and a second flexible line portion in a single catenary configuration between the trough and the point of contact of the flexible pipe with the sea bottom. The installation has at least one support structure having a base-forming bottom portion resting on and/or anchored to, or embedded in the sea bottom and a top portion supporting at least two troughs, respectively a bottom trough and a top trough, the troughs being arranged at different heights in such a manner that the low point of the first flexible line portion passing via the bottom trough is situated below the low point of the first flexible line portion passing via the top trough.
US09518680B2
A valve assembly may include a valve plate having an inlet hole through which working fluid passes from a vacuum muffler, a first discharge hole through which working fluid discharged from a cylinder passes, a second discharge hole through which the working fluid from the first discharge hole passes, and a pulsation and/or noise reducing passage through which the working fluid from the second discharge hole flows; a discharge valve at or in the valve plate configured to open and/or close the first discharge hole; a valve sheet having a first hole therein communicating with the first discharge hole and a second hole therein at an outlet of the pulsation and/or noise reducing passage; and a vacuum valve in the valve sheet configured to open and/or close the inlet hole.
US09518663B2
A pilot valve element includes a metallic pilot valve body formed integrally with a plunger, a flexible sealing member, fitted on a tip of the pilot valve body, which touches and leaves a pilot valve seat, and a stopper for restricting the displacement of the pilot valve element relative to a driven member in a manner such that the sealing member is stopped in a direction of axis line after the sealing member has seated on a pilot valve seat. The stopper is configured such that the pressure-receiving diameter of the sealing member, which receives a pressure difference between an upstream side and a downstream side of the pilot valve, remains unchanged from when the sealing member comes in contact with the pilot valve seat until when the sealing member is stopped by the stopper with the result that the sealing member has completely seated on the pilot valve seat.
US09518660B2
A static gasket and method of construction thereof is provided. The gasket includes a functional layer constructed of one type of metal having an opening bounded by an inner periphery an outer periphery. The gasket further includes a carrier layer constructed of a different metal than the functional layer. The carrier layer has an opening bounded by an inner periphery configured to receive the outer periphery of the functional layer in a line-to-line or loose fit. The functional layer is configured in substantially coplanar relation with the carrier layer with a first portion of the outer periphery of the functional layer being welded to a radially aligned first portion of the inner periphery of the carrier layer. A second portion of the outer periphery of the functional layer remains detached from a radially aligned second portion of the inner periphery of the carrier layer.
US09518658B2
A rotary engine rotor (10) comprises a body (12) comprising an outer surface (18), an inner surface (22), an insert (14) and a fixing member (16). The outer surface (18) comprises three rotor sides (20) arranged in an equilateral triangle shape. The inner surface (22) comprises a location portion (24) at the midpoint of each rotor side (20), the location portions (24) together defining a location aperture (26). One location portion (24) is provided with a first fixing socket (28) extending radially from the inner surface (22) of the body (12), towards the outer surface (18) of the body (12). Cooling channels (30) are provided axially through the body (12) in the region of each apex (31). The insert (14) is provided in the location aperture (26) and comprises a bearing part (38) with a second fixing socket (40) extending radially through the insert (14) and in alignment with the first fixing socket (28). The fixing member (16) is provided through the second fixing socket (40) and received in the first fixing socket (28) to couple the insert (14) to the body (12).
US09518657B2
A parking lock arrangement for a motor vehicle transmission has a housing. A parking lock wheel is connectable to a shaft of the motor vehicle transmission. A parking lock pawl is pivotable between a parking lock position and a release position about a pawl axis mounted on the housing. In the parking lock position, the parking lock pawl is in engagement with the parking lock wheel and prevents the rotation thereof. The parking lock arrangement comprises an actuating mechanism for the parking lock pawl and an actuator arrangement for the actuating mechanism. The actuator arrangement has a control member which is movable between a home position and a parking position and is coupled to the actuating mechanism. An actuating member is coupled to the control member via a releasable coupling device and to the actuating mechanism, wherein the actuating member is furthermore mechanically preloaded in one direction in order, via the actuating mechanism, to press the parking lock pawl into the parking lock position. The coupling device is designed in such a manner that it is releasable by means of an electric release signal.
US09518651B2
The present invention is a weighted gearshift knob for mounting to the gearshift shaft of a motor vehicle. The weighted gearshift knob comprises of a cylindrical exterior body with a hollow cylindrical interior for housing a cylindrical counter weight, which weight is secured by a removable screw, and said screw is covered by a cap. The weighted gearshift knob is designed to allow for the addition or removal of the counter weight as desired by a driver in order to achieve optimal performance. This design allows the gearshift knob and its components to be housed in one apparatus, requiring minimal assembly and/or disassembly for mounting or removal from the gearshift shaft.
US09518649B2
There is provided a link mechanism configured such that a shift rod driven by an operation of a gear shift pedal drives a shift shaft to rotate via a gear shift lever. A stroke sensor measuring a stroke amount, and a shift load sensor making a stroke motion in extension and contraction directions in accordance with shift-up and shift-down operating loads from the gear shift pedal are integrally provided to the shift rod.
US09518638B2
The present disclosure provides a multiple speed transmission having an input member, an output member, a plurality of planetary gearsets, a plurality of interconnecting members and a plurality of torque-transmitting mechanisms. The plurality of planetary gear sets includes first, second and third members. The input member is continuously interconnected with at least one member of one of the plurality of planetary gear sets, and the output member is continuously interconnected with another member of one of the plurality of planetary gear sets. At least eight forward speeds and one reverse speed are achieved by the selective engagement of the five torque-transmitting mechanisms.
US09518637B2
A planetary gear train of an automatic transmission for vehicles may include an input shaft receiving torque of an engine, an output shaft outputting changed torque, a first planetary gear set, a second planetary gear set, a third planetary gear set, a fourth planetary gear set, a first rotational shaft selectively connected to a transmission housing, a second rotational shaft directly connected to the input shaft, a third rotational shaft, a fourth rotational shaft, a fifth rotational shaft selectively connected to the first rotational shaft and the second rotational shaft, a sixth rotational shaft directly connected to the output shaft, a seventh rotational shaft selectively connected to the fourth rotational shaft or selectively connected to the transmission housing, an eighth rotational shaft selectively connected to the fifth rotational shaft, six friction elements disposed to selectively connect the rotational shafts or selectively connect the rotational shafts with the transmission housing.
US09518636B2
A transmission, in particular a multi-speed transmission for a motor vehicle, includes a housing, a drive shaft, an output shaft, at least four planetary gear sets, whereas each of the planetary gear sets comprises one sun gear, at least one planet, one planetary carrier and one ring gear, along with several shift elements in the form of at least four clutches and at least two brakes. The sun gear of the fourth planetary gear set is connected to the housing. The planetary carrier of the fourth planetary gear set is connectable through the fourth clutch to the output shaft. The second brake is connected to the sun gear of the first planetary gear set. The first brake is connected to the ring gear of the first planetary gear set and to the planetary carrier of the first planetary gear set. The first brake is connectable through the third clutch to the drive shaft.
US09518629B2
Safety or protective devices for use in preventing or limiting injury to players impacting against sports equipment use compression coil springs, gas springs, foam or combinations thereof to absorb force during the impact. Particular embodiments are configured for use at the edge of a glass viewing and shielding panel disposed atop the boards of a hockey rink, for example such edges typically found at the team bench of a conventional hockey rink. A shock absorbing system of the device is positioned so as not to reach beyond the plane of the glass into the area of play.
US09518627B2
In one aspect of the invention, a torsion bar assembly is provided. The assembly includes a first shaft having a first bore, a second shaft having a second bore, the second shaft operatively coupled to the first shaft, and a torsion bar positioned within the first and second bores. The torsion bar includes a splined first end having a first diameter extending to a first end face having a diameter generally the same as the first diameter, a splined second end having a second diameter extending to a second end face having a diameter generally the same as the second diameter, and an active diameter extending between the splined first end and the splined second end. The torsion bar is fabricated from a material having a hardness greater than 45 Rockwell C-Scale.
US09518624B2
A method for reducing chatter vibrations of a friction clutch controlled automatically by a clutch actuator on the basis of a target clutch torque assigned to a clutch torque which is to be transmitted. The clutch has a present actual clutch torque which is marked by vibrations as a result of chatter vibrations which occur occasionally. In order to achieve a reduction of the chatter vibrations, from an input signal that is representative of the clutch torque that is marked by vibrations, on the basis of a vibration-selective guidance variable derived in a torque pattern between internal combustion engine and friction clutch, an absolute amplitude and a phase of the input signal are ascertained on the basis of a transfer function which maps the guidance variable on a vibration-selective clutch torque; from that a correction clutch torque is determined; and using that the target clutch torque is corrected.
US09518618B2
A clutch assembly for a manual shift transmission includes a first shaft, which carries a first clutch disc, a second shaft that is coaxial to the first shaft. The second shaft carries an axially shiftable second clutch disc, a first ramp, of which at least one section describes a helical line that is coaxial to the shafts, and a first actuating body. The first actuating body is clamped between the first ramp and the second clutch disc and can be moved about a common axis of the shafts between an open position, in which the clutch discs are spaced from one another, and a closing position, in which the clutch discs contact one another in a frictionally joined manner.
US09518614B2
A device used to achieve a releasable connection between two components and at least one shaft on which the components are rotatably mounted. A switching element that is mounted on the shaft can be coupled to one of the components in a non-rotatable fashion by relative motion in the axial direction of the shaft between the components and the switching element. Toothing profiles of the components each comprise at least two spaced-apart teeth rows. A toothing profile of the switching element is provided with at least three spaced-apart rows of teeth, of which at least two teeth rows of the switching element can be brought into a position where they overlap/engage with the two teeth rows of the first component and also where this happens for at least two of the three teeth rows of the switching element with the two teeth rows of the second component.
US09518608B2
A bearing assembly, including a housing with a first circumferentially disposed groove; a bearing including an outer race with a second circumferentially disposed groove; and a retaining ring disposed within the first and second circumferentially disposed grooves. A method of retaining a bearing, including: locating a first portion of a ring within a groove in an outer race; installing a housing radially about the race to contact the race; locating a second portion of the ring within a groove in the housing; bringing temperature of the housing and the race to a first level; fixing, with contact between the race and the housing, the race with respect to the housing; increasing the temperature of the housing and race to a second higher level; creating a radial gap between the housing and the outer race; and fixing, with the retaining ring, a position of the race with respect to the housing.
US09518602B2
A ball joint which comprises a joint housing, a bearing shell received in the joint housing, and a ball stud having a ball head arranged for pivoting movement in the bearing shell. The ball head is prestressed by a spring system substantially in the direction of a longitudinal axis of the ball stud against the joint housing. The spring system is composed of spring elements connected in parallel and/or in series, at least one spring element of the spring system being made of a polymer material or of an elastomer material.
US09518598B2
An expansion anchor is disclosed. The expansion anchor has an elongated main part having a receiving area extending substantially in the longitudinal direction, into which an expansion element can be inserted in the longitudinal direction, to press expansion tabs laterally from an initial position to an expanded position. At least one setting control member can be moved in the longitudinal direction on the expansion anchor and it is moved by movement the expansion element relative to the main part.
US09518597B2
A self-tapping screw for soft metals having low required initial driving torque, high axial force in the tightened state, small axial force reduction due to heat or the like, and a low manufacturing cost because no intricate and expensive mold is required, and also has an advantage that an amount of produced chip powder is small. The self-tapping screw includes a tapered smaller diameter part at an end of a shaft. The smaller diameter part is inserted and driven into a pilot hole formed in a soft metal to form a female screw in the pilot hole. In the shaft and the smaller diameter part, a continuous male screw with a constant pitch is formed. A thread ridge of the male screw of the smaller diameter part is provided with multiple sets of a largest diameter part and an increasing diameter part, the largest diameter part having a stepped part at a position on a trailing side of the largest diameter part during driven turning of the screw, the increasing diameter part having a gradually increasing diameter from the stepped part to a next largest diameter part.
US09518595B2
A hydraulic pressure amplification system for increasing the output pressure in the delivery pipe to or from a ram pump, a spring rebound inertia pump or similar cyclic pumps which deliver a pulsating flow. Said hydraulic pressure amplification system comprises a fluid inlet (29), a fluid outlet (30) and one or more rigid bodies (21) which contain an enclosed convolute passageway extending between the fluid inlet and the fluid outlet. The body or bodies are sandwiched between rigid cover plates (22,23) which respectively contain the fluid inlet (29) and the fluid outlet (30).
US09518588B2
There are described methods and apparatus for operating and/or cleaning a compressor. In an embodiment, a first fluid comprising gas may be passed through the compressor, while the compressor operates to compress the first fluid. A second fluid may be passed through the compressor, the second fluid comprising gas and liquid from at least one well. The second fluid may be passed through the compressor for a limited time period to clean a surface inside the compressor, while the compressor operates to compress the second fluid.
US09518579B2
A thermal control valve for use in a lubricant flooded compressor system including a controller that generates a control signal includes a valve body including a hot coolant inlet, a cooled coolant inlet, a mixed coolant outlet, an actuator space, and a cylinder bore. A sleeve is positioned within the cylinder bore and is movable between a first position, a second position, and a third position, and an electrical actuator is at least partially disposed within the actuator space and is operable in response to the control signal to move the sleeve between the first position, the second position, and the third position.
US09518577B2
An electrochemically actuated pump and an electrochemical actuator for use with a pump. The pump includes one of various stroke volume multiplier configurations with the pressure of a pumping fluid assisting actuation of a driving fluid bellows. The electrochemical actuator has at least one electrode fluidically coupled to the driving fluid chamber of the first pump housing and at least one electrode fluidically coupled to the driving fluid chamber of the second pump housing. Accordingly, the electrochemical actuator selectively pressurizes hydrogen gas within a driving fluid chamber. The actuator may include a membrane electrode assembly including an ion exchange membrane with first and second catalyzed electrodes in contact with opposing sides of the membrane, and first and second hydrogen gas chambers in fluid communication with the first and second electrodes, respectively. A controller may reverse the polarity of a voltage source electrically coupled to the current collectors.
US09518576B1
A peristaltic pump includes a rotating member operably coupled to a drive. The rotating member includes a plurality of rollers arranged in a circular configuration. A guide member defines a channel configured to direct a peristaltic tube around the rotating member so that the peristaltic tube interfaces with the plurality of rollers. The peristaltic tube is pressed against the plurality of rollers by a retaining shoe. The retaining shoe contains surface irregularities configured to restrict movement of the peristaltic tube. A keeper braces the restraining shoe against the peristaltic tube. The rotating rollers compressing the peristaltic tube against the retaining shoe as the rotating member rotates results in a peristaltic action that produces a nearly pulse free linear flow.
US09518570B2
A motor controller includes a motor winding heater function. The motor controller applies a predefined current to one or more of the motor windings without the use of additional dedicated motor winding heater devices. The motor controller serves to control the operation of the motor, while the motor windings serve both as a heater at times and to produce torque at times.
US09518569B2
Adjustment device for an axial piston machine and hydraulic machine having such an adjustment device
An adjustment device for a pivoting cradle of a hydraulic machine, in particular of an axial piston machine, is disclosed. Said adjustment device has an actuating piston to which pressure medium for pivoting the pivoting cradle about a pivoting axis is applied via an actuating pressure space. In order to control the feeding in of pressure medium and the relieving of the actuating pressure space, a control valve is provided. Said control valve has a control piston configured to be adjusted by an electric actuator, wherein the electric actuator is controlled by a control device. In this context, the control device controls the electric actuator as a function of a control difference formed from a setpoint pivoting angle and an actual pivoting angle of the pivoting cradle. The actual pivoting angle of the pivoting cradle is fed back electrically to the control device here.
US09518556B2
Provided herein is an oscillating water column type wave energy converting apparatus that is suspended underwater by a mooring device and system thereof, the apparatus and system comprising an damping plate connected to the mooring device; a post with a hollow of which both ends are open, the post extending vertically upwards from the mooring device; a turbine disposed inside the hollow of the post; and a housing of which its lower end is open and which is disposed at an upper portion of the post, wherein the turbine is rotated by air that flows according to changes in water level inside the hollow of the post.
US09518554B2
An embodiment of a plasma ignition system for an internal combustion engine having up to N cylinders includes a power splitter, N phase shifters, N amplifiers, a power combiner network, and up to N radiation devices. The power splitter divides an input RF signal into N divided RF signals. Each phase shifter applies one of multiple pre-determined phase shifts to one of the N divided RF signals to produce N phase shifted RF signals. The N amplifiers amplify the N phase shifted RF signals to produce N amplified, phase shifted RF signals. The power combiner network combines the N amplified, phase shifted RF signals to produce N output RF signals. Each of the radiation devices receives one of the N output RF signals, and produces a plasma discharge when a power level of the output RF signal is sufficiently high.
US09518531B2
A piston of an internal combustion engine, includes a piston upper part and a piston lower part which are supported via corresponding joining webs, in each case forming a joining zone connected in a material-to-material manner by means of a multi-orbital rotary friction weld. The joining webs and which are in each case directly connected have a wall thickness S1, S2 which is identical as far as possible. The piston encloses a combustion-chamber recess and at least one cooling duct which are made centrally or eccentrically in the piston. The combustion chamber recess and the cooling duct form a circular contour or a contour which deviates from a circular shape.
US09518526B2
In a method for controlling a valve which injects fuel into a combustion chamber of an engine and which has a valve member which closes a valve opening, and an electric actuator which drives the valve member to carry out strokes for releasing the valve opening and to which electrical control signals are applied for triggering valve member strokes of a defined stroke size, in order to compensate for an age-related stroke reduction of the valve member and deteriorated metering of the injected fuel related thereto, a stroke loss model into which temperature and temperature changes at the valve as well as the number of strokes carried out by the valve member are continuously incorporated is used to predict a reduction of the stroke size as a stroke loss and to correct the control signals using the predicted stroke loss.
US09518524B2
A fuel injection controller controls a fuel injector which injects a fuel directly into a cylinder of an engine. The fuel injection controller conducts a correction to increase a fuel injection quantity injected from the fuel injector according to a fuel-adhered quantity which is an amount of the fuel adhered to an opened intake valve. Thus, even when the fuel is adhered to the intake valve, an appropriate amount of the fuel can be injected into the cylinder.
US09518519B2
Systems, methods and techniques for exhaust gas recirculation are provided. The system includes controlling the mixing of exhaust flow from at least one cylinder of an engine with air in an air intake system prior to combustion in response to an EGR fraction deviation condition. The exhaust flow from the at least one cylinder is accumulated prior to mixing and distributed into the intake air system in a controlled manner to mitigate or prevent the EGR flow from deviating from an expected EGR fraction.
US09518518B2
A compression ignition engine is fueled from common rail fuel injectors that predominately inject natural gas fuel that is compression ignited with a small pilot injection of liquid diesel fuel. Before and after a rapid load loss transient, the liquid and gaseous rail pressures are controlled toward respective pressures based upon engine speed and load. During the transient, the liquid rail pressure is controlled relative to the gas rail pressure in order to maintain the liquid rail pressure greater than the gas pressure during the transient to avoid migration gaseous fuel into the liquid fuel side of the system.
US09518515B2
The invention relates to a sliding mode controller for controlling a controlled object system by using the adaptive sliding mode control. Also, the invention relates to an internal combustion engine system control device for controlling an internal combustion engine system by using the adaptive sliding mode control. The invention is characterized by comprising adaptive law input term learning means for learning an adaptive law input term so as to transfer an offset of a reaching law input term in the adaptive sliding mode control to the adaptive law input term.
US09518511B2
The invention discloses a method for operating a gas turbine with sequential combustion, which gas turbine includes a compressor, a first combustor with a first combustion chamber and first burners, which receives compressed air from the compressor, a second combustor with a second combustion chamber and second burners, which receives hot gas from the first combustor with a predetermined second combustor inlet temperature, and a turbine, which receives hot gas from the second combustor. The CO emission for part-load operation is reduced by reducing the second combustor inlet temperature for base-load operation of the gas turbine, and increasing the second combustor inlet temperature when decreasing the gas turbine load (RLGT) from base-load to part-load.
US09518510B2
An apparatus including an internal combustion engine receiving air from an air particle separator is disclosed. The air particle separator has an air intake capable of receiving air and a particulate matter conveyed by the air, the particle separator being capable of filtering the particulate matter from the air to produce a clean flow and a dirty flow. The clean flow is provided to the inlet of the internal combustion engine. A bladed component is in fluid communication with the dirty flow and includes a plurality of members operable to assist the dirty flow in being conveyed from the particle separator. The bladed component rotates about an axis and has an annular construction disposed radially outward of the plurality of members configured to receive a circumferential force to cause the bladed component to rotate about the axis.
US09518503B2
A cooling water control valve apparatus capable of independently controlling flow rates of cooling water in two lines with a single apparatus for cooling water control and capable of achieving cost reduction.A cooling water control valve apparatus which adjusts a flow rate of cooling water for cooling an object to be cooled includes two inlet ports through which cooling water is introduced, an electrical control valve which is arranged at a first passage communicated with one of the inlet ports and which adjusts a flow rate of cooling water flowing through the first passage with electronic control, and a thermosensitive valve which is arranged at a second passage communicated with the other of inlet ports and which adjusts a flow rate of cooing water flowing through the second passage owing to displacement of a temperature detecting medium with temperature.
US09518496B2
An exhaust after-treatment system for treating an exhaust produced by an engine, including an exhaust passage in communication with the engine; an injector for dosing an exhaust treatment fluid into the exhaust passage, a mixing device positioned downstream from the injector, the mixing device operable to intermingle the exhaust treatment fluid and the exhaust; an irregularly-shaped exhaust treatment substrate positioned downstream from the mixing device; and a dispersion device positioned between the mixing device and the irregularly-shaped exhaust treatment substrate. The dispersion device includes a plurality of dispersion members each being operable to direct an exhaust stream flowing through the dispersion device into a plurality of different directions to disperse the exhaust flow over substantially an entire surface of the irregularly-shaped exhaust treatment substrate.
US09518493B2
A method and an exhaust-gas treatment device for regenerating an exhaust-gas purification component include charging at least one capacitor and heating at least one sub-volume of the exhaust-gas purification component to at least 900° C. by supplying at least a part of the energy stored in the capacitor. A particle burn-off reaction can be started from the at least one sub-volume for a large volume of exhaust-gas purification components. Exhaust-gas purification components in an exhaust system of an internal combustion engine can thus be completely regenerated in an energy-efficient manner. A vehicle having the exhaust-gas treatment device and carrying out the method is also provided.
US09518490B2
An exhaust gas processing device for an engine, capable of securely warming a combustion catalyst, is provided. A combustion catalyst burning gas is produced when a warming end condition for the combustion catalyst is established, which signifies the establishment of either one of a first condition or a second condition. In the first condition, an inlet temperature of a combustion catalyst is equal to or higher than an activation requirement temperature of the combustion catalyst, and further, an outlet temperature of the combustion catalyst is equal to or higher than an activation confirmation temperature of the combustion catalyst in excess of the inlet temperature of the combustion catalyst. In the second condition, the outlet temperature of the combustion catalyst exceeds a warming confirmation temperature of the combustion catalyst that is set to be higher as an engine speed is lower, for a predetermined period of time.
US09518488B2
An ammonia storage cartridge includes an ammonia storage member having a storage material capable of absorbing or adsorbing ammonia. The storage member extends along a longitudinal axis. A heating element heats the storage member, and a hermetic tank houses the storage member. A tubular ammonia circulation element is arranged coaxially to the storage member, and includes a first surface at least partially delimiting, with an element chosen from among the heating element and the hermetic tank, a circulation duct for the fluid ammonia. A second surface is arranged at least partially in contact with the storage member, and at least one orifice passes radially through, allowing the circulation of fluid between the circulation duct and the storage member.
US09518486B2
A method for operating an internal combustion engine involves using an injection valve to post-inject fuel into at least one cylinder of the internal combustion engine in order to help regenerate a particulate filter that is arranged in an exhaust system of the internal combustion engine, downstream of an oxidation catalyst. A closing moment of a discharge valve of a cylinder of the internal combustion engine is advanced when the temperature of the oxidation catalyst is in a first temperature range, and the post-injections are performed when the temperature of the oxidation catalyst is in a second temperature range, an upper limit of the first temperature range having a lower value that an upper limit of the second temperature range.
US09518484B2
A variable displacement pump includes an urging mechanism to urge a cam ring in an eccentric direction and to increase the urging force when an eccentricity is decreased, a first control chamber to apply a force to the cam ring in a direction decreasing the eccentricity, and a second control chamber to apply a force, to the cam ring, in a direction increasing the eccentricity. The variable displacement pump further includes a thermosensitive mechanism to control the supply and drain of a discharge pressure supplied into the second control chamber, and a control valve to be operated by the discharge pressure and to decrease the pressure in the second control chamber when the discharge pressure increases.
US09518483B2
A cam rocker lever comprises an annular piece with an inner diameter, a cam lobe, a first linear portion, and a second linear portion. The cam lobe is disposed within the inner diameter of the annular piece. The first linear portion extends from a first side of the annular piece, and a second linear portion extends from a second side of the annular piece opposite the first side. The first linear portion is configured to connect to a stem of a valve such that the valve is displaced when the first linear portion is displaced.
US09518482B2
This invention presents a method to improve the volumetric efficiency of a reciprocating internal combustion engine using a common transfer port between the exhaust and intake port. The engine employs a poppet valve as part of the intake and exhaust valve to control the flow from the transfer port into the combustion chamber. Two plate type valves outside of the combustion chamber are located at both ends of the transfer port to control the flow coming from the intake and out the exhaust. The timing for opening and closing of the poppet type valve is regulated to remain open for a longer duration which provides complete evacuation of air in the exhaust stroke. The ejector effect from the exhaust flow through the transfer port draws a vacuum into the cylinder. When the exhaust plate closes, the vacuum diverts the intake into the cylinder.
