US11053032B1
A lidding station for containers, including a conveyor structured and arranged for moving unrestrained containers in a conveyance direction; a lid infeed chute above said conveyor; and first, second and third compression rollers positioned above said conveyor and downstream of said lid infeed chute, and methods for affixing lids to containers.
US11053029B1
A modular spacecraft is provided. The modular spacecraft includes a bus module and a payload module. The bus module provides additional thermal radiative capacity for the payload module by including a bus-panel payload thermal zone that couples operational components of the payload module to a radiator panel in the bus module. The bus module also includes its own operational components that are thermally coupled to the radiator panel but that are thermally isolated from the payload module and the bus-panel payload thermal zone.
US11053021B2
An unmanned aerial vehicle (UAV) has: a body for carrying an article; at least one rotor; and a light source for generating a light beam to indicate the landing zone for the UAV. The UAV, in use, is flown to a desired location, that might be a site of an emergency with no defined landing zone. The UAV descends, and, while descending the light source is operated to illuminate and to define a landing zone. The UAV can be provided with lights and an audio source to warn and advise bystanders that the UAV is landing and to stand clear of the landing zone.
US11053018B2
An inlet for a flight vehicle engine, such as for a supersonic or hypersonic engine, includes an internal flow diverter to divert boundary layer flow. The flow diverter is configured to minimize disruption to flow outside the diverted boundary by being configured through use of a flow field that is also used to configure the walls of the inlet. The flow field that is used to configure an inlet-creating shape and a diverter-creating shape has the same flow generator, contraction ratio, compression ratio, mass capture ratio, pressure ratio between entrance and exit, and/or Mach number, for example. The internal diverter may be configured so as to allow arbitrary selection of a leading edge shape for the internal diverter, for example to use a shape that helps avoid radar detection.
US11053011B2
Ice detection systems for aircraft and related methods are disclosed. A disclosed example ice detection system includes a thermochromic device to sense a temperature of freestream air relative to a temperature threshold, and a hydrochromic device to sense an amount of moisture in the freestream air relative to a moisture threshold. A controller to detect an icing condition in response to the thermochromic device sensing a temperature that is less than or equal to the temperature threshold and the hydrochromic device sensing an amount moisture that exceeds the moisture threshold.
US11052994B2
A turbine engine module including an upstream propulsive unit including a propellers doublet that are upstream and downstream, respectively mounted around an axis, a power turbine shaft with axis of rotation intended for rotating the propellers doublet, a speed reducer connected to the propellers doublet and driven by the shaft, and, a pitch-changing system including a cylinder that controls the pitch of the blades of the upstream propeller the rotational axis of the propellers doublet is shifted in relation to that of the shaft. The cylinder is placed downstream of the reducer, and the pitch-changing system includes a shaft for controlling the pitch of the blades that connect the cylinder to the blades of the upstream propeller.
US11052986B2
An aeronautical glazing unit includes at least one sheet of modified acrylic, wherein the sheet is combined with at least one other sheet of modified acrylic, and/or at least one sheet of cast poly(methyl methacrylate) (PMMA), and/or at least one sheet of another transparent polymer such as polycarbonate (PC), and/or at least one sheet of glass in particular that is chemically strengthened, as a laminated and/or multiple glazing unit.
US11052980B2
An underarm float for infants, comprising a main body, the main body is composed of a front part and rear parts, which are connected to each other, wherein rear parts are connected to both ends of the front part, and rear parts at the two ends of front part are oppositely arranged; a first arc groove and second arc grooves are formed at the joint between front part and a rear part, first arc groove is downwards recessed along the upper surface of the front part and the rear part, and the second arc grooves are inwards recessed along the side surface of the front part and the rear part; a shoulder strap is arranged at the joint between the front part and the rear part, and the shoulder strap is located above the first arc groove; and the oppositely arranged rear parts are provided with an elastic cord.
US11052977B2
A tubular installation apparatus (1) including a lay tower (2) mounted to a support structure (4). The lay tower (2) is configured to lower a tubular section along a firing line (L) extending along the lay tower (2). A magazine (3) is removably mounted to the lay tower (2) and configured to be pre-loaded with a plurality of tubular sections. A feed mechanism (23, 25) is configured to feed one or more tubular sections from the magazine (3) to the firing line (L) of the lay tower (2) for connection to the end of a catenary.
US11052968B2
An electric bicycle comprises a removable battery pack (1) for storing electrical energy, and a frame element (5) to which the battery pack (1) is intended to be fixed. The battery pack comprises a housing and a lock arranged in said housing and the frame element (5) comprises a projecting locking element (21), said locking element (21) penetrating into the housing of the battery pack (1) through an entry opening so as to co-operate with said lock with a view to fixing said battery pack (1) to said frame element (5).
US11052963B2
A throttle tube assembly including a throttle tube, a throttle body, a bearing, and a stop collar. The throttle tube extends along a central axis from a proximal most end to a distal most end, the throttle including a lumen extending through the throttle tube. The throttle body is connected to the throttle tube, at the proximal end of the throttle tube, the throttle body having a bearing seat aligned along the central axis with the throttle body. The bearing being disposed in the bearing seat and axially aligned with the throttle body and partially axially aligned with the throttle tube. The stop collar is fixed to the throttle body configured and arranged to actuate a throttle by wire system.
US11052955B2
A spare wheel catcher in a vehicle comprises a base adapted to be connected on a rear differential and a catcher plate. The base includes a support extending along a longitudinal direction of the vehicle at an assembled position and a connection member; and the catcher plate is connected with a first end of the support and forms an obtuse angle with a forward moving direction of the vehicle.
US11052949B2
Provided is a rear vehicle body structure that includes: a right and left pair of frame members each extending in a front-rear direction and having a damper supporting part; rear wheel wells; a rear floor panel; a rear cross member upper part connecting the right and left pair of frame members to each other on a front side of the damper supporting parts; front side reinforcements provided along a vehicle cabin inner side of each of the rear wheel wells and extending in an up-down direction on the front side of the damper supporting parts; and a reinforcing member mounted on each of the frame members and having a reinforcing member main body that reinforces the damper supporting part and a reinforcing member coupling part that couples together the rear cross member upper part and the front side reinforcement.
US11052935B2
A motor-adjustable steering column for a vehicle includes a supporting unit attachable to a vehicle body and by which there is held an adjusting unit in which a steering spindle is mounted so as to be rotatable about a longitudinal axis. An adjustment drive is connected to the supporting unit and to the adjusting unit and is adjustable relative to the supporting unit. The adjustment drive includes a drive unit and a threaded spindle which engages in a spindle nut and which has a threaded spindle axis. The threaded spindle and the spindle nut can be driven to rotate relative to one another about the threaded spindle axis by the drive unit. To prevent slipping or spinning of the spindle drive in a crash situation the adjustment drive includes a blocking device which can be brought into a blocking position for blocking the threaded spindle relative to the spindle nut.
US11052922B2
An information processing apparatus is provided with a controller comprising at least one processor. The controller is configured to execute: displaying presentation information to be presented to a user of a vehicle at an inside or an outside of a window formed in a vehicle; switching over between displaying and non-displaying of the presentation information displayed at the inside of the window according to an instruction received from the user; and displaying the presentation information at the outside of the window in cases where the vehicle is located in a specific place.
US11052915B2
A sobriety ignition interlock system including an engine control device and a method for managing available vehicle engine power using the sobriety ignition interlock system. The engine control device includes an engine control processor (ECP) that is electronically connected in between an engine control unit (ECU), an engine sensor assembly, and a sobriety processor. The sobriety processor determines a sobriety level of a vehicle driver and sends a corresponding sobriety signal to the ECP. The ECP intercepts an engine signal transmitted from the engine sensor assembly to the ECU and manipulates the engine signal according to the sobriety signal, in order to manage the available power of the vehicle engine.
US11052911B2
The speed control device is equipped with: an actual speed acquisition unit; an actual position acquisition unit; an acceleration/deceleration control unit; and a travel resistance calculation unit. When in a situation in which an target speed increases from a first target speed to a second target speed, the target speed in the second road section is set such that an actual speed increases with a first-order lag from the first target speed to the second target speed over a period between the start position and end position of the second road section, and the target speed in the second road section is set such that the amount of change in the speed, which increases with the first-order lag, with respect to the travel time of the vehicle is decreased as the travel resistance calculated by the travel resistance calculation unit increases.
US11052898B2
Systems and methods for operating a vehicle that includes an engine that may be automatically stopped and started are described. In one example, a requested driver demand power may be filtered via a first order low pass filter in response to a powertrain speed. The filtered requested driver demand power may be a basis for automatically stopping and starting an engine.
US11052892B2
An electronically controllable pneumatic brake system. The brake system includes at least two brake circuits, wherein a first of the at least two brake circuits is allocated an electrically and pneumatically controllable control valve and a second of the at least two brake circuits is allocated an electrically controllable parking brake valve in order to predetermine braking pressures so as to actuate wheel brakes of the respective brake circuit. The brake system further includes a first control unit configured to electrically actuate the electrically and pneumatically controllable control valve in dependence upon a vehicle desired deceleration and a second control unit configured to electrically control the parking brake valve in dependence upon the vehicle desired deceleration that is requested in an automated manner. In addition, the brake system includes at least one bypass valve to which a control valve is allocated.
US11052887B2
An electric component assembly includes a housing with which an electric component is fitted, and the electric component and the housing are fixed to one surface of a base body. The electric component includes a connection terminal press-fitted to a through-hole (201a) of a board provided in the housing, and an insertion direction of the connection terminal into the through-hole is a fitting direction of the electric component with the housing. The electric component assembly includes a rib which is protrudingly provided on either one of an outer surface of the electric component intersecting the fitting direction and an inner surface of the housing facing the outer surface, and a groove portion which is provided as a recess on another one of the surfaces and the rib is inserted into; and a protrusion that abuts onto the rib is provided on an inner surface of the groove portion.
US11052885B2
A system and a method for estimating the coefficient of friction of a hydraulic brake system with axle-individual pressure buildup of a motor vehicle. In addition, a system and to a method for setting the target braking torque of a hydraulic braking system with axle-individual buildup of a motor vehicle in order to obtain a desired actual braking torque.
US11052883B2
Driving support ECU transmits a communication connection request to a help net center HNC when a driver of a vehicle has been determined to be in an abnormal state where the driver loses an ability to drive the vehicle, and when the communication connection to the help net center HNC has been established, the driving support ECU transmits the help signal (the positional information of the vehicle) and decelerates the vehicle at a constant deceleration to make the vehicle stop. On the other hand, when the communication connection to the help net center HNC has not been established, the driving support ECU makes the vehicle travel at a constant speed. Accordingly, it is possible to make the vehicle stop under a situation where the help net center HNC recognizes the vehicle position inside which the driver who has been determined to be in the abnormal state is.
US11052870B2
A switch assembly for a vehicle seat belt buckle comprising a switch housing defining an interior and a pocket, a cable extending into the interior and including hook-shaped ends extending around posts in the interior of the switch housing. In one embodiment, the interior of the switch housing includes first and second posts positioned in a co-linear and spaced apart relationship and the hook-shaped ends face each other and extend around the first posts and abut against the second posts. In one embodiment, the Hall Effect sensor is positioned in the pocket of the switch housing in an inclined relationship.
US11052869B2
A seatbelt ignition interlock system. The system includes a plurality of sensor devices each including a housing, a latch configured to removably engage the latch receiver of a vehicle seatbelt system, a latch receiver configured to receive and removably engage the latch of the vehicle seatbelt system, a latch sensor, a temperature sensor, and a power source. Each sensor device is in electrical communication with a vehicle ignition interlock circuit, and the vehicle ignition interlock circuit is in electrical communication with an ignition of a vehicle. The vehicle ignition interlock circuit is configured to prevent the vehicle ignition from being started when a combination of temperature sensors and latch sensors determine that occupied seats have unfastened seatbelts.
US11052862B2
Provided is an air bag base cloth constituted by a composite material obtained by coating fabric made of synthetic fibers with a synthetic resin. The average value of the 100% modulus in the warp direction of the fabric texture included in the composite material and the 100% modulus in the weft direction of the fabric texture included in the composite material is 50 N/cm or less. The 100% elongation recovery rate is 95% or more. The 100% elongation load air permeability is 0.1 L/cm2·min or less both before and after thermal treatment at 100° C.
US11052857B2
An assembly includes a belt and one of a buckle or a clip. The belt has a first inflatable portion inflatable to an inflated position, a second inflatable portion inflatable to an inflated position, and an intermediate portion between the first inflatable portion and the second inflatable portion. The intermediate portion includes a fluid channel connecting the first inflatable portion to the second inflatable portion. One of the buckle or the clip is slidably attached to the intermediate portion.