US09518473B2
A shaft seal insert for the shaft seal of a turbomachine extending along a rotational axis includes:—a rotor part attachable on a shaft of a rotor,—a stator part insertable into a stator receiving area, and—a dry gas seal having a rotating seal element attached to the rotor part and a fixed seal element attached to the stator part to seal an intermediate space between the two seal elements, which lie opposite each other on a sealing surface extending radially and in the circumferential direction. A labyrinth seal is provided on a high-pressure side in a serial arrangement with the dry gas seal to seal the intermediate space, having a fixed and rotating labyrinth seal parts. The fixed labyrinth seal part is part of the stator part or is fixed thereto. The rotating labyrinth seal part is part of the rotor part or is fixed thereto.
US09518469B2
An internally cooled gas turbine engine component has a line of cooling air discharge holes, an internal cooling channel, an internal feed cavity for feeding cooling air from the channel to the discharge holes, and flow disrupting pedestals arranged in rows. A method of configuring the component includes: determining angles α and β of the directions of cooling air flow into the first and Nth rows, respectively; defining a change in angle φ of the direction of cooling air flow between rows as φ=(β−α)/N; and positioning the pedestals such that a line extending forward from the center of each pedestal in the ith row at an angle {α+φ(i−1)} intersects the (i−1)th row at a location which is midway between two neighboring pedestals of the (i−1)th row, i being an integer from 2 to N.
US09518467B2
A blade for a turbomachine impeller including an airfoil, and a platform extending at one of the ends of the airfoil in a direction globally perpendicular to a longitudinal direction of the airfoil, the blade configured, together with other identical blades, to form a ring around a ring axis, with the adjacent blade platforms joining in pairs so as to form an inter-airfoil surface linking the pressure surface of one airfoil to the suction surface of the neighboring airfoil. In this blade, the inter-airfoil surface includes, in an upstream half of the airfoil, a boss located closer to the pressure surface than to the suction surface, and a recessed passage located between the same and the suction surface.
US09518464B2
A quick change type bit/bit holder includes several different structures for holding the item in a bit block without the necessity of a fastener. The bit portion of the bit/bit holder combination includes a ductile steel insert with a polycrystalline diamond coated tungsten carbide bit positioned therein. The ductility of the steel insert acts as a shock absorber to allow the bit to successfully remove concrete as well as asphalt in a road milling machine.
US09518455B2
Disclosed are improved flow control devices and methods of use thereof. One flow control device includes a body arranged within a cavity defined in a housing coupled to a base pipe, the housing defining a perforation and the base pipe defining one or more flow ports aligned with the perforation to allow fluid communication therethrough, and a flow chamber defined within the body and having a longitudinal portion and a radial portion, the radial portion being fluidly coupled to the perforation such that a fluid flowing through the flow chamber is conveyed directly to or from the perforation and the one or more flow ports.
US09518449B1
A method of recovering a liquid hydrocarbon using an injectate includes recovering the liquid hydrocarbon through primary extraction. Physico-chemical data representative of electrostatic interactions between the liquid hydrocarbon and the reservoir rock are measured. At least one additive of the injectate is selected based on the physico-chemical data. The method includes recovering the liquid hydrocarbon from the reservoir rock through secondary extraction using the injectate.
US09518444B2
A valve assembly (2) which is configured to be coupled to a tubing string comprises a housing (8) defining a housing flow path (9) for communicating with the tubing string, and a barrier member (14) located in the housing (8) and configurable between a normally-closed position in which the barrier member (14) restricts access through the housing flow path (9), and an open position in which access is permitted through the housing flow path (9). The valve assembly (2) also comprises a bypass arrangement reconfigurable between an open state in which the bypass arrangement defines a bypass flow path that communicates with the housing flow path (9) on opposite sides of the barrier member (14) to permit fluid to bypass the barrier member and thereby fill the tubing string, and a closed state in which fluid is prevented from bypassing the barrier member to thereby permit pressurization of the tubing string.
US09518430B2
An adjustable fracturing system is provided. In one embodiment, the system includes a fracturing manifold and a fracturing tree. A fluid conduit is coupled between the fracturing manifold and the fracturing tree to enable receipt of fracturing fluid by the fracturing tree from the fracturing manifold. Further, the fluid conduit is an adjustable fluid conduit that allows an operator to vary a dimension of the fluid conduit to facilitate coupling of the fluid conduit between the fracturing manifold and the fracturing tree. Additional systems, devices, and methods are also disclosed.
US09518425B2
A tool caddy assembly to be removably positioned over the top of a folding ladder including a housing having a bottom surface to hold items while the ladder is being used and a bracket to mount the caddy assembly to the ladder. An outer support wall of the bracket extends downwardly sufficiently adjacent the top rung of the ladder to prevent a user from unsafely standing on the top rung of the ladder. A plurality of accessory holders are removably mounted on the top edge of the walls of the housing and/or the bracket.
US09518412B2
A security entry door device for preventing force forward motion entry through and exterior door of a structure. The door security device includes a steel security pole removably anchored to the floor and slidably secured within a retainment bracket anchored to the structural wall header above the door opening. A parallel door engagement push bar adjustably extends against the pole brace to engage the door vertically along its length, securing the door and preventing unauthorized access to the structure by impeding, dissipating, and transferring forward motion force.
US09518402B1
An anchoring system to secure a mounting plate at a base of a pole or column to a concrete foundation includes a plurality of base plates. Each base plate has a planar surface, center-point, and plurality of fastener openings spaced about the center-point. A plurality of concrete anchoring fasteners having a common cross-sectional diameter secures each base plate to the foundation. An attachment bolt at the center-point of each base plate extends perpendicular to the planar surface for securing through an attachment bolt opening inside a peripheral edge of the mounting plate. The anchoring fasteners for securing the base plates to the foundation are spaced apart no less than ten times the common cross-sectional diameter.
US09518400B2
A device and method is provided for removing water that has accumulated on a swimming pool cover in the form of a directed stream or spray from a swimming pool cover pump having an integral water ejection spout. The water ejection spout has tubing extending from the pump housing, and a nozzle coupled to the tubing for expelling the pumped water. The water ejection spout is configured to discharge the pumped water in a directed stream or spray upwardly, outwardly and away from the swimming pool cover pump and thus the swimming pool cover. In one form, the swimming pool cover pump with integral water ejection spout includes another water outlet configured to receive a garden hose. Piping and a valve allows user selection of the desired water outlet—namely, either the water ejection spout or the garden hose water outlet.
US09518390B1
A self propelled blower cleans debris from a gutter and has a housing with rear inlet and front outlet, an electrically powered air mover for moving air into the inlet and blowing it out of the outlet, a guide track laying along a channel of the gutter, an electrically powered housing mover engaged to the track for moving the housing along the guide track and a power circuit electrically connected to the air and housing movers for powering them at the same time to blow air forwardly along the gutter as the housing moves forwardly along the gutter.
US09518388B1
Construction method for producing beam and slab made of compound concrete containing demolished concrete blocks, comprises that a conventional profiled rebars are made to upper and lower L-shaped stirrups, wherein lower profiled rebar mesh are fixed up firstly, in which coarsely-crushed concrete blocks or segments are placed, then upper profiled rebar mesh are assembled on it together to form a rebar cage, and fresh concrete is poured into the mould fully. A connection portion between the upper and lower L-shaped stirrups is located around ⅓ heights of the lower L-shaped stirrup. A cold rolled rebar mesh is applied to a top rebar mesh of slab; when the bottom rebars of the slab are assembled, coarsely-crushed concrete blocks will be dosed, then the cold rolled rebar mesh will be lifted above the coarsely-crushed concrete blocks for mounting. Finally, fresh concrete is poured into the rebar cage for producing abeam and a space between top rebar mesh and bottom rebars for producing a slab.
US09518387B2
A modular wall assembly includes a frame assembly that includes at least one vertical frame member and at least one horizontal frame member, wherein the frame assembly is configured to define a door opening, a door member slidably operable between a closed position, wherein the door member is at least partially located within the door opening, and an open position, wherein the door member is at least partially removed from with the door opening to allow ingress and egress through the door opening, and a support assembly that includes a sliding support member that slidably supports the door member between the open and closed positions, and at least one mounting arrangement coupling the sliding support member, wherein the at least one mounting arrangement allows vertical adjustment of the sliding support member with respect to the frame assembly.
US09518386B2
The invention relates to a metallic frame structure of a container-like, modular and mobile housing, an assembly kit for such a housing, a container-like, modular and mobile housing, as well as a hollow profile for such a housing. The hollow profile which is designed as a floor main profile (1), roof main profile (2) and/or support profile (3) for the metallic frame structure, has a longitudinal structure (71, 72, . . . ) extending along the longitudinal direction of the profile and originating from an outer profile surface. The longitudinal structure is formed as a longitudinal elevation or longitudinal groove and has a width at its attachment to the profile outer surface of less than 20, 15 or 10 millimeters in the direction transverse to the longitudinal direction of the profile.
US09518382B2
A widespread faucet assembly may include one or more valve assemblies and a delivery spout. The anchors for the valve assemblies and delivery spout may be positioned within a mounting deck, and the valve assemblies and the delivery spout are releasably connected to the respective anchors to minimize installation tasks below the mounting deck.
US09518377B2
The present invention controls a proportional control valve controlling the maximum flow of the flow pump to perform controlling the maximum flow of the hydraulic oil pump after checking whether the pump joint control is normal, receiving a flow value of the flow pump controlled by the proportional control valve, checking an error when the flow value received during a control of the maximum flow has an error, and assigning a weight value to the checked error to compensate for the flow value. Therefore, the present invention may decrease a number of an engine revolution speed and lower a driving fuel consumption and reduce a driving noise.
US09518376B1
Systems and methods for reporting a position of an air-over-hydraulic road treatment element use pneumatically activated switches triggered by pilot air for moving the road treatment element. Switch activation electrical signals are used to determine whether the road treatment element is in an engaged configuration or a disengaged configuration. If the switch activation electrical signals indicate the engaged configuration, an engaged configuration electric signal can be maintained until the switch activation electrical signals indicate the disengaged configuration. Conversely, if the switch activation electrical signals indicate the disengaged configuration, a disengaged configuration electric signal can be maintained until the switch activation electrical signals indicate the engaged configuration. The engaged configuration electric signal can be maintained even after cessation of the switch activation electrical signals indicating the engaged configuration, and similarly the disengaged configuration electric signal can be maintained even after cessation of the switch activation electrical signals indicating the disengaged configuration.
US09518375B2
A turning working vehicle is provided with a monitor arrangement structure where a driver's seat is arranged on an operation part disposed on a turning body, and a working part manipulation lever which manipulates a working part and a monitor which displays various information are disposed on either one of left and right sides of the driver's seat. The monitor is arranged in an upright state outside and in front of the working part manipulation lever, and a display screen of the monitor is directed toward a viewpoint side of an operator seated on the driver's seat and performing manipulation while viewing a front side. An outer manipulation lever is arranged in an upright state behind the monitor thus allowing the operator to view the display screen of the monitor between the outer manipulation lever and the working part manipulation lever within a field of vision of the operator.
US09518369B2
A housing for covering equipment located underground may include a body having a top, a bottom and a pipe aperture. The body may include at least two knockouts formed in the pipe aperture. The knockouts may be configured to be individually and selectively removed from the pipe aperture to adjust a height of the pipe aperture relative to the bottom of the body. In addition, a lid may be configured to be mounted to the body, and the lid is movable between an unlocked position and a locked position.
US09518366B2
An erosion control mat provides a plurality of concrete blocks. Each block has an upper portion with a plurality of upper inclined side walls. Each block has a lower portion with a plurality of inclined lower side walls. The block has an upper surface and a lower surface and a block periphery in the form of an edge where the upper and lower side walls meet. Cables or ropes connect the blocks together to form a block matrix and the erosion control mat. Each block has a boot affixed to the block lower portion, the boot having a plurality of inclined side panels. Each boot side panel has an upper edge. The boot has a lower panel, a boot interior surface and an interior that is receptive of at least part of the block lower portion. The boot inclined side panels engage the block inclined lower side walls. The boot lower panel engages the block lower surface. A plurality of anchor posts are attached to the interior surface of the boot. Some of the anchor posts are attached to the side wall panels to enable a connection to be formed between the boot inclined side panels and the block inclined lower side walls. Some of the anchor posts are attached to the lower panel of the boot to enable a connection to be formed between the boot lower panel and the block lower surface. As part of the method, the boot is first placed in a mould. Slurried concrete is then added to the mould so that a connection is formed between the boot anchor posts and the concrete when the concrete sets after a time period.
US09518364B2
A wet laid sheet material formed from a fibrous web, characterized in that the initial fibrous web contains >50% a calculated dry microfibrillated material composition by weight of the total fiber material content in the web, wherein the fibrillated material composition has a SR value of >70; and in that the moisture content in the sheet material is >30 wt.-%.
US09518359B2
The invention provides a doctor blade holder system that includes a doctor blade support structure, an adjustment profiling plate, and a series of adjustment mechanisms. The doctor blade support structure includes an elongated slot for receiving a doctor blade and a separate elongated slot to house mounting hardware. The adjustable profiling plate causes pressure to be applied to the working blade in a continuous manner along the length of the working blade, wherein the profiling plate is mounted to a holder mounting plate with a series of pairs of mounting structures allowing unconstrained flexure, or rotation, of the profiling plate with respect to holder mounting plate around two axes. The series of adjustment mechanisms attach to the holder mounting plate and acting on the profiling plate, wherein the adjustment mechanisms are capable of displacing the profiling plate in a bi-directional manner.
US09518352B2
A unitary balance ring for a washing machine appliance includes a first plurality of ribs and a second plurality of ribs positioned within a tubular body of the unitary balance ring. Each rib of the first plurality of ribs has a bottom edge that is positioned at a bottom surface of the interior volume, and each rib of the second plurality of ribs has a bottom edge that is spaced apart from the bottom surface of the interior volume.
US09518351B2
Systems and methods for predicting and preventing a cabinet strike event in a washing machine appliance are provided. An exemplary method includes ramping a target speed of a motor from a first speed to a second speed over a ramping period. The method includes computing an average deviation of an observed speed of the motor from the target speed over the ramping period. The method includes computing an average power consumption by the motor over the ramping period. The method includes determining whether both the average deviation is greater than a first threshold value and the average power consumption is greater than a second threshold value. The method includes rebalancing the load if both the average deviation is greater than a first threshold value and the average power consumption is greater than a second threshold value. The method includes performing one or more standard operations if both conditions are not satisfied.
US09518350B2
Devices and methods to adjust the operation of a washing machine based on system modeling include a motor, a control board, a heater, a number of sensors, and an electronic controller. The controller receives a selected wash cycle program and determines an operating condition of the selected wash cycle program, using data from the sensors. The motor may be used as a sensor. Based on the operating condition, the controller predicts an operational parameter of the washing machine using a system model. The controller may adjust the wash cycle program to keep the operational parameter in bounds or increase efficiency. The operational parameter may be temperature, electrical current consumption, wash efficiency, or energy consumption. The wash cycle program may be adjusted by modifying the duty cycle of the motor or the heater. The system model may be recalibrated upon use to adapt to the particular characteristics of the washing machine.
US09518348B2
A presser foot has a rod pin and is received by an engagement groove provided with a presser holder. By measuring the resistance value of the rod pin, the rod pin is identified. Terminals are provided with the engagement groove, which contact the rod pin for measuring the resistance. The terminals are connected to a circuit that connects to a circuit of a presser bar. A receiving groove is formed at the presser holder, an inserting part is formed at the lower end of the presser bar, and the presser holder is connected to the presser bar by setting the inserting part in the receiving groove and fixing it. The terminals and the circuit are provided with the inserting part connecting to the electrical resistance measuring apparatus where the resistance of the rod pin is measured, then determination apparatus identifies the rod pin and a display informs the result.
US09518347B2
A method implemented on a computer having a processor and a memory coupled to the processor for determining an estimated number of stitches for an embroidered design. The method includes uploading a file containing a design comprised of at least one of art and text; flattening the design into a flat file; determining a number of pixels that are non-transparent in the flat file; determining a percentage of non-transparent pixels in a total pixel area available for decorating; estimating a measurement of an area to be decorated using the percentage of non-transparent pixels; and determining the estimated the number of stitches in the design using the measurement of the area to be decorated.
US09518345B2
In a process for producing a spinnable silica sol material, a viscosity value VS is stipulated which the spinnable silica sol material should have after ripening. A viscosity value VR corresponding to VS which the silica sol material has before ripening is ascertained. An aqueous acid solution and a hydrolysable silicon compound are combined. The combined mixture is evaporated to give a single-phase solution while measuring the viscosity of the mixture and the evaporation process is terminated upon reaching the viscosity value VR. The single-phase solution thus obtained is then ripened to give a silica sol material with the viscosity value VS. The process exhibits reduced waste and more exact reproducibility of the spinning sol properties during the synthesis and an increased space-time yield in the production of biologically degradable and/or resorbable fibers and nonwoven fabrics.
US09518344B1
Provided are a mask, a method for manufacturing a mask, and a method for manufacturing an OLED panel. The method of manufacturing a mask includes: providing a metal plate; defining a first blocking area, a second blocking area and a coating area located between the first blocking area and the second blocking area; reducing a thickness of the coating area; and intervally hollowing the coating area to thereby form skeletons which are intervally disposed and connected between the first blocking area and the second blocking area and hollowing areas which are surrounded by the first blocking area, the second blocking area and the skeletons. Such a process helps improve the production yield.
US09518338B2
A method of producing a large area plate of single crystal diamond from CVD diamond grown on a substrate substantially free of surface defects by chemical vapor deposition (CVD). The homoepitaxial CVD grown diamond and the substrate are severed transverse to the surface of the substrate on which diamond growth took place to produce the large area plate of single crystal CVD diamond.
US09518337B2
A high-quality nitride crystal can be produced efficiently by charging a nitride crystal starting material that contains tertiary particles having a maximum diameter of from 1 to 120 mm and formed through aggregation of secondary particles having a maximum diameter of from 100 to 1000 μm, in the starting material charging region of a reactor, followed by crystal growth in the presence of a solvent in a supercritical state and/or a subcritical state in the reactor, wherein the nitride crystal starting material is charged in the starting material charging region in a bulk density of from 0.7 to 4.5 g/cm3 for the intended crystal growth.
US09518320B2
A copper alloy sputtering target is made of a copper alloy having a composition containing Ca in a range of 0.3 mass % to 1.7 mass % with a remainder of Cu and inevitable impurities, a Ca-segregated phase (10) in which Ca is segregated is dispersed in a matrix phase, and the Ca-segregated phase contains a Cu-dispersed phase (11) made of Cu.
US09518316B2
A motor vehicle component, in particular body component, is disclosed in which a steel sheet has a corrosion protection coating arranged thereon. The steel sheet has a core with more than 90% of Martensite and an exterior zone with less than 90% Martensite. The corrosion protection coating is arranged on the exterior zone. A depth of this exterior zone amounts to at least 5 μm and/or at least 0.5% of a wall thickness of the steel sheet.
US09518313B2
A high strength, high toughness steel alloy is disclosed. The alloy has the following weight percent composition. Element C0.30-0.47 Mn0.8-1.3 Si1.5-2.5 Cr1.5-2.5 Ni3.0-5.0 Mo + ½ W0.7-0.9 Cu0.70-0.90 Co 0.01 max. V + ( 5/9) × Nb0.10-0.25 Ti0.005 max. Al0.015 max. FeBalance Included in the balance are the usual impurities found in commercial grades of steel alloys produced for similar use and properties including not more than about 0.01% phosphorus and not more than about 0.001% sulfur. Also disclosed is a hardened and tempered article that has very high strength and fracture toughness. The article is formed from the alloy having the broad weight percent composition set forth above. The alloy article according to this aspect of the invention is further characterized by being tempered at a temperature of about 500° F. to 600° F.
US09518312B2
A Al—Mg—Si-based, casting aluminum alloy comprising by mass 4-6% of Mg, 3.1-4.5% of Si, 0.5-1% of Mn, 0.1-0.3% of Cr, and 0.1-0.4% of Cu, the balance being Al and inevitable impurities.
US09518311B2
A nickel-base superalloy for single crystal casting of components exhibiting excellent creep and rupture properties at high temperature and stresses, and which exhibits excellent phase stability contains 5.60% to 5.80% by weight of aluminum; 9.4% to 9.8% by weight of cobalt; 3.2% to 3.9% by weight of chromium; 7.8% to 8.5% by weight of tantalum; 5.3% to 5.7% by weight of tungsten; 0.50% to 0.70% by weight of molybdenum; 4.3% to 4.9% by weight of rhenium; 0.75% to 0.90% by weight of titanium; 0.08% to 0.15% by weight of hafnium; less than 1.1% by weight of tramp elements other than aluminum, cobalt, chromium, tantalum, tungsten, molybdenum, rhenium, titanium and nickel; and balance nickel.
US09518304B2
Compositions and methods are provided for enhanced production of ethanol from fermentation of tobacco biomass. Nicotine resistant microorganisms are provided, as well as methods for making these nicotine resistant microorganisms. A biologically pure culture is provided of a nicotine resistant Saccharomyces cerevisiae strain or a mutant thereof having all the identifying characteristics thereof. Methods are provided for producing ethanol from fermentation of tobacco biomass in which the nicotine resistant microorganisms are used in the fermentation of the tobacco biomass, wherein a higher amount of ethanol can be produced from the fermentation. The nicotine resistant yeast strains of the present disclosure can improve ethanol production in tobacco biomass extract fermentations and shorten the fermentation time.
US09518303B2
Certain embodiments of the invention include, but are not limited to PCR primer pairs, sequencing primers, and/or associated thermocycling protocols targeting a region identified by the inventors within the 5′ untranslated region of enteroviruses for the purpose of identifying, subtyping, and/or classifying of virus in samples using nucleic acid sequencing. The sequencing procedures can use nucleic acid templates, such as cDNA or PCR amplicons, as a template for sequencing in medium to high throughput format that is cost effective and easily deployed to other clinical microbiology laboratories.
US09518299B2
Disclosed herein are apparatuses and methods for conducting multiple simultaneous micro-volume chemical and biochemical reactions in an array format. In one embodiment, the format comprises an array of microholes in a substrate. Besides serving as an ordered array of sample chambers allowing the performance of multiple parallel reactions, the arrays can be used for reagent storage and transfer, library display, reagent synthesis, assembly of multiple identical reactions, dilution and desalting. Use of the arrays facilitates optical analysis of reactions, and allows optical analysis to be conducted in real time. Included within the invention are kits comprising a microhole apparatus and a reaction component of the method(s) to be carried out in the apparatus.
US09518295B2
The present invention provides a high-throughput sequencing method for methylated DNA, and use thereof. Particularly, the present invention provides a high-throughput sequencing method for methylated DNA, which combines methylated DNA immunoprecipitation, removal of repetitive sequences, and bisulfite treatment. The site of sequencing library will be decreased, and the cost will be reduced by using the method disclosed in the present invention.
US09518286B2
The invention relates to a method for assaying plasminogen in a sample comprising a step consisting in particular of reacting a streptokinase (R1), and a streptokinase activator, with a control solution or a diluted plasma sample, in which the streptokinase activator is selected from the group comprising a fibrin DD fragment and/or at least one DD fragment derivative.The invention also relates to a liquid composition, a plasminogen assay kit for implementing this method and the use of a streptokinase activator selected from the group comprising a fibrin DD fragment and/or at least one DD fragment derivative.
US09518280B2
This invention relates to polypeptides having aldolase activity, including pyruvate activity such as, without limitation, HMG and/or KHG aldolase activity, polynucleotides encoding these polypeptides, and methods of making and using these polynucleotides and polypeptides. In some embodiments, the invention is directed to polypeptides having aldolase activity, including pyruvate activity such as, without limitation, HMG and/or KHG aldolase activity, including thermostable and thermotolerant activity, and polynucleotides encoding these enzymes, and making and using these polynucleotides and polypeptides. The polypeptides in accordance with the invention can be used in a variety of pharmaceutical, agricultural and industrial contexts. In some embodiments, the invention provides polypeptides and biosynthetic pathways that are useful in the production of R-2-hydroxy 2-(indol-3ylmethyl)-4-keto glutaric acid (R-MP) and certain stereoisomers of monatin, such as R,R and S,R monatin, and salts thereof, as well as certain stereoisomers of monatin derivatives, such as the R,R and S,R configurations, and salts thereof.
US09518274B2
A process for producing bioethanol includes the steps of pretreatment (consisting in destructuring the lignocellulosic vegetable raw material by placing it in the presence of a mixture containing formic acid, acetic acid and water, then in separating cellulose), of enzymatic hydrolysis and of alcoholic fermentation, characterized in that it includes, prior to the enzymatic hydrolysis, a step of partial elimination of the lignins so as to obtain a residual overall level of lignins (T), expressed as percentage by weight, which is non-zero and which is included in a range determined by a lower limit, and an upper limit Bsup, respectively equal to 0.30% and 4%. In order to obtain conditions of acidification before the enzymatic hydrolysis step, the process includes a step for re-acidification of the mixture, which is carried out with an acid, or of a mixture of acids, of determined pKa, and preferably with weak organic.
US09518273B2
The present disclosure generally relates to microorganisms that comprise one or more polynucleotides coding for enzymes in one or more pathways that catalyze a conversion of a fermentable carbon source to butadiene. Also provided are methods of using the microorganisms in industrial processes including, for use in the production of butadiene and products derived therefrom.
US09518271B2
A method of directing evolution of a target polynucleotide of interest for obtaining variants of this target polynucleotide, a method to generate genetic variability by preparing a cell library, and a method to isolate or to screen variants of a polynucleotide or variants of a protein able to impact the phenotype of a cell or to confer a desired phenotype to target cells, and to identify theses polynucleotide variants or protein variants responsible for this phenotype are described.
US09518266B2
The present invention provides polynucleotides and related polypeptides of the ZmARGOS gene family. The invention provides genomic sequence for the ZmARGOS genes. ZmARGOS is responsible for controlling plant growth, organ size and yield in crop plants.
US09518264B2
The invention relates to antisense oligonucleotidic sequences (ODN) against Smad7 suitably modified, and their uses in medical field as therapeutic biological agents, in particular in the treatment of chronic inflammatory bowel disease, such as Crohn's disease and ulcerative colitis.
US09518261B2
Disclosed herein are methods and compounds for inhibiting gene expression by inhibiting enhancer RNAs (eRNAs). Such methods and compounds are useful for reducing expression of certain genes, many of which are associated with a variety of diseases and disorders.