US11052851B1
Developing intelligent systems which take into consideration the economical, environmental, and safety factors of the modern society, is one of the main challenges of this century. Progress in the fields of mobile robots, control architectures, artificial intelligence, advanced technologies, and computer vision allows us to now envisage a smart environment future. The rise of the connected objects known as the “Internet of Things” (IoT) will rival past technological marvels. This application discloses a time synchronous communication IoT network and IoT ranging device to monitor a smart environment. IoT ranging device uses a time of day (TOD), an absolute time, and a time slot assigned to it by IoT network for ranging in the smart environment in order to avoid interference and collision.
US11052849B2
A vehicle member comprises a wooden member and a resin cover member integrally covering the wooden member. The vehicle member absorbs or transmits a received load. The cover member integrally includes a load acting portion and an attaching portion. The wooden member is positioned in the vehicle member so that a shaft center direction of annual rings is aligned with an input direction of the load. The attaching portion is attachable to an attached member of a vehicle.
US11052839B2
A binding structure of wire routing materials are formed by: elongated wire routing materials; a binding member for binding the wire routing materials; and an engaging member including a movable body portion including an engaging portion for assembly into a vehicle body, and a bound portion to be bound and held together with the wire routing materials by the binding member. The bound portion includes a main portion facing the wire routing materials, and a leg portion extending from the main portion and being in contact with the wire routing materials. The movable body portion includes a sliding portion disposed such that sliding thereof is allowed on the wire routing materials in a gap.
US11052834B2
A method for providing image processing for a plurality of vehicular driving assist systems includes mounting a camera module at a portion of an in-cabin side of a windshield of a vehicle. The camera module houses a camera, a circuit board, at least one electrical connector and an image processor. The camera is electrically connected to circuitry of the circuit board via a flexible electrical connection. With the camera module mounted at the vehicle windshield, electrical power is provided to the camera via the flexible electrical connection, the camera is controlled via the circuitry, the camera is operated to capture image data, which is provided to the circuitry via the flexible electrical connection and is received at the circuitry. The image processor processes the image data received at the circuitry of the circuit board for the plurality of driving assist systems of the vehicle.
US11052829B2
An accessory arm for a lift truck includes at least one rear attachment mechanism affixed to a rear overhead guard leg of the lift truck and a front attachment mechanism affixed to a front overhead guard leg of the lift truck. The accessory arm further includes an accessory bar rotationally mounted to the at least one rear attachment mechanism and to engage with the front attachment mechanism when the accessory bar is in a closed position. A wiring harness connected to a battery of the lift truck and routed within the accessory bar to a device mounted to the accessory bar, the wiring harness to provide power to the device.
US11052828B2
A rack for a truck includes a rail system having a first rail and a second rail each having a first end and a second end. The second rail is configured to be spaced apart from and positioned parallel to the first rail. A first support structure and a second support structure each have a first end and a second end and a cross member having a first end and a second end configured to laterally extend between said first rail and said second rail. The first support structure and the second support structure are configured to engage with said rail system. At least the first support structure is configured to be slidably positioned within the rail system such that the first support structure abuts the second support structure in a closed or unloaded configuration and is separated from the second support structure in an open or loaded configuration.
US11052823B2
A vehicle rear monitoring system includes a camera that captures an image of an area to a rear of a vehicle, and a processing unit that processes the image captured by the camera. The processing unit creates a first vehicle rear image that is displayed in a first display area that is a portion of a display area of a display device, when traveling forward, and creates a second vehicle rear image that is displayed in a second display area that is within the display area of the display device and that is an area that includes the first display area and is larger than the first display area, when traveling backward.
US11052821B2
Specifically programmed, integrated motor vehicle dangerous driving warning and control system and methods comprising at least one specialized communication computer machine including electronic artificial intelligence expert system decision making capability further comprising one or more motor vehicle electronic sensors for monitoring the motor vehicle and for monitoring activities of the driver and/or passengers including activities related to the use of cellular telephones and/or other wireless communication devices and further comprising electronic communications transceiver assemblies for communications with external sensor networks for monitoring dangerous driving situations, weather conditions, roadway conditions, pedestrian congestion and motor vehicle traffic congestion conditions to derive warning and/or control signals for warning the driver of dangerous driving situations and/or for controlling the motor vehicle driver use of a cellular telephone and/or other wireless communication devices.
US11052805B2
A console bin assembly for a vehicle includes a bin surface having a perimeter and a wall extending upward relative to the bin surface. A channel having a first end and a second end is located adjacent to the perimeter of the bin surface and the first wall. A drainage hole located near the first end of the channel. The channel is sloped such that the channel guides liquid entering the channel to the drainage hole.
US11052798B2
An air supply device and a method of operating same are provided for a vehicle seat having an air discharge opening provided in the upper region of the vehicle seat, via which opening a head, shoulder, and neck region of the seat occupant can be supplied with an airflow. The airflow is adjustable by a control unit for controlling or regulating a fan rotational speed of a blower and can be heated via a heating element. The control unit is supplied at least one activation signal for activating the air supply device and a temperature signal that provides information about the interior temperature. The control unit activates the heating element and the blower according to the activation signal and then controls at least the blower as a function of the interior temperature.
US11052797B2
A recliner heart includes a housing member, a locking plate and a pawl. The housing member includes a plate surface having a first recess and a second recess. The locking plate includes a surface having teeth formed thereon. The pawl is movable in the first recess between a secure position in which the pawl is engaged with the teeth of the locking plate and a release position in which the pawl is disengaged from the teeth of the locking plate. The pawl includes a boss slidably received in the second recess. A first lateral side of the boss abuts against a sidewall of the second recess upon an impact event.
US11052788B2
A longitudinal adjuster may have a first transverse locking bar accommodated in a slot of a first seat rail. A spindle may be guided through an opening of the first transverse bar in a contact-free manner. At a distance from the first transverse locking bar toward the front, a shoulder of the spindle is arranged. In reaction to a specified action of force, the first transverse locking bar is clamped between the first seat rail and the shoulder. As a result, a force from the first seat rail via the first transverse locking bar, the shoulder, the spindle, and the spindle nut can be diverted to the second seat rail.
US11052782B1
A charging system for a vehicle is provided. The charging system is for charging an energy storage system of the vehicle using grid power. The grid power may be an external three-phase AC. The charging system may use field weakening techniques to reduce a peak line-line voltage detected at input terminals of conversion circuitry when a need is determined.
US11052780B2
The vehicle dispatching system accepts a dispatch request from a user, selects an autonomous vehicle matching with the dispatch request from among a plurality of autonomous vehicles, and dispatches a selected autonomous vehicle to the user. The plurality of autonomous vehicles include a plurality of battery-mounted vehicles having an in-vehicle battery capable of being charged externally as an energy source. Each of the plurality of battery-mounted vehicles performs charging at a charging station when a charging level of the in-vehicle battery decreases. The vehicle dispatching system comprises a management server including a processor for executing programs stored in memory, the management server programmed to act as a charging planning unit that changes an upper limit charging level of the in-vehicle battery when charging at the charging station according to a time slot.
US11052774B2
A rail transit braking energy recovery system. The rail transit braking energy recovery system comprises a braking motor, a fuel battery, an electrolytic bath, and a hydrogen tank. The braking motor is used for converting braking energy of the rail transit into electric energy. An output end of the braking motor is connected to a power input end of the electrolytic bath. The electrolytic bath comprises a hydrogen output end and an oxygen output end, the hydrogen output end is connected to the hydrogen tank, and the hydrogen tank is connected to the fuel battery and is used for supplying hydrogen to the fuel battery. In the system, only the electrolytic bath is structurally added, and the existing vehicle-mounted hydrogen tank is directly used for storing hydrogen, therefore the structure is simple, the self weight of the vehicle body is reduced, the energy conversion efficiency is high, and at the same time, the injection of hydrogen is reduced and the operation cost is reduced. In addition, the purity of the hydrogen obtained by means of electrolysis is high, so that the hydrogen can be directly supplied to the fuel battery to be used without being processed. Also provided is a hybrid power rail transit system.
US11052772B2
Techniques are described for implementing automated control systems that manipulate operations of specified target systems, such as by modifying or otherwise manipulating inputs or other control elements of the target system that affect its operation (e.g., affect output of the target system). An automated control system may in some situations have a distributed architecture with multiple decision modules that each controls a portion of a target system, and may further have one or more components that interacts with one or more users to obtain a description of the target system, including restrictions related to the various elements of the target system, and one or more goals to be achieved during control of the target system. The component(s) then perform various automated actions to generate, test and deploy one or more executable decision modules to use in performing the control of the target system based on the user-specified information.
US11052765B2
A first and a second control device capable of transmitting and receiving signals to and from a third control device that performs an overall management to the control devices. The third device transmits a command signal to the second device in response to a reception signal from the first device. The first device transmits, to the second device and the third device, an electrical power storage unit signal includes at least one of control information and abnormality information about charging/discharging. The second device includes a function of controlling actuation of a rotating electrical machine on the basis of an actuation command signal about actuation of the rotating electrical machine transmitted from the third device in response to the electrical power storage unit signal, and a function of controlling actuation of the rotating electrical machine on the basis of the electrical power storage unit signal transmitted from the first device.
US11052760B2
A vehicle control device incorporating a plurality of vehicle control elements, at least one control apparatus to alter a functionality of the vehicle control elements, each of the vehicle control elements adapted in use to control a valve in a hydraulic line, in which each vehicle control element incorporates a vehicle control display element, the vehicle control display element indicating whether the functionality of the vehicle control element may be altered. This allows a driver when looking at the vehicle control element easily to see from the vehicle control display element whether the functionality of the vehicle control element may be changed.
US11052756B2
A drive device for a motor vehicle includes an electrical machine which is operatively connected to a transmission device via a drive shaft. The transmission device has at least a first and a second planetary stage and a differential stage. Each planetary stage includes a planet set having a plurality of planet gears, the planet gears being rotatably arranged on a planet carrier and meshing with a sun gear and with a ring gear. The second ring gear has external teeth which mesh with internal teeth of a ring gear cup fixed to a housing in a stationary manner.
US11052755B2
A capless fuel door assembly including a body pivotally supported within a housing of the vehicle between closed and opened positions. The body includes an exterior projection exhibiting an angled slide. A spring is secured to the housing and includes an extended portion supported against an end stop location of the projection defining a first end of said angled slide in order to exert the body in the closed position, with opening of the body about the pivot causing a decrease in the closing force as the spring portion displaces along said angled slide to a second end to achieve the opened position.
US11052753B2
A dual-fuel tank houses one or more compressed natural gas (CNG) vessels and one or more diesel fuel vessels. The diesel fuel vessels are generally disposed laterally outwardly from the CNG vessels to provide a buffer that protects the CNG vessels from side impacts. The dual-fuel tank may be retrofit onto a diesel locomotive in place of the locomotive's diesel fuel tank to convert the locomotive into a dual-fuel locomotive. The dual-fuel tank may be provided in a ship.
US11052752B2
A cooling apparatus for cooling compressed air produced by a compressor of a supercharger includes an air-cooled intercooler through which the compressed air flows, a grille shutter capable of blocking a flow of wind toward the intercooler, and a controller. The controller performs control processing to close the grille shutter when an ambient temperature around the intercooler is lower than or equal to zero degrees centigrade and a pressure value of the compressed air is lower than a predetermined pressure value at which condensate water generated within the intercooler is maintained in an unfrozen state at the ambient temperature lower than or equal to zero degrees centigrade, or otherwise performs control processing to open the grille shutter.
US11052746B2
A vehicle drive assembly with transverse dual-power-source, comprising two power sources and an automatic transmission. The automatic transmission has a first input shaft and a second input shaft, and the two power sources are respectively connected to the two input shafts; a first intermediate shaft is provided parallel to the first input shaft, a second intermediate shaft is provided coaxial with the first input shaft, a third intermediate shaft is provided coaxial with the first intermediate shaft, and a first gear and a second gear on the first intermediate shaft are in engaged transmission; a third gear shaft and a fourth gear on the second intermediate shaft are in engaged transmission; and a fifth gear and a sixth gear on the third intermediate shaft are in engaged transmission, and the sixth gear is simultaneously in engaged transmission with a seventh gear on a differential.
US11052744B2
A transmission having a main transmission and a splitter group, and including at least four spur gear planes formed with a countershaft and at least five shifting elements for engaging at least six gears between the transmission input and output shafts. When shifting between gears with the highest and the second-highest gear ratios, a shift occurs in the shifting elements associated with the splitter group but not in the shifting elements associated with the main transmission, whereas when shifting between gears with the lowest and second-lowest gear ratios, a shift occurs in the shifting elements associated with the main transmission but not in the shifting elements associated with the splitter group. An electric machine can be connected by a gearset, and depending on its shift position, the gearset acts as a pre-transmission ratio for the electric machine or as a superimposition transmission.
US11052743B2
A method according to an exemplary aspect of the present disclosure includes, among other things, periodically adjusting powertrain operation of an electrified vehicle equipped with an internal combustion engine to progressively influence oil quality of oil of the internal combustion engine.
US11052716B2
An axle for a vehicle, wherein the axle includes a transverse axle portion having a longitudinal end. The axle including a first axle portion connecting the transverse portion to a chassis of the vehicle and a second axle portion connecting the transverse portion to a wheel carrier for supporting a vehicle wheel. A vibration damper is arranged in a receiver in one of the axle portions.
US11052713B2
A mobility connection system including a left driveshaft and a right driveshaft having an internally hollow shaft shape, and connected to a left wheel portion and a right wheel portion, respectively; a connection shaft having a shaft shape provided inside the left driveshaft or inside the right driveshaft, and slid to the outside of a vehicle to be inserted into and coupled to the inside of the driveshaft of another vehicle which is disposed adjacent to the side thereof when the vehicle is laterally coupled to another vehicle; and a wheel detecting sensor provided at the left side or the right side of the vehicle, and for detecting whether the driveshafts facing each other when the vehicle is coupled to another vehicle have been aligned with each other or the spacing distance therebetween is formed.
US11052709B2
A pneumatic tire includes land portions defined by grooves, and sipes that are formed in the land portions and intersect the grooves. The sipes form acute angle portions and obtuse angle portions with the grooves. Notches are formed in the obtuse angle portions.
US11052708B2
A pneumatic tire includes: a protrusion portion projecting outward in a tire lateral direction disposed in a buttress portion; and a linear portion with a linear shape when viewed in a tire meridian cross section, the linear portion constituting a surface of the protrusion portion at a position inward in a tire radial direction from a corner portion, the corner portion being an end portion of the protrusion portion outward in the tire lateral direction; the corner portion being located within a retreading development width position, which is a range in the tire radial direction in which a boundary for removing a tread when retreading is located; and the linear portion having an angle ranging from 45° to 90° with respect to a horizontal line parallel with a tire rotation axis at a position inward of the linear portion in the tire lateral direction.
US11052706B2
A green tire includes a plurality of sheets of green rubber having a substantially circular shape, wherein each sheet of green rubber includes an upper ring and a lower ring, and each sheet of green rubber further includes a plurality of spoke portions extending from the upper ring to the lower ring. The green tire further includes a plurality of reinforcements. Each reinforcement is disposed between adjacent sheets of green rubber. At least one reinforcement is sandwiched between the upper rings of adjacent sheets of green rubber, and at least one reinforcement is sandwiched between the spoke portions of adjacent sheets of green rubber.
US11052693B2
The invention comprises a mechanical handwriting system linked to a user input system to generate a plotted document, such as a greeting card, note card or document, using a conveyor belt unit to support and move the document, a plotter, and a series of rollers to position and constrain movement of the greeting card, which is optionally and preferably linked to a paper feeder system in an assembly line format, where the rollers are optionally and preferably adjustable in position to accommodate varying paper sizes and to allow movement of the document during a plotting period to avoid positional overlap constraints of the rollers and a plotter head of the plotter in a process of plotting the document/card in sections.
US11052692B2
A covering assembly is disposed on an inked printing assembly of a stamp. The covering assembly has a top cover and a bottom cover. The top cover is detachably disposed above the inked printing assembly. The bottom cover is detachably disposed below the inked printing assembly, is located below the top cover at a spaced interval, and has a bottom wall. The covering assembly can assist in assembling the inked printing assembly. The disposition of the top cover and the bottom cover can transfer pointed force into planar force for increasing a contact area, the forcing uniformity, and the assembly convenience.
US11052691B2
Examples of the present disclosure relate to a calibration method for a printing system. The method comprises printing a diagnostic pattern representative of decap time. The diagnostic pattern comprises the firing of nozzles after an exposure to ambient air during a first predetermined time period to produce a first pattern element and the firing of nozzles after an exposure to ambient air during a second predetermined time period to produce a second pattern element. The method includes scanning the resulting diagnostic pattern with a sensor to collect decap data in a digital form, digitally analyzing the decap data, the digital analysis comprising identifying a quantitative difference between the first and second pattern elements, and modifying a servicing process of the printing system if the quantitative difference passes a predetermined threshold.
US11052683B2
A single nip de-skew, lateral registration, and process direction registration device removes skew, laterally registers, and registers in the process direction substrates moving along a media transport path. The single nip de-skew, lateral registration, and process direction registration device includes a fixed roller that is longer than a rotating wheel that forms a nip with the fixed roller. The wheel has a coefficient of friction that is higher than a coefficient of friction of the roller so an actuator translating the wheel along the fixed roller laterally registers and de-skews substrates.
US11052682B2
Devices and methods for identifying categories or types of print media in image forming apparatuses are disclosed. In an example method print media are advanced in a feeding direction to reach a cutting position, a cutter is advanced in a cutting direction, perpendicular to the feeding direction to cut the print media, friction between the cutter and the print medium is measured, and the print media are identified based on the measured friction.
US11052676B2
A printing device 1 includes a platen roller 7 which feeds a thermal tape 42, a thermal head 8 which performs printing on the thermal tape 42, and a control circuit 12. The control circuit 12 rotates the platen roller 7 backward to feed the thermal tape 42 backward in order to make a printing start area PT of the thermal tape 42 reach a backward feed position more away from an outlet 2b than a normal position NP of the thermal head 8. After that, the control circuit 12 rotates the platen roller 7 forward to perform printing using the thermal head 8.
US11052674B2
To reduce an influence of a flow of ambient atmosphere and the like on flying of a droplet ejected from a nozzle of an inkjet head. To exhaust vapor of a solvent contained in a coated film while reducing an influence on flying of the droplet. An exhaust device for inkjet coating includes: a cover that covers at least a target range on an object to be coated, the target range being a range in which a droplet lands that is ejected from an ejection nozzle of an inkjet head to a surface of the object to be coated; a closing member that closes a gap between the cover and the object to be coated around the target range; an external communication portion through which a compartment surrounded by the cover, the object to be coated, and the closing member communicates with an outside; and an exhaust mechanism configured to exhaust air from the compartment.
US11052669B2
In one example, an article for a replaceable printer component includes an integrated circuit device having a device controller, a conductor to supply power to the device controller and to carry a signal to and from the device controller, and a sensor operatively connected to the device controller to sense a voltage and/or a frequency on the conductor. The device controller to send an indication of a sensed voltage and/or a sensed frequency to the printer controller.
US11052666B2
In an example, a printhead carriage to be used in a printing system is disclosed herewith wherein the carriage includes a pocket defined by a first wall and a second wall opposite to the first wall; a set of electrical connectors provided on the first wall; and a mechanical protector. In an example, the mechanical protector may be a sheet with a determined length that extends from the first wall into the pocket and a width that extends along the width of the first wall over the electrical connectors. In an example, the mechanical protector includes an elastic member biased towards the second wall.
US11052664B2
A liquid absorbing device includes: a liquid absorber containing fibers and an anionic absorbent resin designed to absorb a liquid; a container having a feed port to which the liquid is supplied, a storage section that is connected with the feed port and that stores the liquid absorber, an inflow section configured such that part of the liquid flows into when the liquid is supplied to the storage section, and a communicating portion that connects the storage section with the inflow section; and a detection unit that is provided in the inflow section and that is configured to detect a surface of the liquid in the inflow section.
US11052659B2
There is provided a liquid discharge apparatus including: a discharging member including a plurality of individual electrodes arranged side by side in a first direction, a plurality of individual channels arranged side by side in the first direction, a plurality of nozzles arranged side by side in the first direction, a common channel communicating with the plurality of individual channels, and an opening communicating with the common channel; and a heating member at least a part of which makes contact with the discharging member. An individual electrode, included in the plurality of individual electrodes and located at an end in the first direction, and the opening are apart from each other in the first direction. At least the part of the heating member is a part making contact with the discharging member, at a location between the opening and the individual electrode located at the end in the first direction.
US11052653B2
A system for processing water washable flexo photopolymer printing plates, the system comprises a washing line including one or more brushes and a surface essentially facing said brushes, and a guiding means adapted to guide a water washable photopolymer printing plate through the washing line by pulling it from a vicinity of a downstream edge thereof and automatically dragging such water washable photopolymer printing plate on said surface. Said brushes are adapted to contact onto a side of such water washable photopolymer printing plate in a washing direction from the downstream edge towards an upstream edge thereof. The system further comprises one or more attachments adapted to be annexed to the vicinity of the upstream edge of a water washable photopolymer printing plate, the attachments being further adapted to exert friction onto the surface, said friction being greater than that between such water washable photopolymer printing plate and said surface.
US11052646B2
In a lining material peeling method of peeling a lining material, which is fixedly formed on a surface of a base material, from the base material, a liquefied fluid which evaporates after injection is injected to a boundary between the base material and the lining material.
US11052644B2
An electrical conductor includes: a first conductive layer including a plurality of ruthenium oxide nanosheets, wherein at least one ruthenium oxide nanosheet of the plurality of ruthenium oxide nanosheets includes a halogen, a chalcogen, a Group 15 element, or a combination thereof on a surface of the ruthenium oxide nanosheet.
US11052639B2
Thermoplastic film suitable as an intermediate layer for a laminated glass pane, wherein the thermoplastic film includes a defined region, which is provided for a camera window or an HUD (head-up display) region that has a non-zero wedge angle, and a region surrounding the defined region on all sides, in which the thermoplastic film has a substantially constant thickness, wherein the maximum thickness in the defined region of the thermoplastic film is less than the thickness in the surrounding region.
US11052637B2
A structure containing a Sn layer or a Sn alloy layer includes a substrate, a Sn layer or Sn alloy layer formed above the substrate, and an under barrier metal formed between the substrate and the Sn layer or Sn alloy layer in the form of a single metal layer containing any one of Fe, Co, Ru and Pd, or an alloy layer containing two or more of Fe, Co, Ru and Pd.
US11052635B2
Provided is a sheet-type molded body that is formed by sewing a sheet, wherein thread is used for at least part of said sewing, the thread being composed of a resin composition for thread containing resin for thread, the thread having a melting point of no more than 200° C., and a laminate comprising: the sheet-type molded body; and a polyurethane foam formed body, the sheet-type molded body, and the laminate comprising: the sheet-type molded body; and a polyurethane foam layer being able to be produced by a simple method at low cost without damaging design qualities over time, and making it possible to prevent leakage of raw material etc. from sewed portions when backed with the polyurethane foam layer.
US11052632B2
An article comprising a flexible mesh layer pliable enough for being arranged in direct planar contact with a contoured surface, the mesh layer providing one or more attributes of adhering, sealing or reinforcing to a surface receiving the flexible mesh.
US11052630B2
A sheet processor subjecting a sheet having been conveyed forward to processing along a direction perpendicular to a conveyance direction of the sheet, includes: a processing unit performing the processing; and a receiving unit receiving the processing unit therein in a state capable of perfecting the processing on the sheet, and the processing unit includes a first processing tool 4A and a second processing tool 4B disposed to vertically oppose each other with a conveyance surface of the sheet disposed therebetween, and the receiving unit includes at least one receiver that removably receives the first processing tool 4A and the second processing tool 4B in the state capable of performing the processing on the sheet, with arbitrarily selected one of the first processing tool 4A and the second processing tool 4B disposed above the conveyance surface, and with arbitrarily selected another of the first processing tool 4A and the second processing tool 4B disposed below the conveyance surface.
US11052628B2
A bag making and packaging machine has pull-down belt mechanisms, a transverse sealing mechanism, a rotatable folding member, and a gas blowing mechanism. The folding member, before the transverse sealing mechanism, seals a cylindrical film, pushes against a side portion of the cylindrical film to thereby fold the cylindrical film inward and form a fold in the cylindrical film. The gas blowing mechanism blows a gas onto the fold to thereby inhibit the cylindrical film from sticking to the rotating folding member.