US09518259B2
Provided herein are antisense compounds and methods for recruiting one or more non-cleaving protein to a target nucleic acid in a cell. In certain instances such recruitment of a non-cleaving protein alters the function or activity of the target nucleic acid. In certain such instances, the target nucleic acid a pre-mRNA and the recruitment of the non-cleaving protein results in a change in splicing of the pre-mRNA.
US09518248B2
An optofluidic photobioreactor including an optical waveguide having an input, characterized by an evanescent optical field confined along an outer surface of the optical waveguide produced by radiation propagating in the optical waveguide, means for inputting light to the input of the optical waveguide, and a selected photosynthetic microorganism disposed substantially within the evanescent field. A method for optically exciting a photosynthetic microorganism for generating a biofuel, a biofuel precursor, or a biomass from the optically-excited photosynthetic microorganism involves irradiating the photosynthetic microorganism attached to the surface of the waveguide with an evanescent optical field from optical radiation propagating in the optical waveguide, and driving photosynthesis in the microorganism by the evanescent optical field.
US09518247B2
The present composition relates to fabric care compositions comprising an organosiloxane polymer. Methods of using such compositions including contacting a fabric with the composition and rinsing the fabric are also disclosed.
US09518244B2
A lubricant composition is disclosed. The lubricant composition is made up of (a) an API Group III base stock; (b) one or more semi-crystalline viscosity modifier; and (c) one or more LOFIs having a side-chain distribution which satisfies the following requirements: (1) the distribution contains side chains ranging from C8 to C18 with an average carbon number ranging from 12.4 to 14.4; (2) the side chain distribution is bi-modal with a lower portion of the bi-modal distribution made up primarily of C12 and an upper portion of the distribution made up primarily of C16, C18 or combinations thereof; (3) the total mole % of the upper portion of the distribution must be less than that of the lower portion of the distribution; and (4) the amount of C12 on the side chain must be at least 40 mole % of the total side chain distribution.
US09518233B2
The present invention relates to a bifunctional catalyst for a hydrodewaxing process with improved isomerization selectivity, and to a method for manufacturing the same, and more particularly to a bifunctional catalyst and to a method for manufacturing same, which is characterized in that EU-2 zeolite with a controlled degree of phase transformation is used as a catalyst support having an acid site. The EU-2 zeolite, the degree of phase transformation of which is controlled, includes, by controlling synthesis parameters of EU-2, predetermined amounts of materials that are phase-transformed from EU-2 crystals such as cristobalite and quartz. The metal loaded bifunctional catalyst according to the present invention improves selectivity of the isomerization process, rather than a cracking reaction, during a hydroisomerization reaction of n-hexadecane. Therefore, the bifunctional catalyst can be widely used as a catalyst for a dewaxing process such as lubricant base oil and diesel oil.
US09518231B2
The present invention relates to demulsifying and dehydrating formulations of heavy crude oil based block copolymers amine bifunctionalized with low polydispersities. These formulations can contain solvents whose boiling point is in the range from 35 to 200° C., preferably: dichloromethane, chloroform, toluene, xylenes, turbosine, naphtha or mixtures thereof.
US09518225B2
Disclosed are the use of fluorine substituted olefins, including tetra- and penta-fluoropropenes, in a variety of applications, including in methods of depositing catalyst on a solid support, methods of sterilizing articles, cleaning methods and compositions, methods of applying medicaments, fire extinguishing/suppression compositions and methods, flavor formulations, fragrance formulations and inflating agents.
US09518213B2
A nano-dispersion well servicing fluid is disclosed. The well servicing fluid is formulated with components comprising: nanoparticles comprising at least one material chosen from aluminum oxides, aluminum hydroxides, aluminum hydroxyoxides, zirconium oxides, zirconium hydroxides, zirconium hydroxyoxides, wherein the concentration of nanoparticles is greater than 0.5% by weight based on the total weight of the nano-dispersion well servicing fluid. The well servicing fluid also comprises an aqueous base continuous phase. Methods of employing the nano-dispersion to service a wellbore are also disclosed.
US09518210B2
A method of servicing a wellbore in a subterranean formation comprising placing a first stream comprising a dilute solution of a metal acrylate into a lost circulation zone in the subterranean formation; placing a second stream comprising an activator into the lost circulation zone; and forming a lost circulation material upon contacting of the metal acrylate and the activator, wherein the lost circulation material forms in from about 0 to about 60 minutes. A method of servicing a wellbore in a subterranean formation comprising placing a composition comprising a dilute solution of a cross-linkable material and an encapsulated activator into a lost circulation zone in the subterranean formation; and allowing the composition to set.
US09518177B2
The present invention relates to a composite material for a transport, including a polypropylene resin and a carbon long fiber, and more particularly, to a fiber reinforced composite material composition for a transport including 40-90 wt % of a polypropylene resin, 5-60 wt % of a carbon long fiber having a fiber diameter of 1-50 μm and a weight average fiber length of 20-150 mm, and 0.3-10 wt % of a compatibilizer. The compatibilizer includes one selected from the group consisting of an ionomer, a copolymer of propylene-polar monomer, a modification water added polymer and combinations thereof. The composite material has improved interface properties between the polypropylene resin and the carbon long fiber owing to a specific compatibilizer, improved rigidity, impact resistance and heat resistance, and may be applied to various fields requiring the fiber reinforced composite material as well as various transports including an automobile.
US09518175B2
A flame-retardant thermoplastic elastomer composition is provided to produce a molded article possessing mechanical properties, flame retardancy and softness inherently possessed by a molted article obtained from a thermoplastic elastomer composition containing a mineral oil-based softening agent and a flame retardant and fails to stain a mold after injection molding. A production method includes step (1) obtaining a thermoplastic elastomer composition by dynamically crosslinking a polymer mixture (A) containing an ethylene-α-olefin-based copolymer rubber (A1) and a propylene-based polymer (A2) in the presence of a mineral oil-based softening agent (C) and a crosslinking agent (D), and step (2) kneading the thermoplastic elastomer composition, a halogen-free flame retardant (E), zinc oxide (F), and a thermoplastic resin with a polar group (G). The amounts of the components satisfy condition (p) when starting the dynamic crosslinking in step (1) and satisfy condition (q) when starting the kneading in step (2), respectively.
US09518173B2
The present invention provides a tire rubber composition that makes it possible to suppress discoloration of tires, and a pneumatic tire formed from the rubber composition. The present invention relates to a tire rubber composition containing a bluing agent.
US09518164B2
A method for recycling vulcanized rubber provided the use of a reactor and a glycerol and hydrochloric acid solution. A quantity of vulcanized rubber is reduced in size, and submerged into a reactor containing the glycerol and hydrochloric acid solution. The quantity of vulcanized rubber is simultaneously heated and agitated to chemically break sulfide bonds within the quantity of vulcanized rubber. A solid residue, byproduct of the reaction, is separated from the quantity of vulcanized rubber, glycerol, and hydrochloric acid mixture. After separation, an additional quantity of hydrochloric acid is added into the aforementioned mixture to wash the mixture and further the reaction to an optimal yield. The quantity of vulcanized rubber, glycerol and hydrochloric acid mixture is reheated and agitated to produce a full quantity of de-vulcanized rubber. The full quantity of de-vulcanized rubber is recovered through a solid-liquid separation process.
US09518162B2
The invention provides a process of making a continuous freeform thermoplastic dielectric film (25) that is evenly loaded with dispersed nanoparticles comprising the steps of; feeding thermoplastic granules (21) into an extruder (23), injecting a secondary feed (27) comprising a suspension of nanoparticles in a liquid carrier to create a nanocomposite, and extruding said composite onto cooled rollers (26) at a preset rate thereby enabling the crystalline structure of the nanocomposite film (25) to be controlled wherein the secondary feed (27) is mixed continuously by an ultrasonicator (29) whilst being injected into the extruder (23). By selecting the size of the nano particles based on their de Broglie wavelength in the crystalline polymer the dielectric can be produced in bulk to make high capacitance high energy density storage capacitors
US09518156B2
A method includes heating a sulfonated polyester resin in an organic-free solvent, adding a solution of silver (I) ion to the heated resin in water to form a mixture, reducing silver (I) to silver (0) by heating the mixture from about 65° C. to about 90° C., thereby forming an emulsion of composite particles comprising a sulfonated polyester matrix and a plurality of silver nanoparticles disposed within the sulfonated polyester matrix, and allowing the silver nanoparticles to agglomerate into a silver nanodendrite structure.
US09518155B2
The present invention relates to a composition for solubilizing a fluoropolymer, comprising a solvent blend of a) compound of formula (I) R1—C(═O)—NR2R3 wherein R1 and R2 and R3 are defined as in the specification and b) dimethylsulfoxide (DMSO). The invention also relates to the process for the preparation of the composition and its uses. The invention is also the use of the fluoropolymer composition for coating applications.
US09518141B2
A resol-type para-octylphenol-formaldehyde co-condensation resin and a method for producing the same are provided, the resol-type para-octylphenol-formaldehyde co-condensation resin having a content of a para-octylphenol monomer of 1 wt. % or less, having a total content of an aliphatic hydrocarbon, a halogenated aliphatic hydrocarbon, an aromatic hydrocarbon, a halogenated aromatic hydrocarbon, and an alcohol having 1 to 8 carbon atoms of 1 wt. % or less, the aliphatic hydrocarbon, the halogenated aliphatic hydrocarbon, the aromatic hydrocarbon, the halogenated aromatic hydrocarbon, and the alcohol having a boiling point of 60° C. or more, having a softening point of 70 to 105° C., and having an acid value of 20 to 28 KOHmg/g. The resol-type para-octylphenol-formaldehyde co-condensation resin can be used as a resin cross-linking agent for a rubber.
US09518139B2
This invention relates to a rubbery or elastomeric polymer material taking up more than 5% by weight of water and at most 500% by weight of water after immersion in demineralized water at room temperature for a sufficient time to reach saturation, comprising: (a) repeating units from one or more hydrophobic organic monomers, and (b) repeating units from one or more monomers (a) being modified with one or more hydrophilic side groups. The rubbery or elastomeric polymer material may be in the form of a sheet, a foam, a coating adapted for adhesion to a substrate, or a fiber. This invention also relates to processes, polymerizable compositions, and foaming compositions for producing such rubbery or elastomeric polymer materials.
US09518123B2
The present invention provides compositions and methods for treating cancer in a human. The invention includes relates to administering a genetically modified T cell to express a CAR wherein the CAR comprises an antigen binding domain, a transmembrane domain, a costimulatory signaling region, and a CD3 zeta signaling domain.
US09518115B2
Disclosed are humanized RFB4 antibodies or antigen-binding fragments thereof. therapy of B-cell associated diseases, such as B-cell malignancies, autoimmune disease and immune dysfunction disease. Preferably, hRFB4 comprises the light and heavy chain RFB4 CDR sequences with human antibody FR and constant region sequences, along with heavy chain framework region (FR) amino acid residues Q1, F27, V48, A49, F68, R98, T117 and light chain residues L4, S22, K39, G100, V104, and K107. More preferably, the heavy and light chain variable region sequences of hRFB4 comprise SEQ ID NO:7 and SEQ ID NO:8, respectively. In certain embodiments, trogocytosis (antigen shaving) induced by hRFB4 plays a significant role in determining antibody efficacy and disease responsiveness for treatment of B-cell diseases, such as hematopoietic cancers, immune system dysfunction and/or autoimmune disease.
US09518111B2
The present invention relates to pharmaceutical compositions comprising a p75 tumor necrosis factor receptor/Ig fusion protein.
US09518109B2
The invention relates to generation and use of cellular and humoral responses for the prevention and treatment of P. gingivalis related conditions and diseases.
US09518103B2
Provided herein are variants of an archaerhodopsin useful for application such as optical measurement of membrane potential. The present invention also relates to polynucleotides encoding the variants; nucleic acid constructs, vectors, cells comprising the polynucleotides, and cells comprising the polypeptides; and methods of using the variants.
US09518099B1
Disclosed are a folded chlorotoxin, a chlorotoxin variant and a folded chlorotoxin variant and their preparation technology. The folded chlorotoxin has a peptide sequence of MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2, and the folded chlorotoxin variant has a peptide sequence of MCMPCFTTDHQMARSCDDCCGGSGRGSCYGPQCLCR-NH2 and is formed by replacing serine (Ser, S) by lysine (Lys, K) in the peptide sequence of chlorotoxin. The chlorotoxin and its derivatives have potential application values in biological and medical fields and good economic and social benefits to life, health, and personalized healthcare.
US09518098B2
The present invention relates to substances and compositions thereof useful in the control of cancer stem cell persistence and concomitant tumor recurrence and/or control of tumor growth. In particular, the invention relates to substances and compositions useful in the treatment of cancers and/or tumors linked to cancer stem cells, preferably brain cancers and/or tumors, in a subject.
US09518095B2
This invention provides a robust fermentation process for the expression of a capsid protein of a bacteriophage which is forming a VLP by self-assembly, wherein the process is scalable to a commercial production scale and wherein the expression rate of the capsid protein is controlled to obtain improved yield of soluble capsid protein. This is achieved by combining the advantages of fed-batch culture and of lactose induced expression systems with specific process parameters providing improved repression of the promoter during the growth phase and high plasmid retention throughout the process.
US09518092B2
Template-fixed β-hairpin peptidomimetics of the general formula (I) wherein Z is a template-fixed chain of 12, 14 or 18 α-amino acid residues which, depending on their positions in the chain (counted starting from the N-terminal amino acid), are Gly, NMeGly, Pro or Pip, or of certain types which, as the remaining symbols in the above formula, are defined in the description and the claims, and salts thereof, have CXCR4 antagonizing properties These β-hairpin peptidomimetics can be manufactured by a process which is based on a mixed solid- and solution phase synthetic strategy.
US09518088B2
The present invention provides a peptide-phospholipid conjugate of Formula 1: wherein: X is selected from the group consisting of —CR1R2—, —R3—, —O—, —S—, and S+(R3)—; Y is selected from the group consisting of a bond, alkyl, alkenyl, alkynyl, haloalkyl, alkoxyalkyl, hydroxyalkyl, amino, ether, cycloamino, cycloether, aryl heteroaryl, arylalkyl, heteroarylalkyl, hydroxyaryl, arylether, cycloalkyl, heterocycloalkyl, hydroxycycloalkyl, halocycloalkyl, and aminocycloalkyl; Z is a peptide comprising 1 to 50 amino acids; R1 and R2 each independently selected from the group consisting of hydrogen, alkyl, alkenyl, alkynyl, haloalkyl, alkoxyalkyl, hydroxyalkyl, amino, ether, cycloamino, cycloether, aryl, heteroaryl, arylalkyl, heteroarylalkyl, hydroxyaryl, arylether, cycloalkyl, heterocycloalkyl, hydroxycycloalkyl, halocycloalkyl, and aminocycloalkyl; and R3 is selected from the group consisting of alkyl, alkenyl, alkynyl, haloalkyl, alkoxyalkyl, hydroxyalkyl, aminoalkyl, amino, ether, cycloamino, cycloether, aryl, heteroaryl, arylalkyl, heteroarylalkyl, hydroxyaryl, arylether, cycloalkyl, heterocycloalkyl, hydroxycycloalkyl, halocycloalkyl, and aminocycloalkyl.
US09518078B2
Essentially pure compounds of the formulas (I) to (XXV) are provided. Compositions and methods for enhancing or stimulating an immune response are also provided. The compounds, provided are advantageous in that the compounds are essentially pure and free from contaminants encountered when such compounds are purified from natural sources.
US09518071B2
A method (P) for hydrosilylating at least one compound (C), including at least one unsaturation in the presence of an organosilicon compound (O) including at least one hydrogen atom per molecule bonded directly to a silicon atom, and of a catalytic hydrosilylation system including a structured porous material (A) including pores and an inorganic structure consisting of silicon oxide walls, in which metal nanoparticles are contained.
US09518070B2
A method of making hydrosilanes having a formula R1R2R3SiH by reacting a compound having formula I: in solution using a strong Lewis acid. This way, e.g., alkenes or carbonyl compounds can be hydrosilylated in good yields using the cyclohexa-2,5-dien-1-yl-silanes of general formula I as transfer hydrosilylating agents in the presence of a strong Lewis acid as catalyst with concomitant formation of an arene solvent.
US09518061B2
Provided is a compound capable of effectively control worst weeds of higher leaf stages that present practical problems. A specific pyrazolylpyrazole derivative of formula (1) is disclosed that is able to solve the above-mentioned problems.
US09518052B2
A compound having the structure: or a pharmaceutically acceptable salt or solvate thereof, wherein A and A′ are C or N, where C may be substituted by halo or C1-C6 alkyl; R and R0 are selected from the group consisting of H, C1-C6 alkyl, —(CH2)n—W, etc., where W is 5- or 6-membered heteroaryl or heterocyclic containing N, S and/or O atoms, —NR″SO2—R′, etc., where R′ and R″ are C1-C6 alkyl, etc.; wherein each alkyl, etc., may be substituted; or, R and R0 and the N atom to which they are bonded together to form a monocyclic or bicyclic heterocyclic ring, etc.; R1 is H, halo or cyano; R2 and R2′ are H, C1-C6 alkyl, etc.; X is a bond, etc.; R3 is H, C1-C4 alkyl, etc.; Y is a bond, —(CH2)m—, etc. The invention also relates to compositions and uses in the treatment of various diseases.
US09518051B2
The patent provides novel compounds with potential anti-malarial activity and process of synthesis thereof. Further, the process for the synthesis of known antimalarial natural products marinoquinazolinone A-F, aplidiopsamine A and their potential antimalarial analogs is disclosed.
US09518048B2
A process for the preparation of teneligliptin.
US09518044B2
The present invention is directed to compounds of Formula IC: wherein the substituents are described herein. These compounds and their pharmaceutically acceptable salts thereof are prostaglandin receptor EP2 antagonists.
US09518042B2
The present invention provides a compound having a cholinergic muscarinic M1 receptor positive allosteric modulator activity and useful as an agent for the prophylaxis or treatment of Alzheimer's disease, schizophrenia, pain, sleep disorder, Parkinson's disease dementia, dementia with Lewy bodies, and the like.The present invention relates to a compound represented by the formula (I) or a salt thereof. wherein each symbol is as described in the specification, or a salt thereof.
US09518036B2
[Problem] To provide a novel technology by which energy efficiency can be further improved in a process for producing ethylene oxide.[Solution] A method for producing ethylene oxide including: an ethylene oxidation reaction step in which ethylene is subjected to catalytic vapor-phase oxidation using a molecular oxygen-containing gas in the presence of a silver catalyst; supplying an ethylene oxide-containing reaction product gas produced in the ethylene oxidation reaction step to an ethylene oxide absorption column; bringing the reaction product gas into contact with an absorption liquid supplied to the ethylene oxide absorption column; supplying an ethylene oxide-containing column bottom liquid of the ethylene oxide absorption column to an ethylene oxide purification system; purifying ethylene oxide in the ethylene oxide purification system; supplying at least a part of a carbon dioxide gas-containing gas discharged from a column top part of the ethylene oxide absorption column to a carbon dioxide gas absorption column; extracting a carbon dioxide gas-rich absorption liquid obtained by contact of the carbon dioxide gas-containing gas with an absorption liquid as a column bottom liquid of the carbon dioxide gas absorption column; supplying the carbon dioxide gas-rich absorption liquid to an upper part of the carbon dioxide gas stripper column; stripping the carbon dioxide gas from the carbon dioxide gas-rich absorption liquid; and discharging the carbon dioxide gas from a column top part of the carbon dioxide gas stripper column as an exhaust gas, the ethylene oxide purification system including an ethylene oxide purification column provided with a reboiler in a lower part thereof, and a heating medium for heating the reboiler being heated by heat exchange with the exhaust gas.
US09518025B2
The present invention relates to a novel process for preparing 3,5-bis(haloalkyl)pyrazole derivatives.
US09518023B2
Lactamium based ionic liquids and methods of making them are described. The ionic liquids comprise at least one of: the reaction product of a lactam compound having a general formula wherein the ring has at least one C≡C double bond, or and a Brønsted acid HX; or a Brønsted acid HX where X is a halide, and a metal halide.
US09518022B2
This invention provides, among other things, tetrahydroisoquinolines useful for treating viral infections, pharmaceutical formulations containing such compounds, as well as methods of inhibiting the replication of a virus, such as HIV, or treating a disease, such as AIDS.
US09518021B2
The present invention is directed to novel processes for the preparation of histamine H3 receptor modulators, in the treatment of for example, cognitive disorders, sleep disorders and/or psychiatric disorders.
US09518011B2
An object of the present invention is to provide a recording material or a recording sheet using, as a color-developing agent, a non-phenol compound that is a safe compound in no danger of corresponding to an endocrine disruptor and is good in color developing performance. The non-phenol compound used in the present invention is at least one selected from the group consisting of compounds represented by the following formulas (I) to (III).
US09518009B2
The present invention provides a compound of the formula (I): wherein: R2 and R3 represent each independently a hydrogen atom or a hydrocarbon group; A represents an s-valent organic group; and s is an integer of 2-10. This nitrileoxide compound has stable and can be easily produced.
US09518008B2
The present invention relates to (1S,2S,3S,4R)-3-[(1S)-1-acetylamino-2-ethyl-butyl]-4-guanidino-2-hydroxy-cyclopentyl-1-carboxylic acid hydrates compounds, preparing methods thereof, pharmaceutical compositions containing said compounds and preparing methods thereof, and the clinical uses of said compounds as neuramidinase inhibitors for anti-influenza.
US09518003B1
Two methods of producing high purity dimethyl carbonate through the reaction of carbon dioxide and methanol are provided. In the ammonia-based method ammonia and carbon dioxide react to produce urea. The urea is mixed with methanol for further reaction to produce dimethyl carbonate. Ammonia released in the process is recycled as a reactant to produce more urea. In the ethylene-oxide process carbon dioxide reacts with ethylene oxide to produce ethylene carbonate. It is then reacted with methanol to produce dimethyl carbonate with ethylene glycol as byproduct. An integrated reactive distillation process using side reactors is used for facilitating catalytic reaction in these two methods for producing high purity dimethyl carbonate. The process is further enhanced by enclosing multiple side reactors into a pressure vessel and incorporating thermal heat pump for recovery and reuse of latent heat within the process.
US09517999B2
A process for producing a grade of (meth)acrylic acid having residual formaldehyde levels of under 100 parts per million.
US09517994B2
The invention provides a compound of formula I: or a salt thereof, wherein R1-R3 have any of the values described in the specification, as well as compositions comprising a compound of formula I. The compounds are useful as antibacterial agents.
US09517993B2
Provided are compounds, compositions and methods for treating Toll-like receptor 1/2 complex (TLRI/2) related inflammatory disorders. Small molecules, based on the benzotropolone scaffold, capable of influencing downstream signaling are disclosed as well as methods of making and modifying these molecules. Also provided are methods for treating a subject for a clinical condition associated with Toll-like receptor complex 1/2 activation, comprising administering to the subject an effective amount of a benzotropolone compound.
US09517992B2
Branched optionally unsaturated ketones particularly useful in providing typical and characteristic orris facets to perfume compositions.
US09517991B2
A process for preparing 2-methylbutanal from the secondary streams obtained in the preparation of mixtures of isomeric α,β-unsaturated decenals, characterized in that a) a mixture comprising linear butenes is reacted in the presence of transition metal compounds of group VIII of the Periodic Table of the Elements with carbon monoxide and hydrogen at elevated temperature and elevated pressure to give a pentanal mixture; b) the pentanal mixture obtained in step a) is converted in the presence of basic compounds to a mixture of isomeric α,β-unsaturated decenals; and c) the mixture obtained in step b) is separated into a stream enriched with unconverted 2-methylbutanal and a stream enriched with a mixture of isomeric α,β-unsaturated decenals; with the proviso that the stream which has been separated off in step c) and is enriched with unconverted 2-methylbutanal is reacted with formaldehyde.
US09517989B2
The present invention relates to novel 2-cycloalkyl resorcinol compounds; to pharmaceutical compositions comprising the compounds; and to methods of preparing the compounds and uses thereof. The disclosed compounds can bind to and modulate the cannabinoid receptors and thus, they are specific ligands for these receptors. The invented compounds, when administered in a therapeutically effective amount to an individual or animal, results in a sufficiently high level of that compound in the individual or animal to cause a physiological response. The physiological response may be useful to treat a number of physiological conditions.
US09517983B2
A process is disclosed for removing contaminants from an olefin stream, comprising passing the contaminated olefin stream through a first adsorbent in a thermal swing adsorption process to produce a relatively pure olefin product stream, and a regenerating gas stream containing the contaminants, passing the contaminated regenerating gas stream through a pressure swing adsorption process to yield a relatively pure regenerating gas stream, which can be redirected to the thermal swing adsorption process for regenerating the adsorbent therein.
US09517980B2
The present invention is an improved process and apparatus for producing para-xylene, particularly with respect to a process that involves the methylation of toluene and/or benzene to selectively produce para-xylene, wherein streams having differing amounts of ethylbenzene are separately treated in the recovery of para-xylene. A first hydrocarbon feed comprising xylenes and ethylbenzene is provided to a first para-xylene adsorption section, and a second hydrocarbon feed comprising xylenes and less EB than the first hydrocarbon feed is provided to a second para-xylene adsorption section. Segregating the feeds with differing ethylbenzene contents increases the overall efficiency of the adsorption of para-xylene by the adsorption units. Efficiency and energy savings may be further improved by subjecting the lower-content ethylbenzene stream to liquid phase isomerization.
US09517977B2
The present invention relates to compounds of the formula (I), to mixtures of the said compounds with emitter compounds, to the use of compounds of the formula (I) and the said mixtures in electronic devices, and to electronic devices containing one or more compounds of the formula (I) and/or mixtures of compounds of the formula (I) with emitter compounds.
US09517969B2
The present invention provides an optical member having a high transmittance, wherein a composition change of a phase-separable base material glass film is suppressed.A method for manufacturing an optical member provided with a porous glass film on the base member includes the steps of forming a glass powder film containing a glass powder on the base member, forming a phase-separable base material glass film on the base member by heating and fusing the glass powder film in an atmosphere having an oxygen concentration of more than 20%, forming a phase-separated glass film on the base member by heating the base material glass film, and forming a porous glass film on the base member by subjecting the phase-separated glass film to an etching treatment.
US09517965B2
The present invention discloses a method for preparing a soda-lime-silica glass basic formulation and a method for producing soda-lime-silica glass, comprising the steps of: pre-desiliconizing silicon-containing powdery industrial waste with a sodium hydroxide solution; introducing carbon dioxide for carbonation decomposition, and filtering to obtain a silicic acid precipitate and a sodium carbonate solution; drying the silicic acid precipitate to obtain silicon dioxide; adding lime milk into the filtered sodium carbonate for causticization, and filtering to obtain a sodium hydroxide solution and a calcium carbonate precipitate; drying the calcium carbonate precipitate; using said silicon dioxide and part of the calcium carbonate and adding sodium oxide. The present invention further discloses a method for extracting aluminum from coal ash for co-production of soda lime glass, which uses silicon dioxide obtained from alkali dissolution and desiliconization of coal ash and calcium carbonate generated from causticization as main raw materials. The method for extracting aluminum from coal ash for co-production of soda lime glass according to the present invention integrates and optimizes a process of extracting aluminum from the coal ash, has a high material and energy utilization rate, good quality of co-product glass, and high added value, and can greatly improve economical efficiency of aluminum extraction of coal ash.
US09517964B2
Provided is a method for producing an optical fiber preform including a dehydration step and a sintering step. In the dehydration step, a porous glass base material is provided to a furnace core tube of a dehydration-sintering furnace, and the porous glass base material is dehydrated using a dehydration agent added with an argon gas. In the sintering step, the porous glass base material dehydrated in the dehydration step is sintered. Further, in the dehydration step, a temperature of the porous glass base material begins to be increased in a condition such that a high heat conductivity gas, having a heat conductivity higher than a heat conductivity of the argon gas, is remaining inside the porous glass base material.
US09517961B2
A glass ribbon has a thickness of 100 μm or less and includes a convex curved surface portion on a side surface. The glass ribbon can be produced by heating a preform glass material having a thickness of 2 mm or less, and subjecting the preform glass material to drawing so that the preform glass material has a thickness of 100 μm or less.
US09517956B2
Systems and methods for generating reactive oxygen species formulations useful in various oxidation applications. Exemplary formulations include singlet oxygen or superoxide and can also contain hydroxyl radicals or hydroperoxy radicals, among others. Formulations can contain other reactive species, including other radicals. Exemplary formulations containing peracids are activated to generate singlet oxygen. Exemplary formulations include those containing a mixture of superoxide and hydrogen peroxide. Exemplary formulations include those in which one or more components of the formulation are generated electrochemically. Formulations of the invention containing reactive oxygen species can be further activated to generate reactive oxygen species using activation chosen from a Fenton or Fenton-like catalyst, ultrasound, ultraviolet radiation or thermal activation. Exemplary applications of the formulations of the invention among others include: cleaning in place applications, water treatment, soil decontamination and flushing of well casings and water distribution pipes.
US09517946B2
A water reclamation system includes a drainage lane overlaying a downward graded area of land and configured to receive water run-off from the land. At least one collection ditch coupled to the at least one drainage lane is configured to receive water from the drainage lane. At least one collection pipe housed is within and extends outwardly from the at least one collection ditch. A first container is coupled to the at least one collection pipe and configured to receive water from the at least one collection pipe. Housed within the first container is at least one water purifying filter and a pump configured to evacuate at least a portion of water within the container to a destination. A second container is in communication with the first container and is configured to: subject water received from the first container to a purification process; and store the purified water.
US09517922B2
An evacuated bottle system including providing a bottle defining a hollow interior, the bottle having a neck defining an opening that provides fluid communication with the interior; providing a cap assembly including a funnel having a first portion and a second portion, where the second portion extends radially outward from the first portion to form a floor on an interior thereof and a shoulder on an exterior thereof, the first portion defining a first bore and the second portion defining a second bore fluidly connected to the first bore; a self serum stopper having a self sealing membrane that extends radially outward to overlie at least a portion of the floor of the funnel; and a cap having a cap wall sized to fit over the funnel and a cover portion extending radially inward from the cap wall, the cover portion defining at least one evacuating opening; assembling the cap assembly with the bottle by inserting the first portion of the funnel into the neck of the bottle; supporting the funnel on the neck of the bottle at the shoulder; inserting the serum stopper within the funnel where the self-sealing membrane covers at least a portion of the floor to seal the first bore of the funnel from the second bore; applying the cap over the funnel and attaching the cap to the bottle, wherein the cover portion extends radially inward over a portion of the self-sealing membrane and defines a gap axially outward of the self-sealing membrane; applying a pressure differential relative to the interior of the bottle to create a suction at the evacuating opening to draw the self-sealing membrane axially outward within the gap a distance effective to provide fluid communication between the first bore of the funnel and the second bore the funnel; maintaining the suction until a selected pressure is achieved within the interior of the bottle; and withdrawing the suction, wherein the selected pressure within the bottle draws the self-sealing membrane against the floor of the funnel to reseal the interior of the bottle.
US09517920B2
The object of the invention is an elevator provided with a guide shoe arrangement, which elevator comprises at least an elevator car, which is configured to travel in the elevator hoistway guided by guide rails, and which elevator comprises at least one guide shoe element, which comprises at least a body part moving along with the elevator car and also a plurality of guide rolls supported on the body part, each of which guide rolls is configured to travel while supported on one guide surface of a guide rail when the elevator car moves. At least one of the aforementioned guide rolls is supported in a manner allowing rotation on a support part that is separate from the other aforementioned guide rolls, which support part is fixed with an openable snap-on fixing means to the aforementioned body part.
US09517912B2
A method for collecting samples in a machine for packaging flat objects, the packaging machine has a counting device and a separation device for forming a succession of batches, and an assembly device for forming a succession of packs. The method of collection includes stages of: forming a sample batch composed of a given number of flat objects with the help of the counting and separation devices, collecting the sample batch by the assembly device, and transferring the sample batch to a dedicated retrieval area with the assembly device.
US09517897B2
The system is provided for repositioning flat-disposed objects that can be arranged in an overlapping manner at a system inlet. The system includes a first and a second lateral deviation conveyor, each having an inlet located downstream the inlet of the system. The system also includes a diverting device creating a first transport circuit ending on the right side of a common receiving zone, and a second transport circuit ending on the left side of the common receiving zone. The system can invert the orientation of the objects transported in the first transport circuit with reference to the objects transported in the second transport circuit. The system can advantageously be used with objects having a variable thickness and in particular with folding cartons in a flat configuration.
US09517894B2
A floating conveyor belt cleaner assembly for removing residual material on the surface of a conveyor belt has a scraper assembly with a plurality of scraper blades rotatably mounted between mounting frames attached to the support structure of a conveyor belt adjacent the opposing edges of the belt. A rotating mechanism selectively rotates the scraper assembly relative to the mounting frames to position a new set of scraper blades against the conveyor belt once the worn set of scraper blades requires replacement. A float mechanism permits movement of the scraper assembly vertically substantially perpendicular to the surface of the belt as the scraper blades wear down.
US09517892B2
A return roller battery has a plurality of idler rollers rotatably attached at either end to opposing mounting plates. The mounting plates are rotatably attached to a conveyor belt frame and selectively rotated by a crank mechanism to position one of the idler rollers beneath the conveyor belt to support the belt. A locking mechanism secures the mounting plates against rotation when an idler roller is in position.
US09517890B2
An apparatus for singulating logs comprises a stationary support at least one inclined stationary surface and a top edge and a first reciprocating support having a top step positioned against the inclined stationary surface. The first reciprocating support is movable between a bottommost position wherein the top step is positioned below the top edge of the stationary support and a topmost position wherein the top step is positioned above the top edge of the stationary support. The apparatus further comprises a plurality of fingers extending from the top step wherein each of the fingers has a length adapted to regain a log on the top step at a topmost position of the first reciprocating support and to retract into the stationary support at the bottommost position of the first reciprocating support.
US09517881B2
The inventive concept consists of a compartmentalized trash can including a basic trash can of any configuration. The basic trash can has installed therein, at a lower area, a horizontal plate which is being fastened to the inside walls of the basic trash can thus forming a lower compartment. The lower compartment has an opening at one of the walls of the basic trash can. A half oval cover skirt is formed that has a flat cover plate at the top end to cover the top of the basic trash can. The half oval cover skirt has a depending a half oval cover skirt which is depending from the top cover plate and is connected to the top plate and can be moved by way of a hinge at the top cover plate and can be moved to an upper position exposing the top trash compartment and when it is lowered it will cover the opening in one of the walls of the basic trash can. The top cover plate has an arrangement to close or open an access to the interior of the upper compartment to deposit trash.
US09517878B2
Flexible wrapping material for wrapping flowers and/or plants, wherein at least two connected parts having mutually distinctive shapes border next to each other along a straight line separating said parts from each other. Optionally said parts are provided with mutually distinctive prints on said parts. In another embodiment said parts are embodied in mutually different materials. It is suitable that one part is embodied in a plastic material and the other part is embodied in a woven or nonwoven fabric material. Neighboring edges of adjacent parts are sealed to each other. Sealing can be achieved in many ways, for instance by heating or by ultrasonic sealing.
US09517877B2
A holder for a single-serving condiment packet that allows an opened packet to maintain an upright position without spilling its inner contents and also without having the opening of the open packet touch any part of the holder. The single-serving condiment packet holder has a thin three-dimensional cavity which is defined by one or more internal sidewalls. The holder may also have sidewalls, a base side, and a top side that is any geometric shape. A clip may be used to suspend the holder.
US09517872B2
A packing body is provided, which is configured to pack an intended apparatus therein. The packing body includes a first sheet formed in such a bag shape as to entirely wrap the intended apparatus therein, a cushion member configured to protect at least a corner of an outer surface of the intended apparatus wrapped in the first sheet, a second sheet configured to be placed between the first sheet and the cushion member at the corner of the outer surface of the intended apparatus packed in the packing body, the second sheet being further configured to cause a lower frictional force between the second sheet and the first sheet than between the second sheet and the cushion member, and a packing box configured to entirely cover the intended apparatus from an outside of the cushion member.
US09517868B2
A lid-opening/closing device includes a device body on which a pod including a container body, a lid portion defining a bottom portion openable and closable relative to the container body, and a locking mechanism performing unlocking and locking of the lid portion with respect to the container body is placed; a plurality of moving units that perform unlocking to cause the locking mechanism to perform unlocking and locking to cause the locking mechanism to perform locking by moving engaging pins configured to engage with the locking mechanism; a linkage unit that causes the moving units to perform unlocking by moving the moving units in conjunction with each other when causing the locking mechanism to perform unlocking, and causes the moving units to perform locking by moving the moving units in conjunction with each other when causing the locking mechanism to perform the locking; and an air cylinder that simultaneously drives the moving units and the linkage unit.
US09517866B2
An improved easy opening closure wherein a cover panel is bonded to a container end panel around the perimeter of an aperture through the end panel. A rotating lever is connected to a proximal lever through a rivet acting as a fulcrum such that, as pressure is applied to rotate the rotating lever axially around the rivet, the force is magnified which allows the proximal lever selectively debonds an isolated region of the perimeter, thereby allowing pressure within the container to escape. Continued rotation of the rotating lever further debonds the cover panel from the end panel. The leading edge of the rotating lever wedges between the end panel and the cover panel at the opposite edge of the aperture, thereby cleaving and debonding the connection between the panels at that edge.
US09517865B2
A canister comprises a vessel defining a volume and an opening having a rim and a lid. The lid comprises a flexible bulb and a conformal outer edge configured to create an airtight vacuum seal with the rim to close the opening. The flexible bulb is configured to release pressure from the vessel and break the airtight vacuum seal in response to compression of the bulb. The lid can be configured to be completely contained within the rim.
US09517860B2
A paint container handling system comprised of an ergonomic gripping handle formed with an upper slot for retaining the wire handle of a paint can and formed with a lower slot designed to couple the handle to the rim of a paint container. An optional strap provides an additional coupling mechanism.
US09517857B2
A cardboard box has a fold-out hanger arranged in a cut-out of the cardboard box, wherein at least a hanger portion of the cardboard box is assembled from two layers of cardboard, the hanger portion having a first hanger portion formed from a first cardboard layer and a second hanger portion formed from a second cardboard layer, wherein a first hanger section of the first hanger portion forms a front side of the hanger, a second hanger section of the second hanger portion forms a backside of the hanger and the second hanger section is smaller in lateral extension than the first hanger section.
US09517855B2
A laser capsule marking system and method may comprise at least two indexing wheels, a feeding mechanism, a laser marker, a first inspection system, a rejection subsystem, a reject verification sensor, and a collection device. The wheels are coaxial and have respective circumferential peripheries with multiple open pockets distributed thereabout. Each pocket is configured to releasably receive a pharmaceutical capsule doped with pigment particles reactive to laser light. The indexing wheels are configured to be incrementally rotated in alternating indexing fashion for transporting discrete arrays of respective pockets through a loading zone, an inspection zone, a marking zone, a reject zone, and an unloading zone. An actuatable reject block may be provided to simultaneously blow a rejected capsule from its pocket, and draw it in for transport to a rejection bin. Each circumferential periphery may be comprised of multiple arcuate shoes removably and replaceably secured to their respective indexing wheel.
US09517852B2
Device (10) for ultrasonic welding of a flexible, notably tubular, structure (F), to be conformed into sachets, this device including at least two airgaps each defined between a sonotrode (20) and an anvil (30,40) carried by respective support structures (28,54) the distance between which varies between a close together welding position and a spaced apart flexible structure movement position, in which airgaps the flexible structure to be welded is intended to be received to produce at least two weld lines, wherein for each airgap an anvil and/or a sonotrode both associated with this airgap is at least partially mobile relative to a support structure (54) of this anvil or sonotrode.
US09517849B2
An instrument (1) for powderous or pasteous substances has a control unit (40) and a dispensing unit (50). The control unit is configured as a grip handle to be handheld. The dispensing unit is designed for removable seating in the holder device. A vertically movable shutter bolt (52) can open a discharge orifice (58). The control unit (40) has an actuator (20) directed at the shutter bolt, with a motor (21), a transmission (22), an actuator element (30) and a drive shaft (12), oriented vertically when operated. The drive shaft (12) can be engaged with the shutter bolt. Continuing and increased actuation of the actuator element moves the shutter bolt into an opening range where the shutter bolt opens up the discharge orifice to a variable, position-dependent extent, allowing the material to flow into a target vessel.
US09517838B1
A helicopter has a lift module having a propulsion system and at least one rotor driven in rotation by the propulsion system. A payload support system is adapted to couple an external payload directly to the lift module. The helicopter is devoid of provisions for human passengers.
US09517835B2
A selector lever with two detent plates and corresponding detent pins that travel along a shaft includes a float that moves with each of the detent pins. When a detent pin fails, a float pin remains engaged with a catch, thereby preventing rotational movement of the shaft.
US09517828B2
A structural frame for a fuselage of an aircraft. The frame is formed from a composite material profile comprising curved zones (7) that interconnect together zones to be joined of the frame, having respective orientations. Each of the curved zones (7) of the frame is geometrically defined by at least one radius of curvature. The value of the radius of curvature (R2), geometrically defining a curved zone (7) of the frame varies as a function of the curvilinear abscissa of each points on the inside periphery of the inside flange from any point of the curved zone relative to a given reference point (P1).
US09517823B2
A fuel supply unit includes a vapor separator that performs vapor-liquid separation for fuel pumped up by a low-pressure fuel pump; a fuel filter that filters the fuel subjected to vapor-liquid separation in the vapor separator; an in-line type high-pressure fuel pump that has an inlet port for receiving the fuel filtered by the fuel filter and pumping the fuel received from the inlet port from an outlet port, the inlet port being located under a fuel liquid level of the vapor separator; a fuel injector that injects the fuel pumped by the high-pressure fuel pump to the engine; and a fuel flow path connected from the vapor separator to the inlet port of the high-pressure fuel pump via a lower side of the inlet port of the high-pressure fuel pump, wherein the fuel filter is arranged in the lowermost part of the fuel flow path.
US09517813B2
A hull form design which incorporates bi-lateral semi-sponsons disposed on either side of a non-stepped V-shaped center hull section. The semi-sponsons extend the entire length of the hull form and comprise protrusions extending away from the center section. The semi-sponsons are delimited by longitudinal steps extending below the hull bottom an equal distance from the centerline on opposite sides of the hull. This design is a hybrid of conventional “V” hulls and catamarans and improves the roll and turn initiation time of convention monohull designs.
US09517781B2
An air spring for railroad cars includes an air spring part formed by an upper support on a vehicle body side, an intermediate support arranged therebelow, and a diaphragm made of rubber and extending between the upper support and the intermediate support; and an elastic mechanism b formed by a rubber mass 5 interposed between the intermediate support and a lower support 4 on a bogie side arranged therebelow. The rubber mass 5 has an end in contact with the lower support 4 formed as an enlarged end 5A increasing in diameter as approaching the lower support 4 in a vertical direction. An outer circumferential portion of this enlarged end is fitted in and bonded to an annular groove 12 formed in the lower support 4, and the annular groove 12 has an annular bottom 12A inclined to decrease in height radially outwards to have an annular tapered bottom 12a.
US09517776B2
Certain embodiments of the invention may include systems, methods, and apparatus for controlling devices based on a detected gaze. According to an example embodiment of the invention, a method is provided for executing computer executable instructions by one or more processors for controlling one or more devices attached to a vehicle based at least in part on a detected direction of observation of an occupant of the vehicle, the method further includes receiving one or more images from at least one camera attached to the vehicle; locating, from the one or more images, one or more body features associated with the occupant; determining a direction of gaze from the one or more located body features; and controlling the one or more devices based at least in part on the direction of gaze.
US09517773B2
Method (400), calculation device (131) and display (130) for causal analysis of the fuel/energy consumption in a vehicle (100), which is driven by a driver (101): Division (401) of the vehicle's fuel/energy consumption over a number of fuel/energy consumers, calculation (402) of the subdivided (401) fuel/energy consumers' fuel/energy consumption in a calculation device (131), and visualization (403) of the subdivided (401) fuel/energy consumers' calculated (402) fuel/energy consumption, on a display (130), which is controlled by the calculation device (131).
US09517771B2
A vehicle operator is identified. Based at least in part on the operator's identity, one or more parameters are determined specifying a mode for autonomously operating the vehicle. The vehicle is autonomously operated at least in part according to the one or more parameters.
US09517766B2
A parking assist device includes a target steering angle setting section configured to set a target value of the steering angle; a target vehicle speed setting section configured to set a target value of the vehicle speed; an automatic steering control device configured to automatically steer the steering wheel so that the sensed steering angle becomes the target steering angle; an automatic vehicle speed control device configured to automatically control the vehicle speed so that the sensed vehicle speed becomes the target vehicle speed; and a parking space recognizing section configured to recognize a parking space of the host vehicle, the host vehicle being parked within the recognized parking space by the automatic steering control device and the automatic vehicle speed device.
US09517761B2
An electric motor (2) of a drive train (1) of a hybrid vehicle is controlled by determining the shaft torque (TW) of a current work cycle (n) of an included internal combustion engine (3) and feeding the shaft torque (TW) to a compensation controller (K) which has stored the shaft torque (TW(n−1)) of a preceding work cycle (n−1) of the internal combustion engine, and calculating a compensated shaft torque (Tkomp) from the shaft torque (TW(n)) of the current work cycle (n), the shaft torque (TW(n−1)) of a previous work cycle (n−1), and the shaft torque of a previous work cycle (n−1) shifted by a system delay, which compensated shaft torque (Tkomp) is linked to a target torque (Tsoll) predefined by a higher-level control unit (15) to determine the controlling torque (Tstell) for the electric motor.
US09517757B2
A hydraulic block for a hydraulic assembly of a slip-regulated, hydraulic vehicle brake system, comprises a first plurality of receivers aligned in a first row that are each configured to fluidly connect to a respective brake pressure, and a second plurality of receivers aligned in a parallel second row that are each configured to fluidly connect to a respective brake pressure reduction valve. The second row is spaced from the first row in a first direction. The hydraulic block further comprises a first further receiver that fluidly connects to a brake master cylinder pressure sensor. The first further receiver is located perpendicularly offset from the first row in a second direction opposite the first direction and within a plane extending between two of the first plurality of receivers and between two of the second plurality of receivers and that is outside of a center plane defined by the hydraulic block.
US09517756B2
A brake system for a motor vehicle having front and rear axles, the brake system having front and rear axle braking mechanisms operated under pressure control devices for producing a respective brake pressure on the front and rear axles of the motor vehicle. A controller receives signal information from sensors and systems on the motor vehicle to detect initiation of a braking process and detect a current speed of travel of the motor vehicle. An initial brake pressure for the rear axle braking mechanism is determined by the controller. A target brake pressure for the rear axle braking mechanism is determined by the controller and is representative of an increase in pressure relative to the initial brake pressure and the current speed of travel. Instructions from the controller operate the pressure control devices to produce the target brake pressure at the rear axle braking mechanism.
US09517754B2
The electric parking brake control device performs accelerator release control for moving a friction-applying member to a standby position when a vehicle starting operation is performed, the standby position being positioned between a locked position and a released position such that friction-applying member moves from the standby position to the locked position within a time which is shorter than a time required to move from the released position to the locked position. The electric parking brake control device determines whether it is unnecessary to maintain the standby position, based on whether a state in which a vehicle speed exceeds a specific speed threshold value is maintained for a predetermined period of time. The release control is performed when the electric parking brake control device determines that it is unnecessary to maintain the standby position.
US09517752B2
The invention relates to a wiper blade adapter unit for connecting a wiper blade (10) to a wiper arm adapter (12), comprising a main part (16) which receives an end (14) of the wiper arm adapter (12) in particular and which has a plateau (20) on the main part lower face (18). At least one region (22, 24, 26) is provided on the main part (16), said region being designed in a flexible manner for the purpose of a shape and/or tolerance compensation. The region (22) that is flexible for the purpose of a shape and/or tolerance compensation is arranged within the plateau (20).
US09517741B2
A vehicle wheel deflector bracket and method is provided. The bracket is attachable to a vehicle having a wheel, a door, and a body structure supporting a door hinge. The bracket is configured to deflect a force from the wheel to the body structure and away from the door hinge when the bracket is attached to the body structure.
US09517740B2
A loudspeaker device is installed in a space between a bumper reinforcement for reinforcing a bumper of a vehicle and a bumper absorber attached to a front side of the bumper reinforcement. An approach notification sound output from a front side of the loudspeaker device is radiated outside through a first opening provided on a driver's seat side of the bumper absorber. An approach notification sound output from a rear side of the loudspeaker device passes through a sound path between the bumper reinforcement and the bumper absorber and is then radiated outside through a second opening provided on a passenger seat side of the bumper absorber.
US09517739B2
The present invention relates to a vehicle impact sensor device adapted to detect an impact between a vehicle (1) and a person. The sensor device (6) comprises a tubular enclosure (7) which encloses a gas-filled space (8). The tubular enclosure (7) has a first end (7a) and a second end (7b) and is arranged to extend along a bumper cover (5), when mounted to a vehicle (1). The sensor device (6) further comprises a pressure sensor (9, 9′, 11, 11′) arranged to detect pressure characteristics in the the tubular enclosure (7). The sensor device (6) also comprises a gas pulse device (11, 11′) which is connected to the tubular enclosure (7), the gas pulse device (11, 11′) being arranged to insert gas into, or withdraw gas from, the tubular enclosure (7).
US09517737B2
Electrical devices in a vehicle engine compartment are controlled from the vehicle passenger compartment over a serial data bus that extends between a relay controller located in the engine compartment and a body control module located in the passenger compartment and which receives commands from various passenger compartment devices. A serial data link passing through the firewall couples the body control module to the relay controller.
US09517723B1
A vehicle is provided that includes a pickup box defining a storage area therein with at least one cleat assembly extending into the storage area. The cleat assembly includes a base, a tie-down cleat coupled to the base, and a lock assembly. The lock assembly is configured to removably couple the tie-down cleat to the base. The lock assembly includes a translucent polymer and a first phosphor material and a key configured to operate the lock assembly. The key includes a polymeric material mixed with a second phosphor material.
US09517721B2
Certain example embodiments relate to a vehicle window (e.g., sunroof). Side-firing LEDs are provided between first and second substantially parallel substrates and emit light towards central regions of the window. A liquid-crystal inclusive switchable film is provided between the first and second substrates. The liquid crystals are sized such that light received from the LEDs is redirected in a direction substantially normal to major surfaces of the first and second substrates. The switchable film is operable in at least first and second modes, with the window in the first mode having a visible transmission of less than 1%, and with the window in the second mode having a visible transmission of 7-15%. The switchable film and the LEDs are operable independently of one another in connection with the LEDs emitting light and the switchable film controlling visible transmission therethrough.
US09517719B2
A method for automatic direction indication for a vehicle includes the following steps: detecting a driver activity and/or a vehicle position by a Lane Keeping System and/or a Lane Departure Warning System; and automatically activating or deactivating a direction indicator of the vehicle dependent on the detected driver activity or vehicle position.
US09517715B1
A vehicle headlamp system can include a plurality of low beam light sources and a plurality of high beam light sources. In one or more arrangements, the light sources can be light emitting diodes. The system can include a first light driver operatively connected to selectively supply electrical energy to a first group of low beam light sources and/or a first group of high beam light sources. The system can include a second light driver operatively connected to selectively supply electrical energy to a second group of low beam light sources and/or a second group of high beam light sources. The system can further include a controller. The controller can be operatively connected to the first light driver and the second light driver to control the selective supply of electrical energy by the first light driver and the second light driver.
US09517702B2
A power supply system is basically provided for supplying electric power to an electric component of a bicycle. The power supply system includes a first battery, a second battery, an operating unit and a power supply controller. The power supply controller is configured to transition an operating state by electric power of the second battery and supply electric power from the first battery to the electric component when the operating unit is operated in a stopped state.