US11052620B2
A guiding device for guiding a fiber texture on an impregnation mandrel of a winding machine, the device including a first radial spacer for placing facing a first cheekplate of the impregnation mandrel, a second radial spacer for placing facing a second cheekplate of the impregnation mandrel, and a cross-member suitable for supporting the first and second spacers, the cross-member including an adjustment system for adjusting the positions of the first and second spacers and suitable for positioning the first and second spacers apart respectively from the first and second cheekplates of the impregnation mandrel so as to hold a first portion of fiber texture that extends along the first cheekplate pressed against the first cheekplate, and a second portion fiber texture that extends along the second cheekplate pressed against the second cheekplate, without blocking rotation of the impregnation mandrel.
US11052616B2
A method for manufacturing a multilayer fiber structure includes providing a receiving surface being formed by a first surface region of a contoured tool surface of a forming tool component and a support surface of a support component. Further, at least one fiber layer is formed on the receiving surface by laying down a plurality of fiber tapes onto the receiving surface. A roller device is positioned so as to press the at least one fiber layer against the tool surface and the support component and the roller device are synchronously moved along a curved transition region connects the first surface region to a second surface region of the tool surface. Thereby the at least one fiber layer is abutted against the transition region and the second surface region of the tool surface. Further, a tool system for manufacturing a multilayer fiber structure is disclosed.
US11052611B2
A fabricating apparatus includes processing circuitry. The processing circuitry is configured to receive designation of a scheduled fabrication start time of a fabrication object, detect a change in a fabrication practicability condition of the fabricating apparatus, and output change information indicating an occurrence of a change in the fabrication practicability condition of the fabricating apparatus when the change in the fabrication practicability condition has been detected after reception of the designation of the scheduled fabrication start time.
US11052610B2
A powder delivery device for providing raw material powder to a powder application device of a powder bed fusion apparatus is provided. The powder delivery device comprises a powder supply section configured to receive raw material powder, the powder supply section comprising an outlet for providing the raw material powder to the powder application device. The powder delivery device further comprises a first physical parameter determining unit arranged at a first location of the powder supply section and configured to determine a first physical parameter in the powder supply section, and a controller configured to determine whether the first physical parameter meets a first tolerance criterion, and a powder treatment unit. The controller is configured to instruct the powder treatment unit to perform a powder treatment in case it determines that the first physical parameter does not meet the first tolerance criterion.
US11052603B2
An additive manufacturing system is disclosed for use in fabricating a composite structure. The additive manufacturing system may include a print head configured to discharge a continuous reinforcement that is at least partially wetted with a matrix, and a support configured to move the print head in at least one dimension during discharge. The additive manufacturing system may also include a cutting mechanism connected to at least one of the print head and the support. The cutting mechanism may be configured to selectively sever the continuous reinforcement from the print head. The cutting mechanism may include a cutting implement, a first actuator configured to move the cutting implement from a stowed position to a deployed position, and a second actuator configured to engage the cutting implement with the continuous reinforcement.
US11052601B2
In a 3D-printing system, a deposition head comprising a band assembly having a body and a band for compacting a filament onto the surface of an object being manufactured. One or more actuators are mounted on the assembly body and are used to shape the band to a desired contour. The band is connected to the one or more actuators, is curved toward the surface of the object to enable contact with the surface, and is capable of being driven along its length by one or more drive wheels that are under the control of a controller. The drive wheels are configured to advance the band along its length by a first distance and in response to a first signal from the controller. The controller provides the first signal based on an estimate of thermoplastic build-up on a portion of the band that overlaps the point of compaction.
US11052597B2
Described is a method of forming a structure having viscoelastic properties. The method can include a) depositing a layer of droplets of a solidifying material and a non-solidifying material, the droplets being deposited according to an occupancy matrix specifying voxels for the solidifying and non-solidifying materials, the solidifying and non-solidifying material being interspersed within the occupancy matrix, the occupancy matrix being generated by a probabilistic function; b) exposing the droplets of solidifying material to ultraviolet radiation to cure the solidifying material; and c) repeating a) and b) to deposit additional layers of droplets of solidifying and non-solidifying materials, thereby forming the structure having viscoelastic properties.
US11052592B2
An extruder assembly has a frame with upstream and downstream ends. A barrel assembly on the frame has a passage. At least one material advancing component resides at least partially within the passage and is configured to be turned around an operating axis to thereby cause material to be conveyed from a passage inlet to a passage outlet. A drive assembly turns the at least one material advancing component around its operating axis and has a motor on the frame situated so that at least a part of the motor is in lengthwise overlapping relationship with the barrel assembly. The drive assembly is configured to turn the one material advancing component around its operating axis at a speed of at least 300 rpm.
US11052578B2
A method for producing a thermoplastic combination film suitable for a composite glass pane, wherein the thermoplastic combination film includes at least one defined area, which is provided for a camera window or an HUD (head-up display) region that has a variable wedge angle, the method including providing a first thermoplastic film, producing a second thermoplastic film with a variable wedge angle, wherein the three-dimensional shape of second thermoplastic film is obtained by molding on a mold, and joining together the first thermoplastic film and the second thermoplastic film.
US11052575B2
Disclosed is an elastomeric bladder tool and related systems and methods. In one embodiment, the elastomeric bladder tool comprises an elastomeric inner layer substantially defining an inner cavity of the elastomeric bladder tool, an elastomeric outer layer substantially defining an outer surface of the elastomeric bladder tool, and a permeable middle layer positioned between the elastomeric inner layer and the elastomeric outer layer. The permeable middle layer has greater permeability than both the elastomeric outer layer and the elastomeric inner layer to allow for evacuating of gases that have entered the permeable middle layer.
US11052572B2
Systems for and methods of forming structural components, such as a spar cap (503), from layers of a fiber reinforced material obtained from rolls of the material are disclosed. The system comprising: a plurality of rolls (514) including a first roll (514a) and a second roll (514b) of the fiber reinforced material (504), the first roll has one or more first lines (530) printed thereon. The first lines indicating where the fiber reinforced material on the first roll is to be separated into a plurality of discrete first pieces (531-1) for forming the structural component (503). The fiber reinforced material on the second roll has one or more second lines (530) printed thereon. The second lines indicating where the fiber reinforced material on the second roll is to be separated into a plurality of discrete second pieces (531-2) for forming the structural component (503). The systems and methods achieve a substantial reduction in the amount of wasted material.
US11052571B2
Systems and methods are provided for fabricating preforms for composite parts. One embodiment is a method of creating a preform. The method includes conveying a web of fiber reinforced composite material in a process direction, disposing fiber reinforced composite material atop the web, conveying the web and the tow in the process direction to a cutting tool, and cutting out a preform comprising a combination of the tow and the web.
US11052570B2
A process for producing foamed thermoplastic polyurethane particles comprises the steps of a) melting a thermoplastic polyurethane in a first extruder (E1), b) injecting a gaseous blowing agent in a second extruder (E2), c) impregnating the gaseous blowing agent homogeneously into the thermoplastic polyurethane melt in a third extruder (E3), d) extruding the impregnated thermoplastic polyurethane melt through a die plate and granulating the melt in an underwater granulation device under temperature and pressure conditions to form foamed thermoplastic polyurethane particles.
US11052566B2
A pole for supporting a cable. The pole includes a plurality of truncated cones arranged in a linear array to form the pole, wherein each truncated cone receives an adjacent truncated cone within its interior. Each truncated cone in the pole is formed from a veneer by moving the longitudinal edges of the veneer towards each other. A method of manufacturing the pole and various uses of the pole are also provided.
US11052557B2
A razor includes one or more blades that are directly or indirectly heated by RF energy. A control circuit is connected to and operates a high frequency (HF) generator and a HF power amplifier (HFPA) for generating radio frequency (RF) energy throughout a range of controllable power levels. The generated RF energy is guided by a wave guide from the HFPA to a resonance chamber (i.e., band pass filter cavity). The RF energy is radiated from the resonance chamber towards the one or more blades which absorb the RF energy, thereby causing the temperature of the blades to increase. An energy source provides the electric current required for operating the control circuit, the HF generator and the HFPA. In another embodiment, the RF energy is radiated from the resonance chamber towards a heating element that increases in temperature and heats the blades by thermal conduction.
US11052552B2
A safety blade for use with a knife assembly comprises a blade body, a bade attachment having a cutting edge and a top edge opposite the cutting edge, a blade attachment having a first half and a second half connected together via a hinge and extending beyond the top edge of the blade body to define a clamshell for receiving the blade body, and a handle adaptor having a handle engagement portion for removably securing the blade attachment to a handle.
US11052543B2
A control device includes a control section configured to control a motion of a robot arm using values detected by a plurality of distance sensors. The plurality of distance sensors include a first distance sensor and a second distance sensor disposed in a first direction orthogonal to the axial direction of a dispenser. The second distance sensor is disposed in a position further apart from the dispenser than the first distance sensor. The control section executes, on a robot, a first instruction for causing the robot to execute discharge of a discharge object by the dispenser when a distance acquired by the first distance sensor is a distance in a predetermined range and a distance acquired by the second distance sensor is a distance larger than the distance in the predetermined range.
US11052539B2
Method, server and storage medium for robot routing are provided. An operation area of the robot is gridded into a plurality of cells arranged in rows and columns. The method includes: planning, for the robot, a traveling path from a starting point to a destination point, where the traveling path is divided into a plurality of path segments; and reserving, one or more cells corresponding to a first path segment for the robot, where the first path segment is anyone of at least one among the plurality of path segments, in case that there is the deadlock phenomenon, refraining from reserving the cell for the robot, and re-checking whether the deadlock phenomenon is still present in the cell after a preset interval; and in case that there is no deadlock phenomenon, reserving the cell for the robot.
US11052525B2
A hammer drill includes a housing, a tool holder, a hammering member, a gear, and a conversion member. The gear is switched to a first state where a rotation of the intermediate shaft is transmitted and a second state where the rotation of the intermediate shaft is not transmitted, and a mode switching member is configured to perform a switching operation of the state of the gear from an outside of the housing. The switching of the state of the gear by the mode switching member provides at least two operation modes of a hammer drill mode where the gear integrally rotates with the intermediate shaft to generate the rotation and a reciprocation of the hammering member on the tool holder and a hammer mode where the gear is separated from the rotation of the intermediate shaft to generate only the reciprocation of the hammering member.
US11052521B2
A crimping device includes a housing defining a bore and at least three extendable mechanisms angularly equispaced about the axis of the bore. Each of the extendable mechanisms include: (i) a first elongate arm hingedly connected at or near a first axial end of the first arm to the housing; (ii) a second elongate arm hingedly connected at or near a first axial end of the second arm to the housing, wherein: the first axial ends of the first and second arms are displaceable relative to each other; and the first and second arms are hingedly connected at or near their second axial ends to each other. The crimping device further includes means for equi-displacing the first axial ends of coupled first and second arms relative to each other, thereby to configure the crimping device between: (i) a dilated condition in which the second axial ends of the first and second arms are maximally spaced from the bore axis; and (ii) a contracted condition in which the second axial ends of the first and second arms are minimally spaced from the bore axis.
US11052518B2
A liner 7 is provided with a cylinder portion 14a is formed in parallel to the rotation axis, and also a hydraulic fluid flow path 14c is formed which opens to a cylinder portion 14a to communicate with the interior of the liner serving as a high-pressure chamber and a low pressure chamber at the time of occurrence of the striking torque, and an automatic relief mechanism 14 is provided in which a cylindrical valve element 14b having a cutout portion 14b′ serving as a flow path for hydraulic oil formed on the outer peripheral surface portion is disposed inside the cylinder portion 14a so as to be freely rotatable.
US11052515B2
The 90 Degrees utilizes dual ratio constant mesh gears which provides suitable use for ratchets in hard to access spaces, and particularly well suited for automotive use. The mesh gears are configured to be used either with manual or pneumatic tools. A female socket element recedes into the housing having gears therein and a male socket element meshes with the female socket element and is shaped to accommodate a female socket element at 90 degrees or the adapter element of a drive ratchet. You can use an elongated drive shaft to accommodate distance. Positioned within the housing of the adapter body are gears secured to mesh within the housing of the adapter. Rotation of the female socket element by a drive ratchet in one direction will rotate the male socket element in the opposite direction without any change in direction is governed by the ratchet use.
US11052513B2
A pneumatic-fixation connecting having a body, a movable part, a plurality of spheres, a plurality of elastic units, and a plurality of stop units is disclosed, wherein each of the elastic units is disposed between the body and the movable part via each of the stop units, respectively. When an external force is applied on the movable part, the distance between the movable part and the body is reduced and the sphere does not block the connecting pin in the extension tube inside the body. When the external force disappears, the distance between the movable part and the body increases such that the sphere affixes the connecting pin and the body. The stop unit can be used, not only to adjust the length and elastic force of the elastic unit so as to extend the life cycle of the elastic unit, but also to help in changing the elastic unit which in turn enhances the efficiency of the replacement work.
US11052504B1
A temperature regulation system and a temperature regulation method are applicable to a machine tool. The temperature regulation system includes a cooling fluid storage tank, a heating fluid storage tank, an internal circulation subsystem, an external circulation subsystem and a computing unit. The internal circulation subsystem includes a first valve. The external circulation subsystem includes a plurality of flow channels and a second valve and a third valve disposed on the plurality of the flow channels. The computing unit controls the first valve, the second valve and the third valve to switch flow directions of the plurality of the flow channels among the cooling fluid storage tank, the heating fluid storage tank and machine tool. Therefore, a thermal balance of the machine tool can be effectively maintained.
US11052481B2
A method for processing a transparent workpiece includes directing a pulsed laser beam into the transparent workpiece such that a portion of the pulsed laser beam directed into the transparent workpiece generates an induced absorption within the transparent workpiece, thereby forming a damage line within the transparent workpiece, and the portion of the pulsed laser beam directed into the transparent workpiece includes a wavelength λ, a spot size w0, and a Rayleigh range ZR that is greater than F D π w 0 2 λ , where FD is a dimensionless divergence factor comprising a value of 10 or greater. Further, the method for processing the transparent workpiece includes etching the transparent workpiece with an etching vapor to remove at least a portion of the transparent workpiece along the damage line, thereby forming an aperture extending through the at least a portion of the thickness of the transparent workpiece.
US11052477B2
A slag removal apparatus for removing slag from support plates provided to support an object to be processed in a cutting machine is disclosed. The slag removal apparatus includes a scraper including a plurality of blades around an outer surface of a bar crossing the support plates, and a plurality of slots formed in the respective blades along a length direction and thus formed around the bar and in a length direction of the bar, a rotation support unit to which the scraper is rotatably installed, a rotation driving unit rotating the scraper from the rotation support unit to remove slag attached to the support plates by the blades, when the support plates are inserted into the slots, a lifting unit lowering the scraper, for insertion of the support plates into the slots and raising the scraper to an original position by raising and lowering the rotation support unit, and a first transfer unit moving the rotation support unit along a length direction of the support plates to allow the scraper to remove the slag along the length direction of the support plates.
US11052472B2
A cutting insert includes a rake face configuring one of polygonal surfaces, a seating surface configuring the other one of the polygonal surfaces, and a side surface connecting the rake face and the seating surface to each other. The cutting insert has a cutting edge portion including a main cutting edge located in a side portion of the rake face, a subsidiary cutting edge connected to the main cutting edge, and a corner cutting edge connected to the subsidiary cutting edge and located in a corner portion of the rake face. The side surface includes a flank face and a connection surface which are adjacent to each other in a thickness direction via a boundary line. The connection surface is located on the seating surface side, and is located outside than an extension line of the flank face.
US11052470B2
THIS invention relates to a drilling accessory for a power drill drilling accessory that assists the operator of the power drill to correctly align and orientate the drill bit of the power drill with the target object, and collects the dust and/or debris arising from such drilling. The drilling accessory includes a cap having a plurality of differently sized guide holes and a container to which the cap is pivotally connected. The container comprises a first through hole, which on rotation of the cap relative to the container, enables the first through hole to be aligned with the require guide hole thereby to allow a drill bit to pass therethrough. The container further comprises a base having a planar support surface portion and a seal portion protruding outwardly from the support surface portion towards a contact lip, which contact lip defines a second through hole coaxially aligned with the first through hole. The protruding seal portion defines a bore therein tapering radially inwardly from the planar surface portion of the base towards the contact lip, which in use biases the contact lip into sealing engagement with the target object to efficiently collect dust and debris, with substantially the entire planar support surface portion contacting the target object thereby to provide a stability for drilling straight holes.
US11052468B2
A surface roughening tool includes a cylindrical body and at least one grooving blade outwardly radially projecting from the body and configured to form grooves and peaks into a surface. The surface roughening tool also includes at least one swaging blade outwardly radially projecting from the body and configured to deform the peaks. The at least one swaging blade is aligned with the at least one grooving blade along a circumference of the body.
US11052462B2
An additive manufacturing product is provided. The additive manufacturing product includes an embedded electronic, a transition zone, and a base material. The transition zone encases the embedded electronic. The transition zone includes transition material. The base material encases the transition zone. The transition material includes an intermediate melting point that is lower than a melting point of the base material.
US11052445B2
A method of forming a part includes extruding a billet through a die, forming a round, closed geometry tube from the billet, and hydroforming the round, closed geometry tube. The extrusion die contains an orifice with a central mandrel, a plurality of bridges, and a corresponding plurality of portholes between the bridges. A spacing of the bridges around the mandrel is non-equiangular. As a result, the round, closed geometry tube has non-equiangular welds after emerging from the die.
US11052442B2
To provide a copper-coated magnesium wire which meets the demand for a lightweight coil wire material, and a method for manufacturing the same. The above-described problem is solved by a copper-coated magnesium wire (10) comprising a core material (1) made of magnesium, and a copper coating layer (2) made of copper or a copper alloy provided on a surface of the core material (1). In the copper-coated magnesium wire (10), a wire drawing mark is present on a surface of the copper coating layer (2), and the diameter is preferably within a range of 0.03 to 0.08 mm, inclusive. Further, a thickness of the copper coating layer (2) is preferably within a range of 5 to 30%, inclusive, as a ratio of the overall cross-sectional area. An insulating coating layer (3) may be provided on an outer circumferential side of the copper coating layer (2).
US11052433B2
An ultrasonic cleaning equipment (1) according to the present invention includes a treatment tank (10) that stores a cleaning liquid that cleans an object to be cleaned and in which the object to be cleaned is immersed; an ultrasonic application mechanism (20) that applies ultrasonic waves to the cleaning liquid retained in an interior of the treatment tank; and a curved surface member (30) that is located in a range defined by an angle of inclination from a perpendicular direction in an end portion of a vibrating surface of the ultrasonic application mechanism to an outside with respect to the vibrating surface and that is held on a wall surface and/or a bottom surface of the treatment tank.
US11052412B2
A sprayer includes a spray gun and a hopper. An air source provides compressed air to the sprayer to both eject fluid from the spray gun as a spray and to pressurize the hopper. The spray gun includes an airflow controller for controlling the flow of the compressed air to a nozzle of the spray gun, a pressure regulator for regulating a pressure of the compressed air flowing to the hopper, and a relief valve between the pressure regulator and the hopper. The hopper receives the compressed air through a port in the hopper, and the compressed air assists the flow of material out of the hopper and into the spray gun.
US11052411B2
A nozzle device and method for creating a fluid nucleation in situ, is disclosed. The nozzle has a housing having a hollow interior, an outer cylindrical wall, and inlet and an outlet, and a diffuser disposed in the cylindrical tube at a first end toward the inlet. The diffuser is configured to break bonds between adjoining fluid molecules and create a nucleation event. The nozzle further has a mesh framework disposed in the cylindrical tube and extending longitudinally within the tube in the nucleation zone, and is configured to manipulate the bonding and un-bonding of water molecules within a pressurized environment for the production of snow, clean water or both.
US11052407B1
A dielectrophoresis-based in-droplet cell concentrator is disclosed herein. The concentrator can include a concentration microchannel having an input port and two or more outlet ports. The input port introduces cell-encapsulated droplets or particle-encapsulated droplets into the microchannel; a first outlet port receives droplets including most of the cells or particles and a second output port receives droplets including few cells or particles. The concentrator also can include a pair of electrodes. When voltage is applied, the electrodes will create an electric field across the microchannel. The concentrator adds new capabilities to droplet microfluidics operations, such as adjusting concentrations of cells in droplets, separating cells of different properties from inside droplets, and solution exchange.
US11052404B1
An apparatus for remediation of a copper and nickel co-contaminated soil includes a housing. A crushing device is arranged at the upper part of the inside of the housing. A stirring device is arranged below the crushing device. An anode electrode and a cathode electrode are provided at both ends of the inner bottom of the housing, respectively. In the present invention, the soil contaminated by copper and nickel is first poured from the top of the crushing device, and then crushed thoroughly under the action of the crushing device. The crushed soil facilitates the movement of copper and nickel metal ions therein toward the electrodes under the action of the anode electrode and the cathode electrode, thereby achieving optimal soil remediation.
US11052403B2
A protection device for tools for cutters and shredders and the like, arranged on a tool-holder seat for a tool-holder rotor rotatable about the axis of the rotor, said tool being housed in a seat arranged on the tool-bolder rotor, and formed by a first surface arranged at the front in the cutting direction and a second surface onto which the tool is fixed with its opposite surface to the cutting direction, the tool having a body that has a front surface in the rotation direction of the rotor, and a rear surface opposing the front surface. The tool and/or the seat having lateral projections and a protection device is dismountable connected to the seat of the tool, laterally as a protection for the tool and the plates being arranged partially between the lateral projections, of the tool and/or the seat of the tool, and the tool-holder rotor.
US11052399B2
A powder gathering apparatus includes at least two rotating plates and a driving mechanism. The at least two rotating plates are disposed with respect to each other. Each of the rotating plates includes at least one spherical member. The at least one spherical member protrudes from the rotating plate. The driving mechanism drives at least one of the at least two rotating plates to move, such that the at least two rotating plates get close to or away from each other. The driving mechanism drives the at least two rotating plates to rotate.
US11052391B2
A microfluidic device, including a controllable shape-changing micropillar where a shape of the shape-changing micropillar is changed by a fluid.
US11052388B2
A method of manufacturing a microfluidic device, said method comprising placing a length of material in a liquid polymer, configuring the length of material to define the path of a microfluidic channel, curing or setting the polymer liquid to form a solid polymer around the configured length of material, and dissolving the configured length of material with a solvent to provide a microfluidic channel in the solid polymer.
US11052381B2
A modified Y-type molecular sieve has a rare earth oxide content of about 4% to about 12% by weight, a phosphorus content of about 0% to about 10% by weight, a sodium oxide content of no more than about 1.0% by weight, a total pore volume of about 0.36 to 0.48 mL/g, a percentage of the pore volume of secondary pores to the total pore volume of about 20% to about 40%, a lattice constant of about 2.440 nm to about 2.455 nm, a percentage of the non-framework aluminum content to the total aluminum content of no more than about 10%, a lattice collapse temperature of not lower than about 1060° C., and a ratio of Brønsted acid to Lewis acid of no less than about 3.50. The preparation of the molecular sieve includes ion-exchange with rare earth, hydrothermal roasting, gas phase ultra-stabilization, acid treatment, and an optional phosphorus modification.
US11052376B2
The present disclosure provides for a porous gas sorbent monolith with superior gravimetric working capacity and volumetric capacity, a gas storage system including a porous gas sorbent monolith of the present disclosure, methods of making the same, and method for storing a gas. The porous gas sorbent monolith includes a gas adsorbing material and a non-aqueous binder.
US11052373B2
The present invention relates to processes and apparatus useful for (fast) ionic polymerisation of liquid monomer(s) containing reaction mixture for the production of the corresponding polymer(s).
US11052362B2
A device for spherification of a liquid includes a first device for storing a first liquid; and a spherification tank for storing a second liquid, arranged so that a dripper or entry funnel controls a level of the second liquid in the spherification tank. A device meters the first liquid coming from the first tank into the spherification tank. An extraction device extracts spheres generated in the spherification tank as a result of the metering. The extraction device includes a worm screw located in the spherification tank, the worm screw being arranged at an angle to the level, and a motor for rotating the worm screw.
US11052360B2
A mixing machine includes a head extending over a bowl receiving location, the head including a downwardly extending rotatable output shaft for receiving a mixer tool. A drive train including a motor having an output operatively connected to drive a planetary gear system that effects rotation of the rotatable output shaft about its axis and orbiting of the shaft axis about another axis. A control system includes a master control unit and a slave control unit, the master control unit connected with a first sensor located along the drive train between the motor and the planetary gear system, the slave control unit connected with a second sensor, wherein both the slave control unit and the second sensor rotate with a part of the planetary gear system, wherein the master control unit and the slave control unit are configured for wireless communication with each other.
US11052357B2
The invention relates to a stirring member (9) for using in a system for preparing a food product, the product being prepared by the stirring member (9) moving inside a container (8), the stirring member (9) being configured in such a way that it can adopt different configurations depending on its direction of rotation inside the container (8). Preferably, the stirring member (9) can adopt a spoon configuration or a whisk configuration. The invention further relates to a method for using such a stirring member (9) in a system for preparing a food product, the method varying the direction of rotation of the stirring member (9) so that it adopts a different configuration depending on the type of product prepared in the container (8).