US09517701B2
An apparatus for providing transportation includes an electric vehicle having a battery, an electric motor, a transceiver, and a battery manager. The battery manager includes a controller configured to control flow of charge between said battery and the electric motor at least in part in response to information received by the transceiver.
US09517700B2
A method for contactless charging of the battery of an electric automobile by magnetic induction using a transmitter coil of a charging device and a receiver coil of the vehicle, the method including: controlling a power supply of a converter, at terminals of which the transmitter coil is connected, according to a variable frequency; measuring, in an analog circuit, a value of a current and of a voltage at the terminals of the transmission coil; calculating a phase shift between the current and the voltage; converting the phase shift into a digital value; and locking the variable frequency of the converter to the phase-shift value by digital processing.
US09517694B2
Vehicles, systems and a method for mitigating power hop in a vehicle are provided. The vehicle, for example, may include, but is not limited to a drivetrain, an electronic limited slip differential mechanically coupled to the drivetrain, and a controller communicatively coupled to the electronic limited slip differential, wherein the controller is configured to determine when the vehicle is experiencing a power hop event or when the vehicle may experience a future power hop event, and cause, when the vehicle is experiencing the power hop event or when the vehicle may experience the future power hop event, the electronic limited slip differential to apply torque differentiation pulses to the drivetrain.
US09517693B2
A drive axle system can be converted between a single drive tandem axle arrangement including a rear drive axle a dual drive tandem axle arrangement. A forward bowl is provided for a forward axle system. One of a geared forward carrier and an ungeared forward carrier is mounted on the forward bowl, depending upon whether a dual drive or a single drive tandem axle arrangement is desired. To convert to the other type of tandem axle arrangement, the one of the geared forward carrier and the ungeared forward carrier is removed from the forward bowl and replaced, with the other one of the geared forward carrier and the ungeared forward carrier.
US09517690B2
A vehicle driving control device for a vehicle includes a control unit configured to stop operation of an electric motor driving device driving an electric motor at a time a rotary element is fixed to be unable to rotate by an engagement by an engaging mechanism, and to recover the operation of the electric motor driving device at a time a predetermined condition based on a parameter relating to a driving of the vehicle is satisfied before releasing the engagement by the engaging mechanism.
US09517689B2
A hybrid powertrain unit comprises an engine, and a gearbox device with a primary shaft connectable to an engine shaft via a clutch. The gearbox device comprises a secondary shaft with an output pinion meshing with a first crown wheel of a differential, the casing of which is rigidly connected to the casing of the gearbox device. The unit comprises an electric machine configured to function as an electric motor and an electric generator, having a shaft connected by a transmission to a second crown wheel of the differential. In the transmission, arranged between the electric machine shaft and the second crown wheel is an engagement device that can be driven via an actuator. The electric machine shaft is connected to the engine shaft, on a side opposite to the gearbox device. The transmission includes a gear for driving a transmission shaft connected to a further axle of the vehicle.
US09517682B2
The invention relates to a device for controlling a complementary electric radiator (R) installed in a ventilation system used in the automotive sector, said device including at least two electronic modules each including a computer, a control module (1) capable of sending operating commands to the radiator and a management module (2), which is implemented within the electric radiator (R) in order to manage the operation thereof on the basis of commands received from the control module (1). According to the invention, the control module (1) includes a unit for generating and transmitting a PWM signal representative of the operating commands being sent to the radiator (R) over a communication wire (3) connected to the management module (2) and a unit for reading the signal travelling over the communication wire (3); the management module (2) includes a unit for altering the PWM signal travelling over the communication wire on the basis of detected events in the operation of the radiator (R).
US09517665B2
An altitude of the vehicle from an external electronic source and an external temperature is received from a temperature sensor are received. An external relative humidity is determined. Based upon the altitude, the temperature, and the external relative humidity, an estimated barometric pressure is determined. An air pressure of a tire is received. An adjustment is made to the received pressure to obtain a corrected pressure. The amount of adjustment is based upon the estimated barometric pressure and the adjustment is applied to the air pressure to obtain a corrected tire pressure. An evaluation is made of the corrected tire pressure to determine when an alert should be presented to a user. When the alert is determined, the alert to the user is presented to the user.
US09517661B2
The present disclosure relates to a low noise tire, and more specifically, to a low noise tire that includes: a sealant layer adhered to an inside surface of an inner liner of the tire; and a sound-absorbing material layer adhered to the sealant layer, in which the sound-absorbing material layer includes 50 to 90 wt % of a polypropylene melt-blown fiber and 10 to 50 wt % of a polymer fiber.
US09517655B2
The invention disclosed herein is comprised of a frame and high tension strings combined to create a useful, distinct and novel display frame. The high-tension strings are interwoven vertically and horizontally across the surface area within the perimeter of the frame, creating vertices and slots for securely holding art objects, such as photographs. The vertical and horizontal high tension strings are affixed to the backside of the frame with a fastener and further secured by intricate knots to prevent the shifting and moving of the strings. The high tension strings are strung at the highest tension and are specifically spaced to accommodate pictures of varying sizes. The specific sized slots created by the interweaving of the vertical and horizontal strings make it easy and simple to slip pictures in and out of the available slots, or rotate the pictures to display in a collage format.
US09517654B2
The present invention relates to a writing implement comprising: a tubular gripping body (10) within which there is a recess for receiving an ink reservoir, a writing nib (12), at one end of the tubular gripping body (10) able to be connected to an ink reservoir, a timekeeping mechanism (14) housed in the tubular gripping body (10). According to the invention, the timekeeping mechanism (14), housed in the tubular gripping body (10), is a mechanical movement comprising an energy source (16), a balance and hairspring (18), an escapement mechanism intermittently transmitting the energy supplied by the energy source (16) to the balance and hairspring (18), and a geartrain (20) arranged to drive a device (22) for displaying time information, said display device being visible on a circumferential portion of the tubular gripping body (10) at a position between its two ends.
US09517642B2
A decision is made for each page as to whether to allow image printing on that page, by comparing the remaining sheet length DL with a length of an image about to be printed, IL. A length of a non-printed, rear-end cut sheet is also checked to determine whether the non-printed cut sheet needs to be further cut into smaller sheets. This arrangement can prevent a complete image to be printed in one page from being broken and only partly printed in the last portion of a paper roll, ensure that printed cut sheets and non-printed cut sheets are stably conveyed and discharged and enable the non-printed cut sheets to be almost equal in size so that they can be properly accommodated in the associated tray.
US09517641B2
A printing device includes a paper medium print mode configured to execute printing on a paper medium; and a textile print mode configured to execute printing on a fabric medium, a print speed in the textile print mode being slower than a print speed in the paper medium print mode.
US09517637B2
The imaging optical element includes an optical surface whose shape within a sub-scanning section has a non-circular shape. Assuming that a coordinate along a main scanning direction is Y and a coordinate along a sub-scanning direction is Z and that, within the sub-scanning section, a curvature radius on an optical axis of the optical surface is r, an eccentricity is k, a coefficient of variation in the curvature radius of the optical surface is Di, and an aspherical surface coefficient is GmnYm, when a shape S of the optical surface within the sub-scanning section is defined by an expression: S = Z 2 r ′ 1 + 1 - ( 1 + k ) ( Z r ′ ) 2 + ∑ n = 1 16 ∑ m = 0 16 G m n Y m Z n , r ′ = r ( 1 + ∑ i = 2 14 D i Y i ) the expression includes a term in which n is an odd number equal to or larger than 3, and the aspherical surface coefficient of at least one of the terms in which n is an odd number equal to or larger than 3 is changed asymmetrically along the main scanning direction.
US09517636B2
An image forming method forms an electrostatic latent image corresponding to an image pattern including an image portion and a non-image portion by exposing a surface of an image bearer with light according to the image pattern. The image portion includes a plurality of pixels. Among the pixels constituting the image portion, at least a group of pixels existing at a boundary with respect to the non-image portion is set as a non-exposure pixel group. Among the pixels constituting the image portion, at least a group of pixels existing at a boundary with respect to the non-exposure pixel group is set as a high power exposure pixel group where exposure is performed with light of a higher light power value than a predetermined light power value required for exposing the image portion.
US09517632B2
An ink containing device comprises an ink cartridge and an adaptor. The ink cartridge comprises a first main body comprising a chamber configured to store ink, an ink outlet portion disposed on a first surface of the first main body configured to direct the ink from the chamber to an exterior of the first main body wherein the first surface faces a first direction, and an electrical interface disposed on the first main body. The adaptor is configured to be in an attached state with the ink cartridge. The adaptor comprises a second main body comprising a first contact disposed on a particular surface facing a particular direction, and a second contact disposed on a further surface and electrically connected to the first contact, wherein the second contact is electrically connected to the electrical interface in the attached state.
US09517630B2
An inkjet printing system, fluid ejection system and method thereof are disclosed. The fluid ejection system includes a fluid ejection device and a determination module to determine a supply condition based on the count value output by the converter module. The fluid ejection device includes a fluid supply chamber to store fluid, an ejection chamber including a nozzle and a corresponding ejection member to selectively eject the fluid through the nozzle, a pressure sensor unit having a sensor plate to output a voltage value corresponding to a cross-sectional area of an amount of fluid in the ejection chamber. The fluid ejection system also includes a converter module to output a count value corresponding to the voltage value output by the pressure sensor unit.
US09517616B2
A lifting sucker for separating sheets from a sheet stack includes a suction cup formed as a double-walled bellows sucker having at least one suction chamber that can be acted on pneumatically to contract the bellows sucker. A punch and a sheet-fed rotary printing press having the lifting sucker are also provided.
US09517607B2
PVC-skinned composites include a substrate, a skin and an intermediate polyurethane layer. The polyurethane layer is characterized in having a low molecular weight between crosslinks, i.e., is somewhat highly crosslinked. The high level of crosslinking in the polyurethane leads to improved performance of the skin layer. The skin layer retains its original color upon aging, is less prone to shrinking and other loss of physical properties, and adheres better to the polyurethane layer.
US09517605B2
A plastic or other film bag is formed from a continuous extruded tube. The tube is flattened and sealed across its width at intervals to form bag bottoms. The bags are joined to one another at a perforation line and folded in thirds lengthwise prior to being rolled into a compact roll, either with or without supporting core. After folding the bags may be chisel cut through the center of the perforation line to assist in dispensing of the bags. The chisel cut will extend through all layers of the bag when folded, resulting in three chisel cuts in the bag. The bags may be gusseted for part or as much as all of their width. The bags may also be corona treated and printed on their outer surfaces. The bags may be formed from partially recycled materials and various combinations of linear low density, medium and high density polyethylene.
US09517604B2
A vulcanization apparatus provided with a vulcanization vessel for vulcanizing a green tire and a suction line for sucking out gas from inside the vulcanization vessel after the vulcanization vessel has been opened. Accordingly, oily smoke generated when vulcanized rubber has been removed from a bladder and an inner wall of a mold can be more efficiently discharged than in cases in which gas inside a vulcanization vessel is sucked out and additional air is introduced into the vulcanization vessel only prior to opening the vulcanization vessel.
US09517603B2
An apparatus for molding and curing a green tire includes a curing mold that includes a first sidewall plate and a second sidewall plate, with a ring of circumferential sectors circumscribing a mold cavity. The first sidewall plate is capable of coming into contact with a first annular fixing structure of the green tire when the green tire is inserted into the mold. The apparatus also includes at least a first bead molding ring movable from a first contracted operating position to a second extended operating position, a second bead molding ring movable from a first contracted operating position to a second extended operating position, and an expandable bladder delimited by a membrane associated for operation with the mold to exert a pre-molding pressure which is lower than a molding pressure to bring the first annular fixing structure into contact with the first sidewall plate.
US09517582B2
The present disclosure provides a method of molding a part. The method may include rotating a screw within a barrel to extrude a molten material through a nozzle orifice into a mold cavity to fill the mold cavity with the molten material, stopping rotation of the screw upon the mold cavity being filled with the molten material, monitoring a parameter indicative of a pressure in the mold cavity, and further rotating the screw to extrude additional molten material into the mold cavity when a drop in pressure in the mold cavity is detected.
US09517581B2
A pressure-maintenance device for a resin injection system including an injection network connected to an injection mould, includes a pressurisation device adapted to inject a pressurised gas into a channelling; a first connector adapted to be connected to the resin injection network and adapted to be connected to the channelling; a second connector adapted to be connected to the injection mould of the injection system; the first connector being connected to the second connector by a pressure-maintenance channelling adapted to receive the gas injected under pressure.
US09517578B2
Method for manufacturing biodegradable moldings, in particular tableware and packages, with application of the method of evoking the water vapor pressure inside the mold consists in that loose bran, preferably the wheat bran, of granulation from 0.01 up to 2.80 mm in the amount of 95-100% of weight containing more than 14% of water structurally bound in the form of moisture, if needed, is mixed in the dry form with additional substances in the amount of up to 5% of weight in total, and the measured amount of dry material obtained in that way is placed in one of the parts of multipart mold, then the mold is closed and the mixture is subject to the simultaneous operation of temperature and pressure of the scope 1-10 MPa. The mold is heated up to temperature above 120° C., then the mold is closed, and then is depressurized, thus forming a gap between the edges of the mold not wider than 0.5 mm, and then the mold, if needed, is closed again, and the depressurization cycles are repeated. After the last cycle the mold is opened and the number of depressurizations is at least 1, and the entire process of depressurization and closing the mold takes a few seconds and is completed according to the program of the machinery digitally controlling the mold movement depending on the expected parameters of the final product.
US09517566B2
A test gripper is provided that decreases an equipment cost and increases a test precision by integrating and simplifying a jig and a test apparatus into the gripper. The test gripper is configured to align and test a component and includes a frame that has a mounting part installed on a robot arm. In addition, a plurality of pins are installed on the frame and are fitted into apertures of the component to align the component and the test gripper. A measuring sensor is also installed on the frame and is configured to test a precision of the component.
US09517562B2
A robot controller includes a force control unit that outputs a correction value of a target track of a robot based on a detected sensor value acquired from a force sensor, a target value output unit that obtains a target value by performing correction processing on the target track based on the correction value and outputs the obtained target value, and a robot control unit that performs feedback control of the robot based on the target value. The force control unit includes an impedance processor that obtains a solution of a differential equation in force control as the correction value before the conversion processing, and a nonlinear convertor that obtains the correction value after the conversion processing by performing nonlinear conversion processing on the correction value before the conversion processing acquired from the impedance processor and outputs the obtained correction value after the conversion processing.
US09517555B2
A battery operated handheld power tool, comprising a working tool assembly (20), a handle assembly (10) and an elongate tubular rod (30). The working tool assembly (20) comprises a motor housing (26) having a first inner space (27), comprising an electric motor (21) with a fan (25). The first inner space (27) is connected to the exterior of the working tool assembly (20) by means of at least one air outlet (28). The handle assembly (10) comprises a second inner space (19) in which a control unit (15) is positioned, the second inner space (19) being in flow communication with the exterior of the handle assembly (10). The elongate tubular rod (30) defines an air guiding channel (33), in flow communication with the first inner space (27) and the second inner space (19).
US09517552B2
A filter remover removes a cylindrical filter element housed in a housing through an opening provided in the housing. The filter remover includes: an attachment portion provided with a screw to be screwed onto the opening; an insert portion that includes a base end integrated with the attachment portion and a tip end in a form of a free end, that is elastically deformable in a radial direction orthogonal to an axial direction of the filter element in conjunction with a movement in the axial direction caused when the attachment portion is screwed, and that is inserted through the opening into a center hole provided in the filter element as the attachment portion is screwed; and an engaging portion that is provided at the tip end and that is engaged with the filter element after the attachment portion is moved for a predetermined amount when the attachment portion is screwed.
US09517543B2
The present document describes a blade sharpening system comprising a blade sharpening device, a blade holding apparatus and a controller operatively coupled to the blade sharpening device and said blade holding apparatus to control sharpening of said blade, and methods of using the same.
US09517535B2
A material is deposited on the surface of a piece to be repaired, by means of two steps of electro-spark deposition alternated with an intermediate compaction step, which reduces the surface asperity of a layer of material deposited before another material is deposited; the compaction phase is defined by shot peening, performed by means of shots supported by at least one flexible element supported projecting from a rotating shaft.
US09517532B2
An object is to form a rough surface for ensuring adhesion between a metal member and other members, or a rough surface for suppressing solder expansion in the metal member using an energy beam having energy density lower than a related art. A surface processing method of a metal member, in which a metal thin film is arranged on a surface of a base, includes: melting or evaporating a surface portion of the metal thin film by irradiating the metal thin film with a pulse-oscillated laser beam having energy density of 100 J/cm2 or less and a pulse width of 1 μs or less; and roughening the surface of the metal thin film by solidifying the surface portion of the metal thin film after the melting or evaporating. The metal thin film is made of at least one of Ni, Au, Pd, and Ag as a main component.
US09517530B2
A hexagonal single crystal wafer is produced from a hexagonal single crystal ingot. A separation start point is formed by setting a focal point of a laser beam inside the ingot at a predetermined depth from the upper surface of the ingot, which depth corresponds to the thickness of the wafer to be produced, and next applying the laser beam to the upper surface of the ingot while relatively moving the focal point and the ingot to thereby form a modified layer parallel to the upper surface of the ingot and form cracks extending from the modified layer along a c-plane, thus forming a separation start point. The focal point is indexed by relatively moving the focal point in the direction where an off angle is formed and the c-plane is inclined downward.
US09517529B2
System for friction stir welding of two parts which includes a welding unit which includes at least one welding head fitted with a rotating pin and a counter-bearing unit which has a support surface to support the parts against a pressure exerted by the welding head, and wherein each welding head can be moved relative to the support surface in a first direction parallel to an axis of rotation of the rotating pin and in a second direction orthogonal to the axis of rotation, and wherein the support surface can be moved in the second direction and is formed of two coaxial clamp rollers which are set apart from each other.
US09517528B2
A tool and method for bonding layers of a shell by the differential pressure bonding process. The tool and method includes a plurality of separable mandrel segments that combine to form a mandrel having a longitudinal axis, an outer surface, an upper end, and at least one substantially continuous inner surface. The inner surface has a substantially axisymmetric shape having complex curvature. In this embodiment, the tool further includes a retort configured to at least partially shroud the outer surface and upper end of the hollow body. The retort includes at least one vacuum port. The tool is configured to facilitate the compression of a plurality of layers of a multi-layer shell having complex curvature as the shell layers and an interdisposed bonding material are heated to an elevated bonding temperature.
US09517518B2
A method of manufacturing a nut in a screw and nut system comprises a first material removal stage to form an internal thread of which the value of the nominal diameter is lower than a predetermined final nominal diameter value and a second plastic deformation stage of the thread formed during the first stage to obtain the predetermined final value by material displacement.
US09517511B1
A method of forming an opening in a layered structure includes providing a layered structure including a first layer and a second layer and a near-zero gap interface defined between the first layer and the second layer; providing an opening through the layered structure such that the opening extends through the first layer and the second layer; and working simultaneously the opening in the fay surface of the first layer and the opening in the fay surface of the second layer without separating the first layer and the second layer. An internal chamfering device is also disclosed.
US09517507B2
A method of shaping a part in a green state obtained through powder injection molding, including placing a surface of the part in contact with a shaping surface of a setter with at least one section of the surface of the part not conforming to the shaping surface, and locally heating at least one area of each of the at least one section to deform the part until the at least one section conforms to the shaping surface. The part remains in the green state during the local heating. The part may be a heat shield panel for a gas turbine engine.
US09517502B2
A system for performing industrial operations comprises at least one tool head provided with a tool and at least one sensor associated to the tool head. The system further comprises a control module mounted on the tool head including a data-acquisition unit connected to the sensor configured for acquiring the data coming from said at least one sensor, and a wireless transmission unit connected to the acquisition unit for receiving the aforesaid acquired data and for transmitting the data acquired to a receiving unit in a wireless mode. The module further comprises a device for storing electrical energy for electrical supply of the control module. The system further comprises a wireless charging system for charging the device for storing electrical energy comprising a first charging device carried by the tool head and connected to the energy-storage device and a second charging device associated to a stationary workstation.
US09517500B2
Apparatus and method for forming a plurality of elongate members into a helical bundle in which a pair of bending die assemblies are mounted on a moveable carriage, the moveable carriage itself being supported by a frame. The bending dies each have a plurality of grooved rollers that engage the sides of the tubes to apply a bending force while allowing the tubes to move longitudinally through the die assemblies. The die assemblies can be rotated independent of each other or in unison by means of stepper motors. A collet, attached to the frame, holds the ends of the tubes during the bending operation.
US09517491B2
A method and apparatus for sorting objects is described, and which provides high-speed image data acquisition to fuse multiple data streams in real-time, while avoiding destructive interference when individual sensors or detectors are utilized in providing data regarding features of a product to be inspected.
US09517490B2
An irradiation device including at least one radiation source, which emits both UV-radiation and W-radiation, i.e. visible light and/or IR radiation. The device includes a transport device for delivering substrates to be irradiated. At least one wavelength-selective filter reflects UV-radiation at an angle of 45° and transmits W-radiation. Means for the absorption of IR radiation are arranged downstream of the optical filter in the propagation direction in the beam path of the W-radiation not deflected by the wavelength-selective filter. The means for the absorption of IR radiation are also designed to absorb visible light and UV rays, and the irradiation device includes movement means in order to guide the wavelength-selective filter into and out of the beam path of the radiation source.
US09517478B2
A spray assembly for dispensing a mixture is provided. The spray assembly includes a connector configured for operable engagement with a first and second source of component and a source of pressurized fluid, and a tip operably connected to the connector. The tip includes an opening and defines a mixing chamber between the connector and the opening of the tip, and an insert member configured to be received in the mixing chamber. The insert member includes a plurality of radially extending slots on at least one end of the insert. The plurality of radially extending slots is configured to mix the first and second components prior to the mixture exiting the opening in the tip.
US09517477B2
A centrifuge includes: a driving unit; a rotor configured to be rotated by the driving unit and hold a sample; a control unit configured to control rotation of the driving unit; and a communication controller configured to communicate with an external network. The control unit has an automatic transmission mode in which operation data is collected at predetermined intervals while the centrifuge is operating and the operation data is periodically transmitted to a data managing apparatus through the network.
US09517471B1
A sorbent composition with improved acid gas reactivity comprising calcium hydroxide particles is provided. In the calcium hydroxide composition, about 90% percent of the calcium hydroxide particles are less than or equal to about 10 microns; the ratio of 90% of the calcium hydroxide particles below a specified size to the ratio of 10% of the calcium hydroxide particles above a specified size is less than about 8; and the calcium hydroxide particles have a BET surface area of about 18 m2/g or greater.
US09517470B2
The invention relates to an agitator ball mill having a vertically arranged container, in which there an agitator that can be rotated about a vertical axis is arranged, and having at least one wear prevention element that can be fitted to the container inner wall with the aid of a fixing system, wherein the fixing system comprises a fixing pin and a fixing cut-out, which are arranged on the container inner wall and/or the rear side of the wear prevention element in such a way that the wear prevention element can be fixed to the container inner wall by means of a movement of the wear prevention element in a direction which forms an angle α>0° with the vertical axis of the rotatable agitator, in that the fixing pin is guided into the fixing cut-out.
US09517461B2
Described is an iron-containing zeolite wherein the number of iron sites, based on the zeolite, is greater than the number of cationic positions in the zeolite. Also described is an iron-containing zeolite preparable by gas phase reaction with iron pentacarbonyl, said zeolite having a greater specific surface area than iron-containing zeolites prepared analogously by ion exchange and/or being more hydrothermally stable than iron-containing zeolites prepared analogously by ion exchange, or wherein the number of iron clusters larger than 10 nm is less than 15% by weight, based on the total amount of iron. Further described is a process for preparing an iron-containing zeolitic material, which comprises doping with iron by means of a gas phase reaction using iron pentacarbonyl. Further described is a process for catalytic reduction of nitrogen oxides using catalysts comprising said iron-containing zeolitic materials.
US09517460B2
The present application relates to a method for fabricating hollow nano particles supported on carrier.
US09517459B2
Provided is a photocatalytic coating film that can develop excellent photocatalytic activity and exhibit superior adhesion to an adherend surface.The photocatalytic coating film is obtained by applying and drying a photocatalytic coating composition containing at least rod-like or needle-like titanium oxide particles and a binder component so that the photocatalytic coating film contains the titanium oxide particles in a content of 0.5 g/m2 or more. The photocatalytic coating film contains the titanium oxide particle in a content per unit volume (1 m2 by 1 μm thick) of less than 3.0 g. The titanium oxide particles preferably have an aspect ratio of 1.5 or more, the aspect ratio specified as the ratio of a long side length to a short side length of particle. The compositional ratio (by weight) of the titanium oxide particles to the binder component in the photocatalytic coating film is preferably from 1:6 to 30:1.
US09517458B2
There is disclosed a microporous crystalline material having pore opening ranging from 3 to 5 Angstroms, where the material comprises a first metal chosen from alkali earth group, rare earth group, alkali group, or mixtures thereof, and a second metal chosen from iron, copper or mixtures thereof; and has a molar silica to alumina ratio (SAR) from 3 to 10. The microporous crystalline material disclosed herein may comprise a crystal structure having building units of double-6-rings (d6r) and pore opening of 8-rings as exemplified with framework types defined by the Structure Commission of the International Zeolite Association having structural codes of CHA, LEV, AEI, AFT, AFX, EAB, ERI, KFI, SAT, TSC, and SAV. There is also disclosed a method of selective catalytic reduction of nitrogen oxides in exhaust gas, comprising at least partially contacting the exhaust gases with an article comprising the disclosed microporous crystalline material.
US09517457B2
Systems, apparatus and methods are disclosed for reducing the amount of nitrous oxide (N2O) produced in a selective catalytic reductant (SCR) catalyst in an exhaust aftertreatment system. The SCR catalysts are arranged to reduce the amount of N2O produced during NOx reduction while not adversely affecting NOx conversion.