US11052328B2
A fuel stabilization system for removing oxygen from fuel includes an accumulator disposed along a fuel line, the accumulator includes a fuel inlet and a fuel outlet and a heat source disposed in thermal communication with the fuel in or upstream of the fuel inlet of the accumulator to increase the temperature of the fuel within the accumulator. The accumulator is configured to allow oxygen deposits to form therein as a result of the temperature increase of the fuel.
US11052325B2
Provided are a mono-ethylene glycol (MEG) recovery apparatus and a MEG recovery method. The MEG recovery apparatus includes a pretreater receiving the raw material from a raw material supplier to remove the low soluble salts, a first distiller connected to the pretreater to receive the raw material from which the low soluble salts are removed, and to form a first treated solution by vaporizing a certain amount of the water, a high soluble salt remover connected to the first distiller to remove the high soluble salts from the first treated solution, a second distiller connected to the high soluble salt remover to form a second treated solution by vaporizing the water from the first treated solution from which the high soluble salts are removed, and a recovery unit connected to the second distiller to recover the second treated solution.
US11052321B2
A system that collects, analyzes, and applies physical metrics from participants in game environments. Participants (players and/or spectators) in a game may wear or hold devices that collect physical data from the participants via sensors, generate metrics data from the sensor data, and provide the metrics data to a participant metrics module. The module may receive the metrics data from the devices, analyze the metrics data to generate game inputs based on the participants' physical metrics, and provide the game inputs to the game system to affect game play. The module may also receive alerts or other information from the game system or from players, determine feedback for participants according to the received information, and signal the devices to provide feedback or alerts to the participants in the game. The devices may include indicators that are activated by the signals to provide visual, audio, and/or haptic indications to respective participants.
US11052313B2
Methods and systems for assigning a data center to service a request from a user account include receiving a login request to a cloud gaming server. The login request is examined to identify a user account. A use history of the cloud gaming server is examined to identify a data center. The user account is assigned to the data center to start a session of streaming game play at a server within the data center. The data center is identified without performing a connection testing operation.
US11052310B2
Various game controller hardware and user interface configurations are disclosed. Some configurations may comprise two circular trackpads, driven by the player's thumbs, which may be clickable, allowing the entire surface to act as a button. Haptic feedback may be based on dual linear resonant actuators (e.g., by means of strong, weighted electro-magnets attached to each of the dual trackpads), capable of delivering a wide range of force and vibration, allowing control over frequency, amplitude, and direction of movement. The haptics-related components in certain implementations may also play audio waveforms and thereby function as speakers. In the center of the controller according to certain configurations may be another touch-enabled surface, this one backed by a display screen. In some configurations this entire screen itself may also be clickable, like a large single button. A variety of other exemplary implementations and configurations are described.
US11052307B2
Embodiments of the present disclosure provide a method for controlling the movement of a virtual object performed by an electronic device. A first button is displayed at a first position of a screen. A second button is displayed at a second position of the screen when a first touch operation is detected. When a second touch operation on the second button is detected, a virtual object is controlled to move automatically, and the two buttons are highlighted. The automatic movement of the virtual object and the linkage between the two buttons are implemented through simple operations, thereby improving the convenience and flexibility of operations.
US11052304B2
A system that manages a package of shuffled playing cards and gaming chips includes a storage box and a control apparatus. The storage box is provided in association with a game table and stores a plurality of shuffled playing cards and a plurality of chip cases and also includes a card reader that reads playing card ID codes of the shuffled playing cards and a chip reader that reads case ID codes of the chip cases. The control apparatus outputs total numbers of the shuffled playing cards and the chip cases stored in the storage box and the playing card ID codes and case ID codes stored in the storage box by monitoring read playing card ID codes and case ID codes.
US11052299B2
A golf putter that enables dual configuration, namely sighting & play modes whereby the golfer can view both the ball and the hole by means of a mirrored surface, but which is reversible so that the golfer can play within tournament rules. A removable mirrored training aid has a reflective side and can be removed, flipped to a non-reflective side, or simply replaced with a same-weighted non-reflective plate, for use in actual (non-practice) golf play. The golfer can practice his or her stroke while observing the image of the ball and hole in the mirror, and thereby imprinting the correct stroke mechanics into muscle memory. Then, after the golfer has reversed the re-attachable mirrored surface plate to present its non-reflective side, the golfer can use the putter in a round of golf.
US11052296B2
A gymnasium or playing field game apparatus provides one or more movable target components in the shape of a mascot mounted on swivel casters which roll on the gym floor or other playing field. Each component serves as a movable target for projectiles thrown by two teams from geometrically opposite sides. Each mascot is moved incrementally upon being impacted by a projectile to move the mascot on the gym floor until it “breaks through” a designated goal finish line of traffic cones protecting one team or the other.
US11052288B1
A force measurement system is disclosed herein. The force measurement system includes a force measurement assembly configured to receive a subject thereon, and one or more data processing devices operatively coupled to the force measurement assembly. In one or more embodiments, the one or more data processing devices are operatively coupled to the force measurement assembly, the one or more data processing devices configured to receive one or more signals that are representative of forces and/or moments being applied to a top surface of the force measurement assembly by the subject, and to convert the one or more signals into output forces and/or moments, the one or more data processing devices further configured to predict one or more balance parameters of the subject using a trained neural network.
US11052284B2
The present invention relates to a method, system, and non-transitory computer-readable recording medium for supporting photographing of a golf swing. According to one aspect of the invention, there is provided a method for supporting photographing of a golf swing, the method comprising the steps of: (i) determining a user device matched with information on a user who is to perform a golf swing, among a plurality of user devices, with reference to a scenario associated with the golf swing; and (ii) causing a photographing module of the determined user device to photograph the golf swing of the user.
US11052278B2
A pipe exercise device designed to allow a user to transport a weight variable exercise device. The pipe exercise device includes an elongated member with an outer shell having a hollow interior designed to receive items therein. The elongated member has an open end disposed opposite a sealed end, wherein the open end is in communication with the hollow interior, such that a weight can be received therethrough to sit within the hollow interior. An end cap is designed to seal the open end, such that the weights therein are removably secured. At least one handle is disposed on the outer shell, such that the user can grasp the pipe exercise device. In this way, a user is able to transport a weight training device that can quickly and simply change the amount of weight used.
US11052272B2
A multiple position adjustable exercise device includes a first plate, a second plate and an elastic member. The second plate is pivotally connected with the first plate. The elastic member is disposed between the first plate and the second plate, and when the second plate rotates relative to the first plate, the elastic member is twisted for providing an elastic recovering force. An initial position of the second plate relative to the first plate is adjustable for adjusting the elastic recovering force.
US11052269B1
An improved protective face mask used to filter out hazardous pollution and airborne germs and viruses. Embodiments include a three layer version including a first spunbond TETHYS SHIELD treated layer, a meltblown filtration layer, and a second spunbond layer; a four layer version further including a gasket layer formed of a felt material; and a five layer version further including an activated carbon layer in between the spunbond TETHYS SHIELD treated layer and the meltblown filtration layer.
US11052266B2
Apparatus for measuring radiation beam energy output from a radiation beam source, comprising a first beam energy sensor at a first distance from the radiation beam source along the radiation beam axis; a second beam energy sensor located at a second distance from the radiation beam source along the radiation beam axis; and an energy absorbing layer, for example a layer that removes a part of the low energy content of the beam or a layer that absorbs at least 1% of the beam energy, located between the first and second sensors, and positioned such that radiation passing through the first sensor also passes through the energy absorbing layer before entering the second sensor.
US11052262B1
A method of affecting a biological, cellular or biochemical function or structure in a targeted subcortical location in a brain of a patient using a TRPMS apparatus placed on a head of the patient includes positioning two or more of a plurality of magnetic assemblies on locations of the head mount selected to stimulate the targeted subcortical location in the brain of the patient, and activating the plurality of magnetic assemblies at the selected locations to generate magnetic fluxes of a selected strength, frequency and duration directed into the brain of the patient, wherein the magnetic flux directed into the brain of the patient from each of the assemblies is operative to generate induced electric field in regions of the brain and the regions of induced electric fields generated by each of the plurality of magnetic assemblies converge in the targeted subcortical location and combine to a magnitude sufficient to affect the biological, cellular or biochemical function or structure in the targeted subcortical location.
US11052259B2
A connector assembly for an implantable device includes a feedthrough interface having a ceramic feedthrough and a ferrule attached to, and forming a perimeter around, the ceramic feedthrough; a lower contact housing coupled to the feedthrough interface, where the lower contact housing and ceramic feedthrough define wire holes extending therethrough; an upper contact housing attached to the lower contact housing and collectively defining contact receptacles, each of the contact receptacles defining an opening for at least one of the wire holes; connector contacts with each connector contact disposed in a one of the contact receptacles; and wires with each of the wires coupled to one of the connector contacts and extending through one of the wire holes so that the respective wire extends out of the ceramic feedthrough.
US11052256B2
An implantable medical device (IMD) includes a heterogeneous housing configured to receive and store one or more components of the IMD. The housing includes an intrinsically non-conductive and non-magnetic base material and at least one dopant with a property of at least one of electrical conductance and magnetic permeability. The base material and the dopant form a first region of the housing including a first skin depth and a second region of the housing including a second skin depth different than the first skin depth.
US11052255B2
Systems and methods for pacing cardiac conductive tissue are described. A medical system includes an electrostimulation circuit to generate His-bundle pacing (HBP) pulses. A sensing circuit senses a physiologic signal, and detect a local His-bundle activation discrete from a pacing artifact of the HBP pulse. A control circuit verifies capture status in response to the HBP pulses. Based on the capture status, the control circuit determines one or more pacing thresholds including a selective HBP threshold representing a threshold strength to capture only the His bundle but not the local myocardium, and a non-selective HBP threshold representing a threshold strength to capture both the His bundle and the local myocardium. The electrostimulation circuit may deliver HBP pulses based on the selective and non-selective HBP thresholds.
US11052252B1
Described is a system for weakening an undesirable memory. The system initiates application of a first pattern of spatiotemporally distributed transcranial stimulation via a set of electrodes to a subject who is in a calm mental state, causing association of the first pattern of spatiotemporally distributed transcranial stimulation with the calm mental state. The system then initiates application of the first pattern of spatiotemporally distributed transcranial stimulation via the set of electrodes when the undesirable memory is recalled by the subject, causing recall of the calm mental state and reconsolidation of the undesirable memory with the calm mental state.
US11052246B2
A method, system, and device for electroporation. A system may include a medical device with a plurality of electrodes borne on an expandable element and an energy generator in communication with the electrodes. The energy generator may have processing circuitry configured to selectively deliver electroporation energy to at least one of the electrodes. The processing circuitry may determine whether an alert condition is present and, if so, cease the delivery of electroporation energy to one or more electrodes identified as the cause of the alert condition and/or prevent the delivery of electroporation energy to the one or more electrodes identified as the cause of the alert condition. The energy generator may also be configured to deliver electroporation energy in a sequence of a plurality of energy delivery patterns to enhance lesion formation.
US11052243B2
A method of laparoscopically implanting an electrically stimulating lead proximate the lower esophageal sphincter (LES) of a patient includes delivering the lead through a port of a laparoscope inserted into the abdominal cavity of the patient through an incision in the abdominal wall. The stimulating electrode is implanted in or proximate the muscularis layer of the lower esophageal wall to treat esophageal reflux disease (GERD). The lead includes a needle and suture at its distal end for pulling the electrode into the muscular wall of the LES. Clips are applied to the suture attached to the distal end of the lead to prevent retrograde movement of the electrode. The lead also includes an anchoring member for anchoring the portion of the lead proximal to the electrode. The method and lead used with the method allow the surgeon to work within the confined anatomy present at the gastroesophageal junction and prevents backwards movement and dislodgment of the electrode. The implantation procedure can be combined with a hiatal hernia repair to repair the hernia and prevent recurrence of a hiatal hernia.
US11052240B2
A medical device for administering a medicament is disclosed that includes a reservoir for storing the medicament, a current driver electrically coupled to an electrode, and an oscillation driver electrically coupled to a vibrational element. The electrode forms multiple channels in fluid communication with the reservoir. A method of administering a medicament is also provided.
US11052239B2
A cannula for relieving the left side of the heart is provided, the cannula having a cannula shaft comprising a heart-side inlet and a pump-side outlet. A lumen extends between the inlet and the outlet, and a suture ring for connecting the cannula to a left atrium is arranged on an outer side of the cannula shaft. The outlet is configured such that the outlet can be connected to a pump and the length of the cannula shaft between the suture ring and the outlet is such that the cannula shaft can be guided outwards through an intercostal space.
US11052232B2
A needle assembly for a liquid applicator comprises housing with longitudinal channel. The channel comprises upper and lower open ends. A needle bundle is movably mounted in the channel, which comprises needle shaft and needles attached thereto. A biasing member is configured and mounted for (i) biasing the needle bundle longitudinally towards a retracted position and (ii) biasing the needles laterally towards a needle-guiding side wall of the housing adjacent the lower open end. The biasing member is configured and mounted to form a fluid seal between the lower and upper open ends. The biasing member comprises an elastic tubular section with opposite sides. The first side has a first rectified length. The second side has a second rectified length longer than the first rectified length so that the second side is less tensioned than the first side to bias the needles towards the needle-guiding side wall.
US11052226B2
Steerable medical devices and methods of use. In some embodiments, the steerable medical devices can be steered bi-directionally. In some embodiments the steerable medical devices include a first flexible tubular member and a second flexible tubular member secured together at a location distal to a steerable portion of the steerable medical device.
US11052225B2
There is provided an apparatus for use in a bodily lumen. The apparatus comprises a guidewire and a catheter. The guidewire has a proximal end portion and a distal end portion. The catheter has a proximal end portion and a distal end portion. The catheter includes a lumen for receiving the guidewire. The catheter is configured to be translated along the guidewire. The catheter is configured to be biased towards a translated position along the guidewire by a magnetic attraction between the guidewire and the catheter.
US11052220B2
The present disclosure pertains to a system configured to adjust a volume of auditory stimulation delivered to a subject during sleep. The system is configured to determine a deepening time indicative of a rate at which sleep of the subject deepens during the sleep session. The deepening time is determined based on (i) a ratio of power in a high frequency band of an EEG signal to power in a low frequency band, (ii) a density of slow waves, or (iii) a hypnogram, indicative of sleep depth in the subject during the sleep session. The system is configured to determine a rate of volume increase for auditory stimulation during a subsequent sleep session based on the deepening time; and control the one or more sensory stimulators to adjust the volume of auditory stimulation provided to the subject during the subsequent sleep session based on the determined rate of volume increase.
US11052219B2
A sensory activity sack provides a garment with pleasant tactile features offering safe sensory stimulation for persons with developmental or sensory disabilities and an isolation bag for the wearer's arms and hands. The isolation bag prevents the wearer from engaging in self-injurious behavior or other harmful behaviors. Multiple fabrics and textures in the isolation bag, including mesh and denim, provide a pleasing tactile experience, which can be furthered by the placement of toys into the isolation bag. Sensory panels made with a sturdy, textured material such as denim provide tactile stimulation and resistance against wear and biting, as well as adding a comforting weight to the sensory activity sack for wearers with sensory issues.
US11052215B2
A medical tube has a tube wall, a first end and a second end. At least one heater wire is wrapped around the wall. Near or at one of the first end or the second end, there is at least one recess in an outer surface of the wall. The heater wire passes over the at least one tube recess such that the wire does not contact the wall in the area of the tube recess. Also disclosed are methods of making the tube and components used in making the tube.
US11052202B2
Drug delivery devices that include a microphone and processing circuitry that can detect operating events, such as peak inspiratory flow (PIF) and Breath Actuated Mechanism (BAM) in dry powder inhalers can be used to improve clinical trials by providing information about the way in which the inhalers under test are being used.
US11052196B1
A method of providing and/or injecting octreotide acetate to a subject in need thereof includes storing the octreotide acetate in a cartridge of a multi-use multi-dose injector provided with a variable dose setter and actuator. The injector includes a needle configured for subcutaneous administration of the octreotide acetate, the octreotide acetate having a concentration of 2,500 μg/mL. The method further includes providing, on the injector, a plurality of indicia only at prescribed doses of 50 μg, 100 μg, 150 μg and 200 μg settable via the dose setter without indicia between said prescribed doses; and permitting setting of a dose of the octreotide acetate by rotation of the variable dose setter, wherein the injector is configured to provide at least one audible feedback during the rotation.
US11052190B2
Provided is a wearable, self-contained drug infusion or medical device capable of communicating with a host controller or other external devices via a personal area network (PAN). The medical device utilizes a PAN transceiver for communication with other devices in contact with a user's body, such as a physiological sensor or host controller, by propagating a current across the user's body via capacitive coupling. The wearable nature of the medical device and the low power requirements of the PAN communication system enable the medical device to utilize alternative energy harvesting techniques for powering the device. The medical device preferably utilizes thermal, kinetic and other energy harvesting techniques for capturing energy from the user and the environment during normal use of the medical device. A system power distribution unit is provided for managing the harvested energy and selectively supplying power to the medical device during system operation.
US11052187B2
A packaging for a reel of medical injection devices includes a base tray configured for supporting the reel and at least a first flat rib and a second flat rib. Each rib includes a respective slot arranged such that the ribs can be interlocked with one another by mutual engagement of the slots. The base tray includes at least two pairs of peripheral openings. Each opening is configured to receive an end of the ribs, so that the base tray and interlocked flat ribs engaging the base tray form a frame configured for enclosing the reel.
US11052184B2
A membrane separation device is disclosed along with systems and methods employing the device in blood processing procedures. In one embodiment, a spinning membrane separator is provided in which at least two zones or regions are created in the gap between the spinning membrane and the shell, such that mixing of the fluid between the two regions is inhibited by a radial rib or ridge associated with the spinning membrane that decreases the gap between the spinning membrane and the shell to define two fluid regions, the ridge isolating the fluid in the two regions to minimize mixing between the two. Automated systems and methods are disclosed for separating a unit of previously-collected whole blood into selected blood components, such as concentrated red cells and plasma, for collecting red cells and plasma directly from a donor in a single pass, and for cell washing. Data management systems and methods and priming methods are also disclosed.
US11052182B2
The present invention relates to a method for checking a dialyzer for the presence of a leak in the semipermeable membrane of the dialyzer, wherein the membrane divides the inner dialyzer space into a least one blood chamber and into at least one dialyzate chamber, wherein the blood chamber is flowed through by blood in the operation of the dialyzer and is in fluid communication with a blood-side line system and the vascular system of the patient, and wherein the dialyzate chamber is flowed through by dialysis fluid in the operation of the dialyzer and is in fluid communication with a dialyzate-side line system, wherein the method comprises the following steps: a) emptying the blood chamber or the dialyzate chamber of blood and of dialysis fluid respectively and keeping the fluid (blood or dialyzate) in the non-emptied dialyzate chamber or blood chamber; b) building up a test pressure by means of a gas, in particular by means of air, in the emptied blood chamber or in the emptied dialyzate chamber; and c) measuring the pressure drop over time in the emptied blood chamber or in the emptied dialyzate chamber or in the line system respectively in fluid communication therewith and/or measuring the pressure increase in the non-emptied blood chamber or in the non-emptied dialyzate chamber or in the line system respectively in fluid communication therewith or measuring the number of air bubbles or of a parameter correlated with the number of air bubbles in the non-emptied blood chamber or in the non-emptied dialyzate chamber or in a line system respectively in fluid communication therewith, wherein the steps a) to c) are carried out subsequent to the blood treatment of the patient and subsequent to the disconnection of the patient from the blood-side line system.
US11052181B2
A cassette integrated system. The cassette integrated system includes a mixing cassette, a balancing cassette, a middle cassette fluidly connected to the mixing cassette and the balancing cassette and at least one pod. The mixing cassette is fluidly connected to the middle cassette by at least one fluid line and the middle cassette is fluidly connected to the balancing cassette by at least one fluid line. The at least one pod is connected to at least two of the cassettes wherein the pod is located in an area between the cassettes.
US11052180B2
A system and method for balancing flows of renal replacement fluid is disclosed. The method uses pressure controls and pressure sensing devices to more precisely meter and balance the flow of fresh dialysate and spent dialysate. The balancing system may use one or two balancing devices, such as a balance tube, a tortuous path, or a balance chamber.
US11052173B2
The present disclosure relates to a biocompatible, electrically conductive polymer capable of carrying the electrical potential of a cardiac impulse. The present disclosure also relates to treatments using the electrically conductive polymer, such as for atrial fibrillation.
US11052168B2
An air germicidal treatment device and system for removing or eliminating unwanted pathogens or bacteria in an airstream is shown. The device or system has a removable irradiation chamber that divides an interior area of the device into an air pre-chamber area, an air post-chamber area and an irradiation area therebetween. The removable irradiation chamber is generally trapezoidal in shape and has end walls that are inclined with respect to an interior divider wall.
US11052163B2
The present disclosure provides peptide constructs for diagnostic imaging and therapeutic applications, using pegylated peptides which exhibit specific binding for a target molecule of interest, such as a biomarker of a disease or disorder.
US11052155B2
This invention relates to novel analogs of the DNA-alkylating agent CC-1065 and to their conjugates. Furthermore this invention concerns intermediates for the preparation of said agents and conjugates. The conjugates are designed to release their (multiple) payload after one or more activation steps and/or at a rate and time span controlled by the conjugate in order to selectively deliver and/or controllably release one or more of said DNA alkylating agents. The agents, conjugates, and intermediates can be used to treat an illness that is characterized by undesired (cell) proliferation. As an example, the agents and the conjugates of this invention may be used to treat a tumor.
US11052153B2
Compositions including a highly branched alpha-D-glucan or modified forms thereof and a solute compound are described herein. The compositions can provide increased water solubility and/or increased rate of dissolution for the solute compound. The compositions can also provide increased stability for the solute compound. Methods for preparing and using compositions including a solute compound and a highly branched alpha-D-glucan are also described.
US11052145B2
Disclosed are novel immunogenic proteins derived from Staphylococcus aureus, as well as methods for their use in conferring protective immunity against S. aureus infections. Also disclosed are nucleic acids encoding the proteins and methods of use of these nucleic acids.
US11052142B2
For the first time individual (free from impurities of penta- and hexa-acetylated derivatives) di-, tri- and tetra-acetylated S-LPS of endotoxic bacteria and combinations thereof were obtained and their immunobiological, physical-chemical and chemical-pharmaceutical properties were studied. For the first time the principal possibility of their clinical application was directly demonstrated as vaccines and pharmaceutical compositions containing the modified S-LPS individual as monocomponent or combinations thereof as two and three component active substance, respectively. The modified S-LPS and combinations thereof have high safety profile and provide low pyrogenicity and high immunogenicity. Developed on their basis vaccines and pharmaceutical compositions demonstrate anti-shock activity, high efficiency and specificity, broad-spectrum action and also good chemical-pharmaceutical parameters.
US11052141B1
Methods of mitigating the risk of rejection of an allograft or xenograft in an incompatible recipient by neutralizing one or more populations of circulating antibody cross-reactive with a carbohydrate antigen expressed by the allograft or xenograft. The method includes administering to the recipient by intravenous infusion a concentration of a synthetic antigen lipid construct sufficient to neutralize the one or more populations of circulating antibody in the recipient.
US11052137B2
The application relates to antimicrobial agents against Gram-negative bacteria, in particular to fusion proteins composed of an enzyme having the activity of degrading the cell wall of Gram-negative bacteria and a peptide stretch fused to the enzyme at the N- or C-terminus, as well as pharmaceutical compositions comprising the same. Moreover, it relates to nucleic acid molecules encoding such a fusion protein, vectors comprising said nucleic acid molecules and host cells comprising either said nucleic acid molecules or said vectors. In addition, it relates to such a fusion protein for use as a medicament, in particular for the treatment or prevention of Gram-negative bacterial infections, as diagnostic means or as cosmetic substance. The application also relates to the treatment or prevention of Gram-negative bacterial contamination of foodstuff, of food processing equipment, of food processing plants, of surfaces coming into contact with foodstuff, of medical devices, of surfaces in hospitals and surgeries.
US11052131B2
Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.
US11052129B2
The present invention relates to methods of treating or preventing a complement-mediated disease and/or disorder in a subject with a complement C5 polymorphism, including administering to a subject in need thereof a therapeutically or prophylactically effective amount of an agent that a) inhibits the classical complement pathway, the alternative complement pathway and the lectin complement pathway; and/or b) inhibits eicosanoid activity. The invention also relates to methods of identifying patient populations with C5 polymorphisms that are treatable with specific agents that a) inhibit the classical complement pathway, the alternative complement pathway and the lectin complement pathway; and/or b) inhibit eicosanoid activity.