US09517453B2
Methods for enhancing the mesoporosity of a zeolite-containing material. Such methods may comprise contacting a composite shaped article containing at least one zeolite and at least one non-zeolitic material with at least one pH controlling agent and at least one surfactant. Such methods may be performed under conditions sufficient to increase the pore volume of at least one 10 angstrom subset of mesoporosity.
US09517451B2
A process for preparing a propane oxidation catalyst, the process comprising pre-calcining the catalyst precursor in an oxygen-containing gas at a temperature of less than 330° C. until the weight of the precursor stabilizes to obtain a pre-calcined precursor; then calcining the pre-calcined precursor to obtain the catalyst.
US09517443B2
A device for polymerizing lactams in molds, comprising: a reservoir for storing lactam, wherein said reservoir is kept at a temperature which varies in the range of 135-150° C. for melting the lactam and keeping it in melted state; lactam feeding means comprising dosing pipes for feeding the lactam from the reservoir, first dosing means for feeding an initiator; second dosing means for feeding an activator; a mixing head configured to receive the lactam, the initiator and the activator from respectively said lactam feeding means, said first dosing means and said second dosing means. The initiator and activator are liquid, and the cited reservoir and lactam feeding means are located within a heater configured to maintain the temperature of the lactam at a substantially constant value until it reaches the mixing head.
US09517434B2
A catalyst system for exhaust gas purification which comprises a first-stage base metal catalyst located upstream and a second-stage base metal catalyst located downstream, wherein the first-stage base metal catalyst comprises at least one oxide support selected from the group consisting of alumina, ceria, zirconia, yttria, and titania and Cu metal and/or a Cu oxide supported thereon, and in cases where the amount of NOx in the exhaust gas has become or exceeded an NOx criterion, the state of the exhaust gas is switched from slightly rich to rich.
US09517424B2
Embodiments of the present disclosure provide metal ligand nanoparticles, particles including the metal ligand nanoparticles, filters including the metal ligand nanoparticles and/or particles, devices and systems for filtering a fluid, compositions including the metal ligand nanoparticles, and the like.
US09517421B1
A novelty toy, apparel, or jewelry, device for fanciful detection of ghosts, or other paranormal phenomena, through exploitation of Hall Effect, or of thermochromic material.
US09517415B2
A method and system for generating augmented reality with a display of a vehicle is provided. The method comprises recording an image of an environment of the vehicle in the form of image data, determining a virtual space in three dimensions from the image data, and detecting a real object in the image data. The method further comprises determining a first coordinate range of the real object in the three dimensional virtual space, adding a virtual element to the three dimensional virtual space, and controlling the virtual element in the three dimensional virtual space based on a user input. The method further comprises outputting the environment and the controlled virtual element in combined form in an output image, modifying the output image when the first coordinate range of the real object and a second coordinate range of the controlled virtual element form an intersection area, and displaying the output image.
US09517406B2
Apparel is disclosed that can be worn to assist an interactive game in tracking the movement of the wearer. More particularly, the apparel may include one or more tracking marks formed of designs, patterns, or reflective materials that can be easily tracked by an interactive game employing one or more cameras or other detectors for detecting a change in position of an object. The apparel may take the form of, for example, hats, shirts, jackets, pants, gloves, and shoes. The apparel may use reflective materials, and the interactive game can employ a camera and a light source configuration where the camera is located within the observation angle of a player employing retroreflective materials reflecting light from the light source.
US09517400B2
A mouth guard composed of a polymer consisting essentially of polycaprolactone exhibits a low softening point, enabling it to be easily custom-fitted by the user or a health professional. The material is provided in the form of a generally U-shaped, unformed sheet of material, enabling the material to be heated with hot water or microwave energy and custom-fitted to the dentition of a user. The mouth guard may be perforated and may include a no-stick layer and/or a flavoring agent. A plurality of mouth guards may be provided in different sizes for children and adults and different shapes for different sports. In the preferred embodiments the mouth guard has a periphery including a plurality of lobes and cusps to enhance fitting. A method of fabricating an improved mouth guard according to the invention is also disclosed.
US09517398B2
An extra-long air-water sandbag includes an inner bladder and an external bag. The external bag is a bag to hold the inner bladder and covers the external of the inner bladder. The inner bladder further includes an inner and outer layer container set which includes a gas container and a liquid container, and an extension layer gas container which is a bladder for containing gas and housed at the top, bottom or top and bottom thereof to increase the total length of space of gas container of the punching bag. As the length of gas container is increased, combat training for the feet is hence achieved.
US09517392B2
An iron-type golf club head has a face for hitting a ball, a sole extending backward from the lower edge of the face and extending in the toe-heel direction of the head so as to define the bottom surface of the club head, and a hosel extending upward in a heel-side of the face and provided with a shaft inserting hole. The club head is composed of a head main body including the face, and a weight member having a specific gravity larger than that of the head main body and fixed to the head main body. The weight member integrally includes a first part extending in the toe-heel direction in the sole, and a second part constituting at least substantial portion of the hosel.
US09517380B2
A device for exercising leg muscles, ligaments, and tendons attendant to movement of a human knee following knee replacement surgery or during rehabilitation following knee injury is provided. The user lies supine on a flat surface and braces the back of his or her upper thigh against the device's leg support bar, so that the user's upper thigh is approximately perpendicular to the user's upper torso. The patient maintains this position and exercises the knee by extending and flexing his or her lower leg. Some embodiments include an elastic band that attaches to the device in a position that limits the degree of leg flexion to within a desired range. Some embodiments include an ankle strap attached to a cord, which may be used to build quadriceps strength through application of resistance, and/or for applying downward pulling force to the lower leg during passive range-of-motion exercising.
US09517376B2
The invention encompasses a removable attachment for installing on a bicycle with the goal of altering the resistance to either front tire or back tire revolution. In this way, the bicycle includes enhanced physical training capabilities allowing the rider to use a bicycle on a standard trainer frame or as a regular bicycle for riding in the usual manner. In one embodiment, the attachment includes a resistance support connected to a bicycle and supporting a resistance device that engages a bicycle wheel or bicycle tire for altering the resistance to tire revolution. In this exemplary embodiment, the apparatus includes a resistance support attached to the bicycle proximate a bicycle tire along with a resistance device removably attached to the resistance support. In one embodiment, the resistance device defines a slot, and the resistance support projects through the slot to position the resistance device against the bicycle wheel or the bicycle tire.
US09517375B2
An exercise machine support system for providing increased versatility including inclination or declination of an exercise surface, a reduction in the overall length and width of the exercise machine, and an enhanced user interface which reduces the risk of injury. The exercise machine support system generally includes a cantilevered exercise machine which is adapted to have a variable angle of incline or decline with respect to a horizontal ground surface. The exercise machine will generally include a base and a support which extends between the base and the exercise machine. The upper end of the support is connected to the exercise machine by a first pivot such that the exercise machine pivots about the support. An adjustment device may be utilized to pivot the exercise machine and thus adjust its angle of incline. Various types of adjustment devices are disclosed, including an actuator, ratchet-and-pawl, gears, and cam.
US09517372B2
The invention provides a novel bentonite-fiberglass fire blanket, comprising: bentonite and fiberglass and an optional mesh fabric, such as cheesecloth.
US09517362B1
An assisted-rescue and personal evacuation system preferably includes a deployment bag, an equipment tether, a stop tether, a flexible anchor strap, a descender system, at least two carabiners and a rescue hitch system. The deployment bag includes a bag portion, an end flap, a rope protector and a pair of snap hooks. The equipment tether includes a tether strap and a tether loop. The tether loop is used to retain all of the rescue components. The stop tether preferably includes a stop body, a first stop carabiner and a second stop carabiner. The descender system preferably includes a rescue rope, a descender unit, a rope carabiner and a descender carabiner. The rescue rope is inserted through the descender unit. The rescue hitch system includes a hitch strap, a micro rope grab and a hitch carabiner. A micro haul device provides a 6:1 mechanical advantage for self or assisted rescue.
US09517357B2
Provided herein are silk fibroin-based photothermal elements and uses thereof. The silk fibroin-based photothermal elements comprise a plurality of plasmonic nanoparticle distributed in a silk fibroin matrix, and can generate heat when the plasmonic nanoparticles are exposed to electromagnetic radiation. The silk fibroin-based photothermal elements can be adapted to be conformable and biodegradable, and can further be integrated with various electronic components, such as a thermo-electric device for conversion of heat into electricity. The invention is useful for various in vivo applications, such as photothermal therapy, controlled drug-delivery devices or wireless powering of implanted micro-devices.
US09517356B2
An optical therapeutic apparatus includes an ear shield for covering a wearer's ear, which has a plurality of acupuncture points; a hanging member including a connection portion connected to the ear shield; and a plurality of light emitters disposed within an interior portion of the ear shield in array manner to face the plurality of acupuncture points respectively. The plurality of light emitters includes a plurality of acupoint-stimulation elements, each corresponding to a respective one of the acupuncture points, at least two sets of the acupoint-stimulation elements are capable of emitting stimulation light beams at different time intervals.
US09517348B2
An implantable cardiac therapy device having a heart assist pump, a stimulation unit, and a control unit. The heart assist pump is designed to be connected to a ventricle of a heart and an associated artery, and is designed to pump blood from a particular ventricle into an associated artery, thereby supporting the particular ventricle. The stimulation unit is designed to electrically stimulate a heart contraction, and the control unit is designed to control the heart assist pump and the stimulation unit in such a way that the stimulation unit induces synchronized motions of cardiac contraction while the heart assist pump operates in a ventricle-supporting manner.
US09517347B2
An implantable pulse generator (IPG) that generates spinal cord stimulation signals for a human body includes an electrode driver for each electrode, which adjusts the amplitude of the timing signals and output an output current corresponding to the adjusted signals for transmission to the associated electrode so as to enable independent amplitude control of the stimulation signals for each stimulation pattern channel.
US09517342B2
The system includes five components: (1) a sensor array, (2) a processor, (3) a transmitter, (4) a receiver-stimulator, and (5) an implantable electrode array. The olfactory implant system generates odor fingerprints by detecting odors with an array of chemical sensors and then transmitting variable spatio-temporal stimulation patterns for an electrode array with electrode stimulating points positioned at different locations in the olfactory cortex (e.g., stimulating the olfactory bulb). Different patterns of activity in the olfactory cortex are thereby generated which mimic the sense of smell in a subject. Once trained the system should be usable by a subject to detect or correctly identify one or more odors.
US09517340B2
A hybrid method is provided for modulating upper airway function in a subject. The method includes applying first and second therapy signals to the subject to modulate at least one extrinsic laryngeal muscle and at least one intrinsic laryngeal muscle to synergistically control laryngeal motion and vocal fold movement, respectively.
US09517336B2
A fixation member of an electrode assembly for an implantable medical device includes a tissue engaging portion extending along a circular path, between a piercing distal tip thereof and a fixed end of the member. The circular path extends around a longitudinal axis of the assembly. A helical structure of the assembly, which includes an electrode surface formed thereon and a piercing distal tip, also extends around the longitudinal axis and is located within a perimeter of the circular path. The tissue engaging portion of the fixation member extends from the distal tip thereof in a direction along the circular path that is the same as that in which the helical structure extends from the distal tip thereof. The electrode assembly may include a pair of the fixation members, wherein each tissue engaging portion may extend approximately one half turn along the circular path.
US09517330B2
A safety device is described wherein drug delivery systems and methods involve associating unique keys to patients that prevent the interconnection between a drug delivery device and non-complimentary patient key. Medication in a drug delivery device intended for a patient may only be accessed via a particular unique key associated with the intravenous access device of that patient.
US09517322B2
A flowmeter comprises a lower valve body (1), a throttle assembly, a flow tube assembly, an upper valve body (2), and a pressure fluctuation suppression assembly. An air inlet, an air outlet and an air flow channel connecting the air inlet and the air outlet are arranged in the lower valve body (1); a throttle assembly for adjusting the degree of opening of the air flow channel in the lower valve body (1) is further disposed on the lower valve body (1). The flow tube assembly comprises a flow tube (3), an upper base (4), a lower base (5), and a float (6); a vent hole is provided on each of axial centers of the upper base (4) and the lower base (5); the lower base (5) is arranged at the air outlet of the lower valve body (1); a vertical air flow passage and a horizontal air flow passage are arranged in the upper valve body (2); the upper base (4) is arranged at an air inlet of the vertical air flow passage in the upper valve body (2); the flow tube (3) is disposed between the upper base (4) and the lower base (5) through two ends thereof that are respectively sleeved on protruding portions of the upper base (4) and the lower base (5); the float (6) is disposed in the flow tube (3). The pressure fluctuation suppression assembly comprises a sealing gasket (7), and the sealing gasket (7) is disposed at an air outlet of the vertical air flow passage.
US09517318B2
The invention concerns a nasal cannula assembly (10) adapted to deliver gases to a patient comprising a first compartment (1) and a second compartment (2) separated by a separation wall (6); a pair of nasal prongs (5) in fluid communication with the first compartment (1); the first compartment (1) comprising a first inlet (11) for introducing a first gas into said first compartment (1); the second compartment (2) comprising a second inlet (2) for introducing a second gas into said second compartment (2); and the separation wall (6) comprising at least one flow restriction element (35) for controlling the passage of gas from the second compartment (2) to the first compartment (1).
US09517310B2
A resettable dose setting mechanism for a drug delivery device comprising a driver for driving a spindle of the drug delivery device is provided. Said driver comprises a first component and a second component rotationally coupled to said first component. During resetting of said drug delivery device, said first component is rotationally decoupled from said second component.
US09517307B2
An apparatus includes a container, a needle, and an actuation assembly. The container contains a dose of a naloxone composition having a delivered volume of at least about 0.34 mL. The actuation assembly includes an energy storage member that produces a force on a movable member to move the needle and to deliver the dose of the naloxone composition. The 90% confidence interval of at least one of the relative mean maximum naloxone plasma concentration after dose delivery into the body (Cmax), time to reach the maximum naloxone plasma concentration (Tmax), area under the plasma concentration-time curve from pre-dose (time 0) extrapolated to infinity (AUC0-∞), or area under the plasma concentration-time curve from pre-dose (time 0) to the time of the last quantifiable concentration (Tlast) (AUC0-t) of the delivered dose to a delivered dose of a corresponding naloxone composition delivered via a manually-actuated syringe is within 80% to 125%.
US09517302B2
A method of alerting a user to a potential unintended bolus delivery includes delivering fluid to a patient along a first fluid flow path. The method also includes transmitting a signal prior to initiation of a change in fluid delivery to the patient along a second fluid flow path connected to the first fluid flow path upstream of the patient, and detecting the signal. The method further includes actuating an alarm to alert the user to a potential unintended bolus delivery if the signal is detected. A system for carrying out the method is also provided.
US09517297B2
Apparatus for transdermal or subcutaneous delivery of a bioactive solution, including a plurality of needles fixed on a needle carrier in a spaced apart relationship and projecting from the needle carrier, each needle having a tip zone adapted to receive an amount of bioactive solution from a reservoir coupled to the needle carrier and to deliver the bioactive solution upon penetrating a skin.
US09517294B2
The present invention provides a suction sequence which is considered to produce advantageous results, particularly for mothers with newborn infants. The sequence comprises a process of stimulation, expression, and pausing to closely mimic a newborn's sucking pattern.
US09517291B2
Implantable biocompatible polymeric medical devices include a substrate with an acid or base-modified surface which is subsequently modified to include click reactive members.
US09517280B2
Germicidal light fixtures and germicidal light fixture systems. One embodiment of a germicidal light fixture includes a support structure and at least one first lighting device coupled with the support structure operative to emit ultraviolet radiation at a first predetermined wavelength. At least one second lighting device is coupled with the support structure and is operative to emit ultraviolet radiation at a second predetermined wavelength. The first and second predetermined wavelengths are selected such that ultraviolet radiation emitted from the at least one first lighting device and from the at least one second lighting device, respectively, is operative to inactivate microorganisms. At least one third lighting device is coupled with the support structure and is operative to emit visible radiation.
US09517277B2
Provides is a therapeutic technology that combines the phototoxic and immune-stimulating ability of photodynamic therapy with the widespread effectiveness of the immune system to reduce the viability of such as cancer cells and tumors. The nanoparticle compositions of the disclosure combine an immunostimulant with a photosensitizer using a nanoparticle delivery platform. For example, zinc pthalocyanine, which is a long-wavelength absorbing photosensitizer, integrated into a polymeric nanoparticle core made up of poly(D,L-lactic-co-glycolic acid)-b-poly(ethylene glycol) (PLGA-b-PEG). The outside surface of the core can be coated with metallic nanoparticles, which are then modified with CpG-ODN. Metastatic mouse breast carcinoma cells showed significant photocytotoxicity of the hybrid after irradiation with a 660 nm LASER light and this activity was remarkably better than either treatment alone. Treatment of mouse bone marrow derived dendritic cells with the photodynamic therapy-killed 4T1 cell lysate showed that the combination of photodynamic therapy with a synergistic immunostimulant in a single nanoparticle system resulted in an immune response suitable for the treatment of such as a metastatic cancer.
US09517276B2
The invention relates generally to compositions and methods for conjugating antibodies and activatable antibodies, and methods of partially reducing antibodies and/or activatable antibodies prior to conjugation, e.g., thiol-based conjugation, with an agent, e.g., a therapeutic and/or diagnostic agent.
US09517275B2
Provided herein are compositions and methods for targeted drug delivery to prevent restenosis in the cardiovascular system. In particular, provided herein are nanoscale delivery vehicles for drugs that prevent proliferation and neointimal hyperplasia.
US09517274B2
The invention provides eTEC linked glycoconjugates comprising a saccharide covalently conjugated to a carrier protein through a (2-((2-oxoethyl)thio)ethyl)carbamate (eTEC) spacer, immunogenic compositions comprising such glycoconjugates, and methods for the preparation and use of such glycoconjugates and immunogenic compositions.
US09517270B2
Polymers produced by ring opening polymerization which comprises an amino group that can be used in compositions to deliver a nucleic acid such as a miRNA or a siRNA. In some embodiments, compositions which comprise the polymers described herein and a nucleic acid are also provided herein. In some embodiments, these compositions are used to silence one or more genes in vivo or treat a disease or disorder.
US09517267B2
The objects of the present invention are to inhibit photobleaching of porphyrins as well as to provide a superior photodynamic diagnostic agent and a photodynamic diagnostic method employing the photobleaching inhibitor for porphyrins. The present invention provides a photodynamic diagnostic agent containing a precursor of porphyrins and a gallic acid. The present invention also provides a photobleaching inhibitor for porphyrins containing a gallic acid.
US09517264B2
The present invention provides compositions and methods relating to or derived from antigen binding proteins and antigen binding protein-FGF21 fusions that specifically bind to β-Klotho, or β-Klotho and one or more of FGFR1c, FGFR2c, FGFR3c, and FGFR4. In some embodiments the antigen binding proteins and antigen binding protein-FGF21 fusions induce FGF21-like signaling. In some embodiments, an antigen binding protein or antigen binding protein-FGF21 fusion antigen binding component is a fully human, humanized, or chimeric antibody, binding fragments and derivatives of such antibodies, and polypeptides that specifically bind to β-Klotho, or β-Klotho and one or more of FGFR1c, FGFR2c, FGFR3c, and FGFR4. Other embodiments provide nucleic acids encoding such antigen binding proteins and antigen binding protein-FGF21 fusions, and fragments and derivatives thereof, and polypeptides, cells comprising such polynucleotides, methods of making such antigen binding proteins and antigen binding protein-FGF21 fusions, and fragments and derivatives thereof, and polypeptides, and methods of using such antigen binding proteins and antigen binding protein-FGF21 fusions, fragments and derivatives thereof, and polypeptides, including methods of treating or diagnosing subjects suffering from type 2 diabetes, obesity, NASH, metabolic syndrome and related disorders or conditions.
US09517261B2
The present invention relates to an Epstein-Barr virus-like particle (EB-VLP) substantially free of Epstein-Barr Virus (EBV) DNA. The present invention also relates to a polynucleotide comprising an EBV genome a) lacking at least one expressible gene selected from the group consisting of the BFLF1 gene, the BBRF gene, the BGRF1 gene, the BDRF1 gene, the BALF3 gene, the BFRF1A gene, and the BFRF1 gene, and b) producing the EB-VLP of the invention in a suitable host cell. The present invention further relates to a vector and a host cell comprising the polynucleotide of the invention as well to a method of manufacturing the EB-VLPs, a method of manufacturing a vaccine thereof, a vaccine and a composition comprising the EB-VLPs.
US09517248B2
A method of treating ischemia in a subject in need thereof is disclosed. The method comprising administering to the subject a therapeutically effective amount of adherent cells of a tissue selected from the group consisting of a placenta and an adipose tissue, thereby treating the ischemia in the subject. A method of treating a medical condition requiring connective tissue regeneration and/or repair is also disclosed.
US09517246B2
The present disclosure provides a polymer comprising a derivative of chitosan, wherein the derivative is zwitterionic, as well as methods of using the polymer. In addition, the present disclosure provides a nanoparticle structure comprising a derivative of chitosan and a dendrimer, as well as methods of utilizing the nanoparticle structure.
US09517244B2
The invention features compositions and methods that are useful for the treatment of neoplasia (e.g., pancreatic cancer, colon cancer, brain cancer) by increasing DNA damage, reducing nucleotide synthesis, and reducing base excision repair (BER).
US09517242B2
Oral dosage forms of bisphosphonate compounds, such as zoledronic acid, can be used to treat or alleviate pain or related conditions. The bioavailability of zoledronic acid can be enhanced by administering the zoledronic acid in the disodium salt form.
US09517236B2
A solid oral controlled-release dosage form of hydrocodone is disclosed, the dosage form comprising an analgesically effective amount of hydrocodone or a pharmaceutically acceptable salt thereof, and controlled release material.
US09517235B2
The present invention relates to the discovery of a novel opioid modulator effective in reducing pharmacologically induced weight gain associated with atypical antipsychotic use. The present invention provides methods of reducing antipsychotic induced weight gain, methods for suppressing food intake and reducing ghrelin levels induced by atypical antipsychotic medications in a patient.
US09517234B2
Drug formulations, methods and their use in treatment of diseases using formulations of pure di-acid salts of tetrandrine family members, especially d-tetrandrine di-hydrochloride, combined with a pharmaceutical diluent or carrier.
US09517233B2
Statin compositions are disclosed for stimulating neurite growth from spiral ganglion neurons in the inner ear, as well as methods and kits for preventing damage to or treating damage of auditory neurons and/or hair cells of the cochlea following acoustic or toxic insult. An exemplary statin for these methods and kits includes Pitavastatin having the compound formula (VIII):
US09517229B2
The disclosure describes the use of one or more compounds that fall within the scope of one or more of structural formulae I, II, III, IV, V, or VI for treating triple negative breast Compounds useful for treating breast cancer include those compounds of formulae I, II, III, IV, V, or VI that inhibit proliferation of breast cancer cells and/or lead to the death of breast cancer cells, especially triple negative breast cancer.
US09517227B2
Novel dihydropyrazole derivatives of formula (I) wherein L, R, R3, R4, R5, R6, R7, X1, X2, X3, X4, Y, m and n have the meaning according to the claims, are positive allosteric modulators of the FSH receptor, and can be employed, inter alia, for the treatment of fertility disorders.
US09517219B2
Dapsone and dapsone/adapalene compositions can be useful for treating a variety of dermatological conditions. The compositions of this disclosure include dapsone and/or adapalene in a polymeric viscosity builder. Subject compositions can be adjusted to optimize the dermal delivery profile of dapsone to effectively treat dermatological conditions and improve the efficiency of pharmaceutical products applied to the skin. Use of the polymeric viscosity builder provides compositions with increased concentrations of diethylene glycol monoethyl ether relative to compositions without the polymeric viscosity builder.
US09517216B2
A pharmaceutical composition is described that is suitable for delivery from a pressurized container. The composition is free of polar excipients and comprises: (a) a propellant component that consists essentially of 1,1-difluoroethane (R-152a); (b) a surfactant component that comprises oleic acid; and (c) a drug component that consists of salbutamol sulphate. The pharmaceutical composition can be delivered using a metered dose inhaler (MDI).
US09517210B2
A method for producing a microcapsule powder includes a concentration step. In the concentration step, an aqueous dispersion of a microcapsule is supplied into a cyclone, and the aqueous dispersion is then concentrated. The concentration step includes an aqueous dispersion-supplying step and a concentrated dispersion-recovering step. In the aqueous dispersion-supplying step, the aqueous dispersion is supplied into a cylindrical member inlet. In the concentrated dispersion-recovering step, a microcapsule dispersion is recovered. The microcapsule dispersion is discharged through a conical member outlet.
US09517207B2
Disclosed in certain embodiments is a controlled release oral dosage form comprising a therapeutically effective amount of a drug susceptible to abuse together with one or more pharmaceutically acceptable excipients; the dosage form further including a gelling agent in an effective amount to impart a viscosity unsuitable for administration selected from the group consisting of parenteral and nasal administration to a solubilized mixture formed when the dosage form is crushed and mixed with from about 0.5 to about 10 ml of an aqueous liquid; the dosage form providing a therapeutic effect for at least about 12 hours when orally administered to a human patient.
US09517205B2
Influenza vaccines are administered using solid biodegradable microneedles. The microneedles are fabricated from the influenza vaccine in combination with solid excipient(s) and, after penetrating the skin, they dissolve in situ and release the vaccine to the immune system. The influenza vaccine is (i) a purified influenza virus surface antigen vaccine, rather than a live vaccine or a whole-virus or split inactivated vaccine (ii) an influenza vaccine prepared from viruses grown in cell culture, not eggs, (iii) a monovalent influenza vaccine e.g. for immunizing against a pandemic strain, (iv) a bivalent vaccine, (v) a tetravalent or >4-valent vaccine, (vi) a mercury-free vaccine, or (vii) a gelatin-free vaccine.
US09517202B2
The present invention is directed to phospholipid compositions and methods of preparation of phospholipid depots that are injectable through a fine needle. The phospholipid depots prepared by the methods described herein comprise nanometer-sized phospholipid particles and exhibit a higher degree of structural order compared to compositions prepared by other methods.
US09517201B2
Novel classes of multi-arm polyalkylene oxide-based materials including PEG nanocarriers, nanogel particles, and aggregated nanogel particles are disclosed. These classes of compositions may be associated with therapeutic agents and targeting moieties, or visibility enhancing agents, and may have a modified surface structure. In some embodiments the PEG-based materials can be made to provide relatively high drug loads with improved solubility and targeted delivery.
US09517193B2
Antiperspirant/deodorant compositions have lower, or even zero amounts of aluminum and/or zirconium antiperspirant actives. A polymer having one or more anhydride and/or diacid moieties, such as succinic (maleic) anhydride and/or diacid. The antiperspirant/deodorant compositions comprise a polymer with a non-zero acid value and a cationic species, which may be a cationic polymer, cationic molecule, cation, and/or a cationic carrier. Product are formed for the antiperspirant/deodorant composition, as well as a method of treating perspiration.
US09517191B2
A composition is disclosed that includes pure silk fibroin-based protein fragments that are substantially devoid of sericin, wherein the composition has an average weight average molecular weight ranging from about 17 kDa to about 38 kDa, wherein the composition has a polydispersity of between about 1.5 and about 3.0, wherein the composition is substantially homogeneous, wherein the composition between 0 ppm to about 500 ppm of inorganic residuals, and wherein the composition includes between 0 ppm to about 500 ppm of organic residuals.
US09517184B2
A feeding tube assembly for insertion and delivery of nutrients into an alimentary canal is disclosed. A method of facilitating the use of the feeding tube with an insufflation device is also disclosed. The feeding tube assembly has a feeding tube with opposite proximal and distal ends, a feeding passage extending between the proximal and distal ends, an outlet proximate the distal end and in fluid communication with the feeding passage, a port at the proximal end and in fluid communication with the outlet; and an air insufflation device fluidly connectable to the port comprising a compressible air bulb having a bulb inlet and a bulb outlet; an inlet check valve at the bulb inlet, an outlet check valve at the bulb outlet, and a relief valve fluidly connected to the bulb outlet.
US09517173B1
Some embodiments of the present disclosure include a stretching device for stretching and aligning a user's back. The stretching device may include a belt configured to wrap around the user's back and under the user's armpits and a first ring attached to a first end of the belt and a second ring attached to a second end of the belt, wherein the first ring and the second ring may engage with a hook such that the device may hang from a support system, using gravity to stretch and align the user's back.
US09517169B2
An absorbent article having a plurality of granular particles placed between two liquid-permeable non-woven fabric sheets, the article including: a high-strength bonded portion formed in a loop-shaped pattern on the article such that the two non-woven fabric sheets are not separated even if the granular particles swell to thereby apply a separating force to a bonded position between the two non-woven fabric sheets; and a low-strength bonded portion formed in an inner area surrounded by the high-strength bonded portion such that the two non-woven fabric sheets are separated from each other at a bonded position when the granular particles swell to thereby apply a separating force to the bonded position between the two non-woven fabric sheets.
US09517167B2
A disposable diaper includes: a pair of leg stretch units formed along a leg hole openings and being stretchable in at least a product longitudinal direction; and a cushioning unit provided adjacent to each of ends of the leg stretch units in the product longitudinal direction. Each of the leg stretch units is configured from a stretchable sheet member. A ratio of expansion and contraction of each of the cushioning units is lower than a ratio of expansion and contraction of the leg stretch units. At least a part of each of the cushioning units has a dimension in a product widthwise direction greater than a width of the leg stretch units in the product widthwise direction.
US09517166B2
An inflatable device for insertion into a user's nose for controlling nasal exudation has an elongated shaft including at least one lumen for accommodating a fluid (15); an inflatable balloon (25) connected to the shaft, the balloon (25) being in fluid connection to the lumen; and an absorber (19, 33) for absorbing nasal exudates, the absorber (19, 33) being disposed at an outer circumference of the shaft and/or at a distal tip portion (9) of the device. Another inflatable device for insertion into a user's nose for controlling nasal exudation has an elongated shaft including at least one lumen for accommodating a fluid (15); and an inflatable balloon (25) connected to the shaft, the balloon (25) being in fluid connection to the lumen; the balloon (25) containing a cooling agent (29), wherein the cooling agent (29) is configured to cool the balloon (25) when coming into contact with the fluid (15).
US09517165B2
A method for obtaining temporary non-stretchability characteristics, mainly in a machine direction, in a non-woven fabric having any level of stretchability, in order to ease converting is disclosed. The non-stretchability characteristics can be then eliminated in order to restore the original characteristics of the non-woven fabric. This technique allows the formation of final products comprising stretchable non-woven fabrics by converting machines.
US09517159B2
Contraceptive and/or sterilization methods and devices are disclosed which may improve the speed of tubal occlusion and mechanisms for anchoring for a contraceptive device. In accordance with some embodiments, improvements may be made to the delivery catheter to induce trauma and create faster tubal occlusion, improvements may be made to the occlusion device to prevent migration and induce trauma, and improvements may be made to the occlusion device to reduce the total volume of in-growth required compared to conventional expansive occlusion devices.
US09517156B2
The invention relates to a device for fixing a test person on a standing surface, wherein at least one rope is tensioned between a hip belt placed on the test person and a retaining plate arranged below the standing surface.
US09517148B2
The disclosure of the present application provides devices, systems, and methods for the prevention of stroke. In at least one embodiment of a device of the present application, the device comprises an extension portion sized and shaped to fit within an artery extending from an aortic arch, and a flange portion sized and shaped to prevent the device from advancing into the artery extending from the aortic arch in which the device may be positioned. In at least one embodiment of a system for preventing stroke of the present application, the system comprises a hypotube, a folder coupled to a distal end of the hypotube, a sleeve positioned circumferentially around the hypotube proximal to the folder, and a stent, wherein a first part of the stent may be positioned within the folder, and wherein a second part of the stent may be positioned within the sleeve.
US09517145B2
An orthopedic device includes a patient-specific acetabular guide that can be used for preparing an acetabulum of a patient to receive an acetabular implant and/or placement of an acetabular prosthesis. The acetabular guide has a body with an outer three-dimensional surface configured to match an acetabulum of a specific patient's hip joint designed from data of the patient's hip joint. The acetabular guide can further include a peripheral annular rim.
US09517144B2
In some embodiments, an intervertebral implant may include a body including a superior and an inferior surface. The implant may include a first channel extending from an anterior end towards the posterior end of the body. The implant may include a first anchor channel The implant may include a first guide member positionable in the first channel The implant may include a first anchor. When the first guide member moves from a first position to a second position the first anchor may be conveyed through the first anchor channel and couple the body to an adjacent vertebra.
US09517139B2
A prosthesis assembly for use with a scapula in one embodiment includes an acromion spacer unit, a first articulation surface on an inferior surface of the acromion spacer unit, a bone contacting surface on a superior surface of the acromion spacer unit, and a bone mounting member extending sideways from the acromion spacer unit and oriented such that when the acromion spacer unit is mounted on a scapula, the acromion spacer unit is positioned at a height above the height of a midpoint of a glenoid fossa of the scapula.
US09517136B2
Ceramic orthopedic implants may have one or more dense inner layers and one or more porous outer layers. Methods for manufacturing the implants may include one or more stages during which the dense inner layer(s) are partially compressed. At least one porous outer layer may include coating particles that are present at a surface of one or more inner layer(s) while pressure is applied to attach the coating particles to the inner layer(s) and to further compress one or more of the inner layer(s). Various layers may be formed until an implant, or other device, is formed having the desired density gradient and/or other properties, as disclosed herein.
US09517133B2
A malleable penile prosthetic device for implantation within a penis of a user includes a columnar body and a plurality of malleable cores within the columnar body. The columnar body has a proximal end, a distal end, and a central axis extending from the proximal end to the distal end. Each of the plurality of malleable cores extends along the central axis, is angularly displaced about the central axis from neighboring malleable cores, and includes a bundle of wires surrounded by a sleeve.
US09517132B2
The present invention concerns an actuating device for actuating a mechanical adjustment element of surgical implant, said mechanical adjustment element allowing to modify the functional shape and/or the functional size of the surgical implant when actuated, said actuating device comprising transmission means linked with one end to the mechanical adjustment element and able to move the mechanical adjustment element when said transmission means are actuated, connecting means (7) mounted on the other end of the transmission means and able to actuate the transmission means, said connecting means (7) comprising coupling means and driving means (24) comprising complementary shaped coupling means, said driving means (24) being designed to be removable and fitted into the coupling means for moving the mechanical adjustment element by driving into movement a movable part of the connecting means (7).
US09517127B2
A prosthetic capsular device configured to be inserted in an eye includes a housing structure and a ring structure. The housing structure includes a first side, a second side opposite the first side, a third side, a fourth side opposite the third side, a posterior side including a refractive surface, an anterior side opposite the posterior side, and a longitudinal axis. The first side, the second side, the third side, the fourth side, the posterior side, and the anterior side at least partially define a cavity configured to contain an intraocular device (e.g., an IOL). The anterior side includes an opening. The ring structure includes a ring structure portion extending radially outward from proximate one of an end of the first side and an end of the second side.
US09517123B2
Endovascular prosthesis and a method of connecting a structural component and a woven graft material
An endovascular prosthesis that includes a stent and a woven graft material. The stent is connected to the graft material by direct attachment of the stent to the graft material at thermoplastically fused regions of the graft material.
US09517122B2
An endoprosthesis has an expanded state and an unexpanded state, the endoprosthesis includes a stent, wherein the stent has a first end, a second end, an inner surface defining a lumen, an outer surface, and a thickness defined between the inner surface and the outer surface; and a stent end covering disposed at one of the first and second ends, the stent end covering including a polymeric coating that includes a base and a plurality of protrusions, the base including a first major surface facing the outer surface of the stent, the base further including a second major surface from which each of the plurality of protrusions extends outwardly, the first major surface opposing the second major surface, wherein the protrusions are arranged in a micropattern. Methods of making and using an endoprosthesis are provided.
US09517121B2
A graft includes a flexible, resilient, generally tubular external support and a blood vessel segment, carried within and having an ablumenal surface in contact with and supported by the tubular support, the graft being capable of resilient radial expansion in a manner mimicking the radial compliance properties of an artery.
US09517119B2
The mouthpiece includes an arcuate base assembly (12), comprising two side pieces (14, 16) and an intermediate center piece (18), the two side pieces (14, 16) being connected rotatably to opposing ends of the center piece (18), such that the rear ends of the side pieces move outwardly and inwardly. A flexible screw thread spindle (30) having two side portions and a front portion is connected at the free ends thereof (33, 35) to the rear ends of the side pieces of the base assembly, such that the flexible spindle member follows the arcuate shape of the base assembly. Two side carriages (40, 42) are mounted on opposing side portions of the spindle (30), the carriages having bristles (43) mounted thereon for cleaning teeth. A motor and gear box assembly (36) are mounted at the front of the appliance for moving the two carriages along the respective side portions of the spindle (30), which have opposing screw threads. A front carriage (48) is mounted on and moves along a front spindle by a front motor and gear box (36).
US09517103B2
According to some embodiments, a medical instrument (for example, an ablation device) comprises an elongate body having a proximal end and a distal end, an energy delivery member positioned at the distal end of the elongate body, a first plurality of temperature-measurement devices carried by or positioned within the energy delivery member, the first plurality of temperature-measurement devices being thermally insulated from the energy delivery member, and a second plurality of temperature-measurement devices positioned proximal to a proximal end of the energy delivery member, the second plurality of temperature-measurement devices being thermally insulated from the energy delivery member.
US09517091B2
A spinal implant includes a locking mechanism. The locking mechanism includes an inner surface defining a tapered passageway. A tapered collet is configured for disposal in the tapered passageway. The tapered collet has an inner surface defining a passageway configured for disposal of a longitudinal member. The tapered collet is configured to translate within the tapered passageway between a non-locking orientation in which the longitudinal member is moveable relative to the tapered collet and a locking orientation in which the longitudinal member is fixed relative to the tapered collet.
US09517090B2
A device and method for coupling first and second elongate spinal fixation elements. The device includes first and second connector members, for receiving first and second elongate spinal fixation elements respectively. One or both connector members may include an engagement portion configured and dimensioned to provisionally receive an elongate fixation element with an interference fit. First and second connector members are coupled to a translation member, the translation member operatively associated with at least one connector member to provide for polyaxial movement. At least one locking member is provided to secure a received elongate spinal fixation element in the engagement portion and lock polyaxial movement of the at least one connector member. The translation member may have first and second portions which move relative to each other with translation movement, and a third locking member to lock the translation movement.
US09517082B2
The present invention generally relates to methods for preparing a skin graft without culturing or use of biologics.
US09517068B2
A surgical instrument is disclosed. The surgical instrument comprises a handle, a shaft comprising a proximal portion extending from the handle and a distal portion, and a firing member. The surgical instrument further comprises a motor, wherein the motor is configured to be operated in a first direction to advance the firing member toward the distal portion during a firing stroke, wherein the firing stroke comprises a firing stroke end, and wherein the motor is configured to be operated in a second direction to retract the firing member away from the distal portion. The surgical instrument further comprises a switch configured to detect when the firing member has reached the firing stroke end, wherein the motor is configured to be automatically operated in the second direction when the switch detects the firing stroke end.
US09517060B2
A wound closure device including a first tissue anchor with a first suture filament fixedly coupled thereto at a proximal end and extending along a length to a free distal end, and a second tissue anchor with a second suture filament fixedly coupled thereto at a proximal end and extending along a length to a free distal end. The first suture filament is configured to form a slip knot at its proximal end substantially adjacent the first tissue anchor, and the second suture is configured to form a slip knot at its proximal end substantially adjacent the second tissue anchor. The length of the first suture filament passes through the slip knot of the second suture and the length of the second suture filament passes through the slip knot of the first suture filament.
US09517050B2
An apparatus for dispensing gel for use with a medical device comprising a storage container for storing a quantity of gel of at least one gallon, a pump for delivering gel to a user, a first delivery conduit connected to the outlet of the storage container and the inlet of the pump, and a second delivery conduit connected to the outlet of the pump on one end and having a second end terminating at a location near the patient. The apparatus includes a heat source positioned proximal to the storage container for warming the gel so that is at a comfortable temperature when it is applied to a patient.
US09517044B2
A system and method to perform image acquisition of a subject is provided. The system includes a mobile device to move an imaging system across a floor, and a brake system that restrains movement of the mobile device. A controller includes a memory having program instructions to instruct a processor to perform the steps of: instructing movement of the mobile device in support of the imaging system to a first position for image acquisition of the subject; receiving feedback that the mobile device is located at the first position; and applying a brake force to restrain movement of the mobile device. The step of applying the brake force includes generating a vacuum in restraint of movement of the mobile device with respect to the floor.
US09517040B2
Embodiments include a system for providing blood flow information for a patient. The system may include at least one computer system including a touchscreen. The at least one computer system may be configured to display, on the touchscreen, a three-dimensional model representing at least a portion of an anatomical structure of the patient based on patient-specific data. The at least one computer system may also be configured to receive a first input relating to a first location on the touchscreen indicated by at least one pointing object controlled by a user, and the first location on the touchscreen may indicate a first location on the displayed three-dimensional model. The at least one computer system may be further configured to display first information on the touchscreen, and the first information may indicate a blood flow characteristic at the first location.
US09517034B2
A system that monitors various conditions of a plurality of hospital beds located in different rooms of a healthcare facility is provided. Alternatively or additionally, other types of equipment may be monitored by the system. Various configurations of network interface units that are coupleable to or integrated into a hospital bed are also disclosed. The system receives data from the hospital beds and/or other equipment and initiates a communication to a wireless communication device of at least one designated caregiver in response to the received data being indicative of an alarm condition.
US09517033B2
A magnetic resonance imaging apparatus performs myocardial perfusion imaging of an object. An imaging unit acquires image data by imaging a heart of the object in synchronism with a biological signal from the object. An image generating unit generates an image concerning the heart of the object based on the image data. The imaging unit applies a probe pulse for detecting body motion of the object before imaging of the heart, and applies a spatial non-selective saturation pulse before application of the probe pulse, and a local selective pulse for flipping back a flip angle of the spatial non-selective saturation pulse with regard to a region to which the probe pulse is applied.
US09517026B2
A biological fluid collection device that is adapted to receive a blood sample having a cellular portion and a plasma portion is disclosed. After collecting the blood sample, the biological fluid collection device is able to transfer the blood sample to a point-of-care testing device or a biological fluid separation and testing device. After transferring the blood sample, the biological fluid separation and testing device is able to separate the plasma portion from the cellular portion and analyze the blood sample and obtain test results.
US09517024B2
A non-invasive, optical-based physiological monitoring system is disclosed. In an embodiment, the non-invasive, optical-based physiological monitoring system comprises an emitter configured to emit light into a tissue site of a living patient; a detector configured to detect the emitted light after attenuation by the tissue site and output a sensor signal responsive to the detected light; and a processor configured determine, based on the sensor signal, a first physiological parameter indicative of a level of pain of the patient.
US09517000B2
Waypoints for a steerable medical device are stored as the steerable medical device is moved within a patient. The stored waypoints are an ordered sequence of locations. The ordered sequence of locations defines a safe path within the patient for moving an articulatable portion of the steerable medical device. The articulatable portion of the steerable medical device is constrained to follow the safe path as the articulatable portion moves within the patient. For example, the articulatable portion of the steerable medical device is constrained to remain within a boundary region enclosing the safe path as the articulatable portion of the steerable medical device follows the safe path.
US09516983B2
A rug cleaning head for a traditional rug cleaning application machine is improved. The spray apparatus remains prior art. The vacuum components on the underside of the cleaning head are improved with a focusing diverter arm or a pair of arms forming a “V”. The arm or arms direct the wash water into a reduced size (about a one inch slot) vacuum inlet. The result is much more wash water is collected from the rug due to the combination of a higher speed (reduced size) vacuum inlet stream and the focusing diverter's urging all the wash water into the smaller vacuum inlet. An alternate embodiment uses separate spray/vacuum inlet assemblies on a star shaped hub.
US09516976B2
A sanitary facility including a washstand of ceramic or porcelain and a piece of support furniture, which carries the washstand and has two side walls and a front wall, on the upper end surfaces of which the edges of the washstand rests. The front and side end surfaces of the washstand are processed in such a way that they are flush with the outside surfaces of the side walls and of the front wall. Veneer, covering the outside surfaces, is applied to the end surfaces of the washstand by an adhesive bond and extends up to the right-angled upper corner of the washstand.
US09516972B2
A system and method are provided for warming a nutritional substance (i.e. mother's milk or formulated liquids) for ingestion by a neonate. Structurally, the system includes a warmer for holding a container of the nutritional substance as it is simultaneously vibrated and warmed in preparation for the neonate, and it includes a controller which determines how the system will be operated. For an operation of the present invention, a user provides input to the system controller to establish a mode of operation (e.g. warming; warming-frozen; or thawing). The user will also input a predetermined protocol to the controller. During the operation, a heat sensor monitors temperatures of the nutritional substance which are provided as feedback input to the controller for operating the warmer in accordance with the protocol.
US09516961B1
The present invention provides a container including a system for personal identification. A series of bands are mounted between ridges formed circumferentially around the container. The bands have symbols printed in a color similar to the container. The bands can be rotated around the container to position selected symbols over a patch printed on the container in a contrasting color to make the selected symbol visible.
US09516959B2
The present invention relates to a pillow, which aids a user to sleep soundly when the user is lying on the back, and makes breathing easier and helps stimulate the acupuncture points on the face when the user is lying on the stomach and rests the face on the pillow. To this end, the present invention comprises: a main body; a neck support part, which is formed in the longitudinal direction at the front side of the main body and has a height higher than the height of the main body; a ventilation hole, which penetrates the center of the neck support part into the center of the main body; an incline support part, which is provided on the main body in contact with the ventilation hole, and has a gradual decline towards the ventilation hole; and an acupuncture point stimulation part provided in a protruding manner on the ventilation hole side of the neck support part. The pillow of the present invention aids the user to sleep soundly by forming the ventilation hole at the head resting area, which allows for easy ventilation, ensuring the head to stay cool when the user is lying on the back.
US09516958B1
A food shield has shield panels that are location adjustable and angularly adjustable in respect of support structures (posts) that are coupled to a mounting surface, such as a surface of a buffet table or cart. For vertical or location adjustment of a shield panel in relation to a post, a bracket assembly includes outer and inner collar portions, a grip element positioned between the outer and inner collar portions, and a tightening element that tightens the connection of the assembled collar against support posts. For angular adjustment, each bracket assembly includes an indexing base, a rotatable arm assembly with an indexing hub, and a removable or retractable coupling element. Alternative bracket assemblies provide support elements that contact one face of the shield panel, in addition to having clamps that engage the shield panel at or near each of the front and rear panel edges.
US09516953B1
A stand system suspends a baby car seat on baby car seat sling in which the baby car seat may pivot freely in any direction. A mounting plate elevated above the floor by three elongated leg supports attaches to the baby car seat sling harnessing a baby car seat is used as a platform for holding the suspended baby car seat in a laying position located below the mounting plate above the floor. Each elongated leg equal in length comprise 5 dowel sections. A three-way brace across the bottom of the elongated legs interconnects the elongated leg's foot-end to a center point. The disclosed stand system which is the product invention may be easily assembled by hand for product use and disassembled for compact storage and ease of transportation.
US09516947B2
A configurable furniture system and method are disclosed. The system and method include one or more panels, each of the panels having one or more working edges. One or more hinges successively connect the panels together at the working edges. The system is able to convert from a folded configuration into a functional configuration, which may be a chair, desk, lounge, table or stool.
US09516945B2
An improved worksurface for home and office furniture constructions. The improved worksurface generally includes a plurality of vertical openings disposed along at least a portion of the periphery of the worksurface, where the vertical openings are adapted to support removable and interchangeable accessories. The accessories can include shelving units, support stands, storage baskets, swivel arms, docking cradles, and display mounts, for example, each being positionable at multiple locations along the periphery of the worksurface. The vertical openings are optionally disposed within a recessed portion extending adjacent a rear edge of the worksurface. In use, a user can reposition the accessories as desired, providing enhanced flexibility and customization over existing constructions.
US09516943B2
A laundry transfer apparatus comprising a frame within which is disposed a transfer conduit that traverses a distance between the openings of a washing machine and dryer. A plurality of upper extensions are provided to enable the apparatus to rest on the top surfaces of the washing machine and dryer and to vertically suspend the apparatus so that the conduit is appropriately positioned for each use. The conduit preferably comprises a substantially planar surface formed by individual table sections that fold out to form the conduit when the laundry transfer apparatus is in use. The conduit is slidably engaged to the frame via a railing. When use of the laundry transfer apparatus is complete, the individual sections are folded upright and pushed into a retracted position for later use.
US09516932B2
An article of manufacture includes decorative ornamentation relating to constellations. More specifically, the article of manufacture bears at least a first and a second pattern of first and second elements, respectively. In the first pattern, the first elements are arranged in relative positions that correspond to relative positions of stars in a first constellation. In the second pattern, the second elements are arranged in relative positions that correspond to relative positions of stars in a second constellation. The first and second patterns are superimposed on each other, forming a decorative ornamentation that represents a composite of the first and second constellations. The patterns can be configured so that a relative size of each element corresponds to a relative brightness of the constellation star corresponding to that element.
US09516927B2
A hinged slider for a closure assembly of a bag. The hinged slider includes a top wall, a pair of legs that extends vertically from the top wall, and a pair of wings hingedly attached to the pair of legs. In one embodiment, the pair of wings hinges upwardly in order to install the slider onto the closure assembly. In another embodiment, the pair of wings hinges downwardly in order to install the slider onto the closure assembly. A storage bag is also provided, in which the storage bag includes at least one zipper profile and a hinged slider in a straddling relation with the zipper profile.
US09516920B1
A footwear structure comprising a shoe having sidewalls and including gaps provided in the sidewalls extending from the sole and positioned on either side of the footwear in alignment with the medial and lateral malleoli; closure systems are provided to partially close the gaps for applying a selected force to the wearer's foot through internal pads bridging the respective gap and contacting the wearer's foot.
US09516919B2
A method of manufacturing a sole structure includes providing a plate within a cavity of a mold. The plate includes a base and a rib, and the base includes a first surface and a second surface. The first surface faces the upper, the second surface faces away from the first surface, and the rib projects from the second surface of the base. Moreover, the method includes providing a preform bladder member within the cavity of the mold, wherein the preform bladder member including a first member and a second member. The method additionally includes forming a bladder from the first and second members using the mold. Also, the method includes attaching the first member to the plate using the mold. Attaching the first member to the plate includes shaping the first member according to surfaces of the rib.
US09516911B2
An interchangeable accessory system for hardhats is disclosed which includes two accessory interchange assemblies that permit accessories such as face shields and welding shields to be attached to and removed from a hardhat while the hardhat remains on the head of the user.
US09516910B2
The present application discloses an impact liner system for a helmet. In one embodiment, the impact liner system comprises an impact liner configured to be installed in the interior of a helmet shell to at least partially line the front, rear, and middle portions of the helmet shell. The impact liner comprises a plurality of impact pads and forms a plurality of air channels between the impact pads when the impact liner is installed in the helmet shell. In certain embodiments, at least one insert is disposed within one or more of the plurality of air channels. The insert generally comprises a body portion having a top and vertical side walls configured to prohibit at least a portion of the air channel from collapsing when the helmet shell is installed on a user's head.
US09516909B2
Protective gear includes an outer shell layer connected to a middle shell layer through an outer energy and impact transformer layer. The middle shell layer is connected to an inner shell layer through an inner energy and impact transformer layer. The outer and inner energy and impact transformer layers flexibly connect the shell layers to absorb impact forces, rotational forces, shear forces, etc., and allow the various shell layers to move and slide relative to the other shell layers. The outer and inner energy and impact transformer layers may be constructed using gels, fluids, electro-rheological elements, magneto-rheological elements, etc. The protective gear may be formed as helmets or body protection for various activities and protect users from not only impact and penetrative forces, but rotational and shear forces as well.
US09516908B2
An object of the present invention is to surely provide a wig with hairs that ensures the desired voluminous feeling. A wig comprises an alternate arrangement, the alternate arrangement including: a first region of a wig base in which a plurality of first hairs having a first curl diameter are implanted, the first hair being an artificial hair or a natural hair; and a second region of the wig base in which a plurality of second hairs having a second curl diameter smaller than the first curl diameter are implanted, the second hair being an artificial hair or a natural hair, the first and second regions being adjacent to each other and alternately arranged.
US09516904B2
An upper body undergarment with two wide strap or garment style shoulders connected to a full-support bra at two front points. The straps are made from any suitable material, and is widest at the points of attachment to the bra, in this case the front of the subject embodiment where it is stitched directly to the cups, or made removable as per the description of the back ends of the straps. The straps then taper towards the apex of the shoulders to fit the width of a wearer's shoulders. The cups of the brassiere can be of any method or material generally employed in the art of support bra construction. The side panels of the brassiere connect from the outer sides of the cups around to the back of the wearer, and also serve to connect to the wide strap or garment style shoulders. Restickable or repositionable adhesive is used to create adjustment, fastening, or closure, or removable or other attachment in the undergarment.
US09516900B2
The present disclosure describes a protective stretchable material and a garment made therewith. The protective stretchable material comprises a first protective fabric, and a second protective fabric partially superposing the first protective fabric. The protective stretchable material further comprises a stretchable structure. The first and second protective fabric are affixed to the stretchable structure in such a manner as to allow movement of the first protective fabric with respect to the second protective fabric while remaining partially superposed upon stretching of the stretchable structure.
US09516897B1
A smoking article provides a purchased, as-built cigar that can be disassembled to form multiple cigars, enabling a consumer to make his or her own cigars using custom tobacco filler. The as-built cigar is capped as part of its construction, preferably at one end or at both ends. A smoker removes the cap or caps to enable smoking of the as-built cigar or disassembly into layers. Each layer can then be rolled with a smoker's custom tobacco. The inner layer contains tobacco filler. Upon disassembly, the inner layer and tobacco filler can be smoked. Alternatively, the inner layer can be pulled apart at a provided serration to discard the tobacco filler and then filled and rolled with a smoker's custom tobacco filler material.
US09516895B2
A deformable additive release component (1) for a smoking article is disclosed, comprising an aperture (8) through which additive may be released, an outer wall section (2), an inner wall section (3) that defines a chamber (10) within which the additive is held and at least one channel (5) between the inner and outer wall sections to allow airflow through the component, wherein the component is configured to transmit a compressive force applied to the outer wall section to the inner wall section and to open the aperture. A filter (25) for a smoking article that comprises said additive release component, and a smoking article (21) that comprises said additive release component or said filter, are also described. Methods of manufacturing the additive release components is also disclosed.
US09516894B2
An oral pouched product comprising a pouch containing moist botanical beads comprising compacted loose, fibrous moist botanical material and method of manufacture thereof. The loose, fibrous moist botanical material can comprise moist smokeless tobacco. The pouch comprises a porous outer web, and the beads comprise a majority amount of loose, fibrous moist botanical material having a moisture content of at least about 50% OV.
US09516889B2
A self-contained system is provided for cleaning a food flow path in a food processor. The system can be operably engaged without requiring disassembly and reassembly of the food processor or can be operably engaged after a partial disassembly of the food processor. The system includes a control assembly for directing passage of a solution through the food processor without requiring constant operator oversight. The system can employ available positive pressure water supply, such as public utility water pressure to selectively and automatically push solutions, including rinses, backwards or forwards through a food flow path in the food processor, though typically countercurrent to the normal processing food flow. A manifold assembly includes an intake manifold and a distribution manifold, with an induction port and/or access port in the distribution manifold for introducing additives or agents into a controlled motive stream passing through the manifold assembly.
US09516884B2
A bowl for a kneading machine includes a bottom provided with an opening, a discharge device equipped with a plug, and an actuator configured for moving the plug between a position for closing the opening, in which the latter is engaged by the plug, and a position of discharge of the bowl, in which the opening is disengaged from the plug so as to be able to discharge through it the dough prepared in the machine. The actuator is a linear actuator configured for moving the plug, and cam means are configured for guiding movement of the plug along a path comprising a horizontal rectilinear stretch.
US09516874B2
A hunting tree stand is disclosed. The hunting tree stand includes a backbone configured to be secured to a tree, an inner radial support beam having a generally arc shape, and a plurality of cantilevered supports extending outwards from the inner radial support beam. In addition, the hunting tree stand includes a pair of adjustment plates disposed on a respective proximate end of the plurality of cantilevered supports and configured to be secured to opposing sides of a lower end of the backbone. A plurality of adjustment apertures are disposed in a curvilinear pattern on the pair of adjustment plates, where the plurality of adjustment apertures are positioned so that an angle of a decking to the backbone can be adjusted relative to the backbone by rotating the decking downwards or upwards and inserting an adjustment pin through a desired adjustment aperture and the lower end of the backbone.
US09516873B2
An apparatus and method for applying an agricultural management material to targeted area. Exemplary agricultural management materials include viscous materials.
US09516872B2
A mite trapping mat includes a mite attracting material; a film bag enclosing the mite attracting material; and a buffer element which forms a space inside the film bag. The film bag has a large number of small holes penetrating through the film, and the inside space of the film bag is a dark space. A mite trapping paper container includes: a mite attracting material; a buffer element containing the mite attracting material; and a flat paper box case in which the buffer element is stored. The box case has a large number of small holes penetrating from an outer surface to an inner surface, and an inside space of the box case is a dark space. At least any of a product name, a purpose of use, and a disclaimer is shown on a surface of the box case. The buffer element is made of at least any of cotton, cloth, nonwoven fabric, or grains which are larger than the small holes and is stuffed into the box case such that the box case is almost full.
US09516861B2
An improved flea comb apparatus can be used to remove fleas from animals such as cats, dogs, and the like and advantageously includes a retractable flea comb and lights that are automatically illuminated when the flea comb is in a deployed condition. The lights attract fleas and aid in their removal by providing an intensity of light at the undercoat region of an animal that has not previously been conveniently provided. The lights also assist the user in identifying fleas during combing of the animal.
US09516853B2
The present invention relates to a Lactuca sativa seed designated 83-02 RZ, which may exhibit a combination of traits including resistance to downy mildew (Bremia lactucae) races B1:1-31 and Ca-I to Ca-VIII, resistance to currant-lettuce aphid (Nasonovia ribisnigri), very intensely red deeply lobed leaves, and a loose to moderately firm head. The present invention also relates to a Lactuca sativa plant produced by growing the 83-02 RZ seed. The invention further relates to methods for producing the lettuce cultivar, represented by lettuce variety 83-02 RZ.
US09516850B2
A wheat cultivar designated HY 271-SRW is disclosed. The invention relates to the seeds and plants of wheat cultivar HY 271-SRW and to methods for producing wheat seeds and plants by crossing wheat cultivar HY 271-SRW with itself or another wheat cultivar or wheat plant not designated a cultivar. The invention also relates to methods for producing seeds and plants of wheat cultivar HY 271-SRW containing in its genetic material one or more transgenes and to the transgenic wheat plants and plant parts produced by those methods. The invention also relates to methods for producing seeds and plants by mutagenesis of wheat cultivar HY 271-SRW. The invention also relates to hybrid wheat seeds and plants produced by crossing wheat cultivar HY 271-SRW with another wheat cultivar.
US09516845B1
A novel soybean variety, designated XBP26004 is provided. Also provided are the seeds of soybean variety XBP26004, cells from soybean variety XBP26004, plants of soybean XBP26004, and plant parts of soybean variety XBP26004. Methods provided include producing a soybean plant by crossing soybean variety XBP26004 with another soybean plant, methods for introgressing a transgenic trait, a mutant trait, and/or a native trait into soybean variety XBP26004, methods for producing other soybean varieties or plant parts derived from soybean variety XBP26004, and methods of characterizing soybean variety XBP26004. Soybean seed, cells, plants, germplasm, breeding lines, varieties, and plant parts produced by these methods and/or derived from soybean variety XBP26004 are further provided.
US09516838B2
A novel maize variety designated X70F225 and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X70F225 with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X70F225 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. This invention relates to the maize variety X70F225, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X70F225. This invention further relates to methods for producing maize varieties derived from maize variety X70F225.
US09516836B1
A novel maize variety designated X03F656 and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X03F656 with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X03F656 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. This invention relates to the maize variety X03F656, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X03F656. This invention further relates to methods for producing maize varieties derived from maize variety X03F656.
US09516828B2
The invention relates to the field of Cucumis melo, in particular to a new variety of melon designated NUN 26357 MEM as well as plants, seeds and melon fruits thereof.
US09516817B2
A grain-moving arrangement is disclosed for agricultural combines. An elevator is configured to move grain in a first direction along an elevator path, within an elevator housing, and to receive grain from a first auger at a first location on the elevator path. A grain-moving device is configured to receive power from the elevator in order to move grain received from a second auger in a second direction along a device path, within a device housing, to an outlet of the device housing. Grain moved along the device path to the outlet of the device housing passes through the outlet of the device housing to a second location on the elevator path that is upstream of the first location on the elevator path, with respect to the first direction.
US09516816B2
A feeder drum used in an agriculture head to force the cut crop through an opening of the head. More specifically, the feeder drum is used to produce the transition from the lateral movement of the crop through the platform to a transverse longitudinal movement (with respect to lateral movement) which directs it to the platform carrier's feeder. Even more specifically, the feeder drum comprises a plurality of fins or blades attached to a cylinder, wherein the fins contain one side with a profile describing a convex curve.
US09516815B2
A harvester for agricultural products such as fruits such as grapes, berries, vegetables, and the like, and method of harvesting, using an RFID system capable of detecting and interrogating RFID tags associated with objects or conditions along a path of the harvester in a manner to determine both presence and location of the associated object or condition, to enable responsively adapting or altering the operation of harvesting apparatus in a predetermined manner, such as by reducing or interrupting forces exerted thereby when about or proximate the object or condition.
US09516805B2
A particulate material delivery system is provided that allows for variable rate sectional control while delivering particulate material to an agricultural field. The system may include an air cart and a drill that are towable behind a tractor and that includes a metering system receiving product from the air cart and delivering the product to the drill for distribution to the ground, such as an agricultural field. The metering system includes multiple metering units that receive separate portions of the product from the air cart. Multiple prime movers drive the multiple metering units. A controller is connected to and individually controls the multiple prime movers such that distribution rates of the multiple metering units can be varied independently of each other.
US09516800B2
A soil aeration apparatus can include an aeration rotor comprising at least one set of aeration tines configured for movement in a planetary motion about an axis. The apparatus can further include the aeration rotor being configured to remove soil plugs from a ground surface and break the soil plugs into soil particles when the aeration rotor is rotated.
US09521795B2
A method includes placing a plurality of first package components over second package components, which are included in a third package component. First metal connectors in the first package components are aligned to respective second metal connectors of the second package components. After the plurality of first package components is placed, a metal-to-metal bonding is performed to bond the first metal connectors to the second metal connectors.
US09521793B2
A method for filling a carrier tape (10) with electronic components (12) and for removing and replacing defective electronic components (13) from the carrier tape, comprising the steps of: at a filling station (1), loading an electronic component in a pocket (11) of the carrier tape (10), moving said carrier tape (10) forward, automatically detecting that said electronic component which is defective, moving said carrier tape backward, and unloading the defective electronic component (13) from the carrier tape (10), at said filling station (1), filling said packet with a new electronic component.
US09521791B2
The present invention provides an assembly equipment and an assembly method thereof. The assembly equipment is used for assembling a flexible screen with a curved backplane and includes a supporting part used for supporting and fixing the curved backplane and a holding part used for holding the flexible screen and assembling the flexible screen with the curved backplane in a fit manner. The assembly equipment is provided with the supporting part and the holding part to stably fix the curved backplane and assemble the flexible screen with the curved backplane in a fit manner quickly and accurately, thereby realizing high-efficiency assembly of the flexible screen and the curved backplane, and meanwhile realizing a high yield of display panels formed by assembling the flexible screen and the curved backplane.
US09521787B2
Systems and methods for cooling include one or more computing structure, an inter-structure liquid cooling system that includes valves configured to selectively provide liquid coolant to the one or more computing structures; a heat rejection system that includes one or more heat rejection units configured to cool liquid coolant; and one or more liquid-to-liquid heat exchangers that include valves configured to selectively transfer heat from liquid coolant in the inter-structure liquid cooling system to liquid coolant in the heat rejection system. Each computing structure further includes one or more liquid-cooled servers; and an intra-structure liquid cooling system that has valves configured to selectively provide liquid coolant to the one or more liquid-cooled servers.
US09521777B2
The present invention is directed to a cooling system (1) for electronic components (4). The cooling system (1) comprises means (7) for producing cyclic air pressure fluctuations, wherein the electronic components (4) are distanced from the pressure producing means (7). In the vicinity of the electronic components (4) are situated means (5), preferably restrictions like holes, which are affected by the cyclic air pressure fluctuations, and which produce cyclic air jets (6). The air jets (6) affect the surface of the electronic component (4), and since the air jets (6) originate directly in the vicinity of the electronic components (4), an efficient heat transfer is affected. Preferably, the pressure producing means (7) actuate a pressure Pc inside a chamber (2), and turbulent air jets (6) are produced through holes (5) of a substrate (3), onto which electronic components (4) are mounted.
US09521776B1
A chassis rail stabilizer that may be used to securely support a rack mount rail in a server rack, in particular during transportation of the server rack. The chassis rail stabilizer includes a first body with a front face and a back face, and four rail supporting sides. The stabilizer further includes a second body extending off of the front face of the first body and an offset threaded through hole that extends through the first and second bodies. The offset nature of the through hole is such that the stabilizer may be secured to a vertical mounting post in a server rack in one of four orientations. Each orientation causes one of the rail supporting sides to extend downward a different distance to support a top surface of the rail beneath.
US09521774B2
The present invention is applied to the field of technologies about a handle structure in an electronic device, and discloses a handle locking structure and an electronic device having the handle locking structure. The handle locking structure includes a handle body that is connected to a shell, and a pressing member, a transmission member, and a locking part that are connected to the handle body in a sliding or rotating manner, where the locking part includes a bolt, the transmission member is connected to the pressing member, an unlocking structure that is used to enable the bolt to retract is disposed between the transmission member and the locking part, the transmission member is connected to the bolt through the unlocking structure, the transmission member can slide by pressing the pressing member, and the sliding transmission member functions on the bolt through the unlocking structure to enable the bolt to retract.
US09521772B2
A housing for receiving electrotechnical components includes a first and a second housing shell having, respectively, a first housing web that forms a sealing face and a second housing web that forms a further sealing face. The first and second housing webs are part of an inner wall of a double-walled casing portion of the housing. Two resilient sealing elements for sealing a transition portion are formed between the housing shells. In the assembled state, the first and second housing webs are aligned one above the other and substantially flush and the longitudinal edges thereof facing each other are arranged at a distance apart. A carrier element forms a bridging element between the housing webs and presses the sealing elements in the transverse direction or in the assembly direction against the sealing faces.
US09521750B2
The present invention relates to a printed circuit board of a probe card. The printed circuit board comprises a first side, a second side, a plurality of plated through holes and at least one electric barrier. The first side includes a plurality of first contacts and a plurality of second contacts respectively corresponding to the first contacts. The second side includes a plurality of third contacts respectively corresponding to the second contacts and a plurality of second-side traces extended to a predefined/specific region. The plated through holes penetrate through the first side and the second side, so that the third contacts are electrically connected to the second contacts. The at least one electric barrier is installed among at least two of the second side traces.
US09521749B2
A circuit substrate which is capable of decreasing the possibility that the amount of solder in the overall mounting land is uneven and reducing formation of a solder void even when a mounting terminal has a large soldering area. An electronic component having the mounting terminal is mounted on the circuit substrate. A mounting land is connected to the mounting terminal of the electronic component by soldering, and the mounting land has a protruding portion of an insulating material formed so as to protrude from an outer side of the mounting land toward an inner side of the mounting land, and the protruding portion does not divide the mounting land into a plurality of areas.
US09521747B2
A connection board includes at least one cut-out to fasten the connection board to an installation board and multiple contact surfaces electrically isolated from one another, wherein the contact surfaces electrically connect to one another when the connection board is in a fastened state by a fastener that extends through the cut-out.
US09521741B1
A circuit board assembly includes a first shield positioned over a top surface of a printed circuit board and a second shield positioned over a bottom surface. The first and second shields include conductive tabs which are coupled to a first side surface of the circuit board, wherein the tabs of the first shield are generally interposed or staggered with the tabs of the second shield.
US09521740B2
An electronic device includes a substrate, a first device, a second device, and a shielding wall. The first device and the second device are disposed on the substrate respectively. The shielding wall is disposed independently between the first device and the second device. The shielding wall is configured for suppressing the electromagnetic interference from the second device to the first device.
US09521734B2
The static eliminator for parts feeder comprises a hollow cylindrical or truncated conical cup into which air is injected from the upper portion thereof to generate an air stream of negative pressure circling within the cup so as to lift the works up in the air, and an ionized air introduced into the cup to remove the static from the works thus lifted. The static eliminator is disposed above the upper portion of the parts feeder in a space more than the height of the work. The static eliminator is positioned just in front of the place in which the works stop moving due to the static charge.
US09521730B2
A circuit (200, 300, 400, 600, 700, 800) interfacing a device (20, 30, 40, 60, 80) with a line-pair includes: a diode bridge (210) having polarity-independent input terminals coupled to the line-pair; a galvanic isolation device (230, 330) receiving a transmit signal and coupling the transmit signal to its output; a variable edge delay circuit (270, 370, 572, 574, 576) that delays rising/falling edges of the transmit signal more than falling/rising edges of the transmit signal; a voltage-controlled variable resistance element (260, 360, 460) connected across output terminals of the diode bridge; and a filter connected to a control terminal of the voltage-controlled variable resistance element. The filter includes decoupled charge and discharge paths to decouple the rise time of the transmit signal from the fall time of the transmit signal. The voltage-controlled variable resistance element couples the transmit signal to the line-pair via the diode bridge.
US09521727B1
The present disclosure provides systems and techniques for a lighting fixture with a motion sensor and an emergency battery test switch. The disclosure herein provides a lighting fixture for fitting within a ceiling, wall, or other surface. The lighting fixture includes a frame which forms the perimeter of the lighting fixture. The frame includes two endplates and two side bars, forming an outer frame of the lighting fixture. The frame further includes a device mounting bracket coupled between the two endplates, separating the outer frame into two frames. Each of the two frames houses a lightguide which is coupled to a light source. Each of the light guides are coupled with a back reflector. The motion sensor and emergency battery test switch can be coupled to the device mounting bracket or elsewhere on the frame.
US09521719B2
A circuit for driving a lighting apparatus is provided. The circuit includes a valley signal generator configured to generate a valley signal based on an input voltage, an input voltage determining unit configured to determine whether the input voltage corresponds to a direct voltage or a full-wave rectified AC voltage based on the valley signal, an AC voltage simulation unit configured to generate a virtual valley signal when the input voltage is a DC voltage, and a switching device controller configured to control a switching device used to drive an LED module based the determination and at least one of the valley signal and virtual valley signal.
US09521718B2
The LED tube lamp includes a lamp tube configured to receive an external driving signal; a rectifying circuit configured to rectify the external driving signal to produce a rectified signal; a filtering circuit coupled to the rectifying circuit, and configured to filter the rectified signal to produce a filtered signal, wherein the filtering circuit has a first filtering output terminal and a second filtering output terminal; an LED lighting module coupled to the filtering circuit, wherein the LED lighting module includes a driving circuit having a first driving output terminal and a second driving output terminal and configured to receive the filtered signal to produce a driving signal, and an LED module configured to receive the driving signal and emit light; and a mode switching circuit coupled to at least one of the first and the second filtering output terminal and at least one of the first and the second driving output terminal, and configured to determine to perform one of a first driving mode and a second driving mode.
US09521712B1
Multiple measurements may be obtained via a single pin of an integrated circuit (IC) to set multiple control parameters of a light emitting diode (LED) controller within the IC. For example, a first input signal may be applied from the IC to two or more components via a single IC pin. A first output signal may be obtained from the two or more components via the single IC pin. A second input signal may be applied from the IC to the two or more components via the single IC pin, and a second output signal may be obtained from the two or more components via the single IC pin. A first parameter and a second parameter of the two or more components may be calculated based, at least in part, on the first output signal and the second output signal obtained via the single IC pin.
US09521689B2
Embodiments of the disclosure provide a method, an apparatus, and a system for controlling a serving grant of a user terminal (UE) of a neighboring cell. The method is used for controlling a UE in a CELL-FACH state or in an idle state of a neighboring cell through a common E-RGCH. The method includes: obtaining a control command by monitoring the common E-RGCH of the neighboring cell; determining whether the UE satisfies at least one further configured controlled condition; and when the UE satisfies the at least one controlled condition, adjusting the serving grant of the UE based on the obtained control command. Through the method and the apparatus according to the embodiments of the disclosure, throughput of the UE may be prevented from being reduced excessively, thereby improving communication performance.
US09521681B2
The invention relates to apparatuses, a method, computer program and computer-readable medium.
US09521679B2
The present disclosure is directed at systems, methods and media for providing QoS differentiation between IP data flows by sorting data packets into bearers. If a first node in a communication network (e.g., a User Equipment or UE) determines that downlink packets received from a second node (e.g., a Packet Data Network Gateway or PDN-GW) via a specific bearer should be given reflective bearer treatment, the first node can be configured to send uplink packets back to the second node via the same bearer. By sending uplink traffic using the same bearer as downlink traffic, the first node can aid in ensuring that the correct QoS for the uplink traffic is used. Downlink packets or bearers can be configured to request reflective bearer treatment through reserved QoS Class Identifier (QCI) values, Allocation and Retention Priority (ARP) values, or through an indicator specifically defined for requesting such treatment.
US09521667B2
Disclosed is wireless communication base station equipment in which CCE allocation can be flexibly performed without collision of ACK/NACK signals between a plurality of unit bands, even when wideband transmission is performed exclusively on a downlink circuit. In this equipment, an allocation unit (105) sets up mutually different search spaces for each of a plurality of downlink unit bands, with respect to wireless communication terminal devices that communicate using a plurality of downlink unit bands, and allocates resource allocation information of downlink circuit data destined for the wireless communication terminal devices to CCEs in mutually different search spaces for each of the plurality of downlink unit bands, and an ACK/NACK reception unit (119); extracts a response signal in respect of the downlink circuit data from the uplink control channel associated with the CCE to which the resource allocation information of this downlink circuit data was allocated.
US09521666B2
Embodiments of the present invention provide a method and apparatus for triggering aperiodic feedback in coordinated multipoint transmission. The method includes: transmitting, by an eNB to UE, dynamic control information (DCI) and preconfigured feedback sets corresponding to the DCI, so that the UE aperiodically feeds back corresponding channel state information (CSI) according to the DCI and the feedback sets corresponding to the DCI; wherein the preconfigured feedback sets corresponding to the DCI are classified according to a triggered transmitting point or a CSI-RS of non-zero power, or are classified according to configured CSI, or are classified according to an interference type. With the method and apparatus of the embodiments of the present invention, a relatively good tradeoff between flexibility of aperiodic CSI feedback and signaling load in a CoMP transmission process or a joint transmission process of CoMP and CA may be achieved.
US09521665B2
The present invention relates to a wireless communication system, and more specifically, to a method and an apparatus for transmitting or receiving a downlink signal considering an antenna port relationship. The method for enabling a terminal to receive a physical downlink sharing channel (PDSCH) signal in the wireless communication system according to one embodiment of the present invention can determine a PDSCH start symbol index according to the predetermined priority and receive the PDSCH signal therethrough. The PDSCH start symbol index can be determined when a PDSCH start symbol value included in a PDSCH resource element mapping and Quasi co-location Indicator (PQI) parameter set is determined by an upper layer. The PDSCH start symbol index can be determined according to the PDSCH start symbol value for a cell receiving the PDSCH when the PDSCH start symbol value included in the PQI parameter set is not determined by the upper layer.
US09521657B2
A user equipment implements a method of processing indication messages, such as SCRI (signaling connection release indication) messages. For at least one RRC (radio resource control) state, if the current RRC state of the UE is a result of a previously sent indication, the UE inhibits itself from sending a further indication message.
US09521655B2
Methods and apparatus for avoiding power scaling and controlling transmit power in uplink data transmission are provided. If a user equipment (UE) would be transmit-power limited when transmitting data concurrently on an uplink high speed dedicated physical control channel (HS-DPCCH) and an uplink data channel, the UE may forgo building data for transmission on the uplink data channel to avoid power scaling. If the UE would be transmit-power limited when transmitting data concurrently on an HS-DPCCH and a dedicated physical control channel (DPCCH), the UE may reduce the transmission power of a portion of the data transmitted on the DPCCH to avoid power scaling. The UE may also boost transmission power of a negative acknowledge transmission above network-specified power level.
US09521651B2
A system and methods for controlling a mobile electronic device is disclosed. A notification in response to a prescribed event is outputted. A change in a position of the mobile electronic device is detected. A strength of the notification is reduced, when a change in the position of the mobile electronic device is detected while the notification sound is being outputted.
US09521648B1
A location estimation method and a communication device configured to estimate location and automatically connect to one or more wireless display devices based on the determined location. The estimation of location can be based on one or more location signatures that include information of the wireless display device(s). The location estimation method can include identifying available access points (APs) and wireless display adapters, determining wireless characteristics of the available APs and wireless display adapters, calculating match scores based on the wireless characteristics of the available APs and the wireless characteristics of the available wireless display adapters, determining a location signature based on the determined match scores, and determining a location based on the location signature. The communication device can be configured to automatically connect to the wireless display device(s). The communication device can operate in a standby display mode upon the connection.
US09521646B2
A method of wireless communication includes generating a unique position reference signal (PRS) for a remote radio head having a same physical cell identity (PCI) as a macro eNodeB. The unique PRS is based on a virtual cell ID and/or unique cell global identification (CGI) of the remote radio head such that the unique PRS is different from a PRS of the macro eNodeB. The PRS of the macro eNodeB is based on the PCI. The method also includes transmitting the unique PRS.