US11052125B2
The present invention discloses a composition comprising extracts of Cyperus rotundus, standardized to contain 3-5% w/w total stilbenes, extracts of Garcinia sp., standardized to contain 20% w/w garcinol and extracts of Coleus forskohlii standardized to contain not less than 10% w/w forskolin for the therapeutic management of diet induced obesity and weight gain and related conditions like liver dysfunction, NASH, NAFLD, liver cirrhosis, hypercholesterolemia, hyperlipidemia, kidney dysfunction by bringing about a reduction in body weight, increasing lean body mass and by normalizing the levels of liver enzymes, kidney markers and circulating lipids.
US11052119B2
The present invention relates to a cell-based composition comprising a suspension of mesenchymal stem cells in crystalloid with a cellular concentration from 0.01 million to 3.0 million cells/ml. The cell-based composition is used in a form of medicament for treatment of diabetes and its associated metabolic disorders and complications.
US11052118B2
The invention provides improved methods for cell therapy. In particular, the invention provides therapeutic compositions of enhanced hematopoietic stem and progenitor cells having improved engraftment and homing properties, and methods of making the therapeutic compositions. The invention further provides methods of improving the efficacy of hematopoietic stem and progenitor cell transplantation including transplanting the therapeutic composition to subjects in need of hematopoietic system reconstitution.
US11052114B2
The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules.
US11052102B2
The present invention provides novel compounds that target thrombocyte activity or aggregation capacity through cellular components for the treatment of diseases associated with Non-Alcoholic Fatty Liver Disease (NAFLD). The invention provides these compounds for treating non-alcoholic steatohepatitis (NASH), a progressed stage of NAFL (non-alcoholic fatty liver), in order to avoid the development of liver cirrhosis and Hepatocellular Carcinoma (HCC). Further provided are pharmaceutical compositions, comprising the compounds of the invention, and methods for screening new NASH therapeuticals.
US11052100B2
A nicotinamide riboside composition and preparation method thereof, the icotinamide riboside composition comprises nicotinamide riboside and/or a salt thereof and konjac glucomannan or rebaudioside A. The nicotinamide riboside composition provided by the present invention, used to increase the concentration of NAD in cells, thereby preventing and improving various unhealthy conditions caused by NAD deficiency. is stable in property and easy to store and transport.
US11052094B2
Provided herein is an ophthalmic composition formulated in deuterated water. Also disclosed herein are methods of treating, ameliorating, or reducing ophthalmic conditions or diseases by administering to an eye of an individual in need thereof an effective amount of an ophthalmic composition as described herein.
US11052092B2
The present invention provides e.g. N-{[2-(piperidin-1-yl)phenyl](phenyl)methyl}-2-(3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)acetamide derivatives and related compounds as ROR-gamma modulators for treating e.g. autoimmune diseases, autoimmune-related diseases, inflammatory diseases, metabolic diseases, fibrotic diseases or cholestatic diseases, such as e.g. arthitis and asthma.
US11052089B2
In alternative embodiments, provided are compositions and methods for treating, enhancing the drug sensitivity of, and preventing the formation of cancer stems cells, including preventing or slowing the development or generation of a beta-3 (β3)-expressing, or integrin β3 (ITG-B3)-expressing cancer or tumor cells. In alternative embodiments, provided are methods using histone acetyl transferase inhibitors and/or histone methyl transferase inhibitors to determine therapeutic values in cancer cells that induce an integrin β3 (ITGB3) polypeptide expression. In alternative embodiments, provided are kits, blister packages, lidded blisters or a blister card or packet, clamshells, trays or shrink wraps, comprising at least one compound, composition or formulation used to practice a method as provided herein, and at least one Growth Factor Inhibitor.
US11052081B2
The present invention relates to therapeutic ADCs comprising SN-38 attached to an anti-Trop-2 antibody or antigen-binding antibody fragment. The ADC may be administered at a dosage of between 4 mg/kg and 18 mg/kg, preferably 4, 6, 8, 9, 10, 12, 16 or 18 mg/kg, most preferably 8 to 10 mg/kg. When administered at specified dosages and schedules, the ADC can reduce solid tumors in size, reduce or eliminate metastases and is effective to treat cancers resistant to standard therapies, such as radiation therapy, chemotherapy or immunotherapy. Preferably, the ADC is administered in combination with one or more other therapeutic agents, such as a PARP inhibitor, a microtubule inhibitor, a Bruton kinase inhibitor or a PI3K inhibitor. Most preferably, the ADC is of use for treating a Trop-2 expressing cancer, such as metastatic urothelial cancer.
US11052080B2
The present invention provides compounds of formula I, pharmaceutically acceptable salts thereof, and pharmaceutical compositions thereof. Compounds of the present invention are useful for inhibiting kinase (e.g., GSK3 (e.g., GSK3α or GSK3β) or CK1) activity. The present invention further provides methods of using the compounds described herein for treating kinase-mediated disorders, such as neurological diseases, psychiatric disorders, metabolic disorders, and cancer.
US11052078B2
Provided herein are compounds, derivatives thereof, composition comprising one or more of said compounds and derivatives, and methods for prevention and/or treatment of microbial infections and/or related diseases or conditions. The present compounds and/or derivatives thereof can be represented by Formula (II): The present methods include administering to a subject an effective amount of one or more compounds of Formula (II). In one embodiment, said microbial infections are bacterial infections. More specifically, said bacterial infections are staphylococcal infections.
US11052068B2
Pharmaceutical compositions and kits including a tyrosine hydroxylase inhibitor; melanin, a melanin promoter, or a combination thereof a p450 3A4 promoter; and a leucine aminopeptidase inhibitor are provided. Also provided are methods of treating cancer in a subject, comprising administering an effective amount of a tyrosine hydroxylase inhibitor, a melanin promoter, a p450 3A4 promoter, and a leucine aminopeptidase inhibitor to the subject in need thereof. Also provided are methods of reducing cell proliferation in a subject comprising administering an effective amount of a tyrosine hydroxylase inhibitor, a melanin promoter, a p450 3A4 promoter, and a leucine aminopeptidase inhibitor to the subject in need thereof.
US11052053B2
A nanoparticle includes a core. The core includes a bio-resorbable polyester and a hydrophilic polymer. The hydrophilic polymer is a portion of the bio-resorbable polyester or a separate polymer. An acylated human lactoferrin-derived peptide is coated onto the core. The acylated human lactoferrin-derived peptide is a peptide with the amino acid sequence SEQ ID NO. 1: KCFQWQRNMRKVRGPPVSCIKR or an amino acid sequence, which does not differ by more than 8 amino acid positions from the sequence SEQ ID NO: 1. The N-terminus of the human lactoferrin-derived peptide is acylated with a C16-monoacyl group.
US11052039B2
Provided is a cosmetic composition for skin moisturization containing a hydrolyzate extract obtained by adding a protease to the fruit of Cicer arietinum, a Rhododendron chrysanthum leaf extract and a Tricholoma matsutake extract. The cosmetic composition exhibits excellent effects on cell moisturization, intercellular moisturization and skin-barrier moisturization. In addition, the cosmetic composition is harmless to the human body and has excellent stability because it uses natural substances.
US11052038B2
Disclosed are a green environmental facial cleansing tissue with a natural plant origin and its preparation method, particularly a green facial cleansing tissue with a makeup removal function and a natural plant origin formula and its preparation method. The formula of the facial cleansing tissue consists of natural plants, honey extracts, etc., and the facial cleansing tissue is capable of avoiding skin irritation, providing a convenient and safe use, and the facial cleansing tissue is naturally decomposable and environmentally friendly.
US11052035B2
Method for treating hair comprising the successive application onto hair of polymeric layers which can be removed to a large extent or even totally in an easy manner upon request of the user by using a composition having a pH less than 7.
US11052032B2
Compositions and methods for amelioration of skin laxity and body contour are provided. Provided herein are compositions comprising a combination of peptides.
US11052031B2
An aqueous cleansing composition comprising a cationic surfactant, a nonionic surfactant, and a thickener comprising an alkoxylated methyl glucose ether, wherein a weight ratio of cationic surfactant to nonionic surfactant is greater than 0.9:1. The combination of the cationionic:nonionic surfactant ratio with the alkoxylated methyl glucose ether thickener provides the composition with cold weather stability. Cold weather stability is observed when the composition remains transparent after cold storage.
US11052030B2
A method of preparing a fine oil-in-water emulsion comprising an oil phase based on silicone and/or hydrocarbon oils, in which the oil phase particles have an average particle size of 150 nm or less. The emulsion is stabilized by a carboxy-modified silicone in combination with a C16 to 22 higher alcohol; a nonionic surfactant having a POE chain and an HLB of 5 to 10; and a dihydric glycol. The emulsions can be prepared without the use of a high-pressure emulsifying apparatus.
US11052011B2
A standing-up assistance apparatus includes a first sensor that measures a muscle potential of a lower leg of a user, a second sensor that measures a knee angle of the user, a processor that determines whether starting to assist the user in a standing-up motion from a seated state is possible, based on, at least, the measured muscle potential and the measured knee angle, and outputs an instruction signal if the processor determines that starting to assist the user in the standing-up motion is possible, and an assistance mechanism. The assistance mechanism starts assisting the user in the standing-up motion when the assistance mechanism receives the instruction signal from the processor.
US11052001B2
A mobile chair apparatus is described that comprises a drive assembly that preferably includes one or more moveable foot pedals, and drive wheels which rotate in response to rotation of the foot pedals by the mobile chair occupant, and a steering assembly which comprises two steering wheels and at least one tiller, configured such that forward and backward movement of said tiller will translate into movement of both steering wheels, wherein the drive assembly and the steering assembly concurrently enable the mobile chair occupant to propel and steer the mobile chair apparatus without assistance from another person.
US11051999B2
Patient support apparatuses, such as beds, cots, stretchers, recliners, or the like, include control systems with one or more image, radar, and/or laser sensors to detect objects and determine if a likelihood of collision exists. If so, the control system controls the speed and steering of the patient support apparatus in order to reduce the likelihood of collision. The control system may be adapted to autonomously drive the patient support apparatus, to transmit a message to a remote device indicating whether it is occupied by a patient or not, and/or to transmit its route to the remote device. The remote device may determine an estimate of a time of arrival of the patient support apparatus at a particular destination and/or determine a distance of the patient support apparatus from the particular destination.
US11051998B2
A reconfigurable portable load bearing structure which can be configured into an extended load bearing configuration or a collapsed configuration, comprising of a first, second and third plurality of rail segments that are each rotatably coupled together and a plurality of support segments or pads which are configured to selectively couple and latch into one of a plurality of positions on said first, second and third plurality of rail segments.
US11051997B2
A disposable pant-type absorbent article, such as a pant diaper, a sanitary pant or incontinence pant is described. The disposable pant-type absorbent article has a longitudinal direction (Y) and a transverse direction (X). The disposable pant-type absorbent article is adapted for a male user. A method for manufacturing such a disposable pant-type absorbent article is also described.
US11051984B2
A ventilation unit and controller device comprises a ventilation unit with a housing. The housing has an intake port permitting flow of gas into the housing and an exhaust port permitting flow of gas out of the housing. Within the housing, a motorized fan is positioned to direct gas into the housing via the intake port and out of the housing via the exhaust port. A controller capable of controlling the ventilation unit communicates with a sensor capable of detecting an environmental stimulus. A source of electric current provides power to the ventilation unit and controller device. The device further comprises a switch capable of interrupting the electric current that powers the device. The device is capable of being removably attached via fasteners to an arc flash hood, and the arc flash hood comprises a ventilation opening to permit gas discharged by the device to enter the arc flash hood.
US11051982B2
A plug for occluding an ocular canaliculus comprises a cylindrical body member having a first outer diameter. The cylindrical body member is provided along an external surface with at least one outwardly extending projection having a second outer diameter greater than the first outer diameter and larger than an inner diameter of an ocular canaliculus. The first outer diameter of the plug is typically less than and approximately equal to the inner diameter of the canaliculus.
US11051981B2
Devices, systems, and methods for performing an ophthalmic procedure in an eye are disclosed. The devices include a hand-held portion and a distal, elongate member coupled to the hand-held portion having a lumen operatively coupled to a vacuum source. A drive mechanism operatively coupled to the elongate member is configured to oscillate the elongate member. When in use, the device is configured to aspirate ocular material from the eye through the lumen. The drive mechanism retracts the elongate member with a retraction speed profile and advances the elongate member with an extension speed profile. The retraction speed profile is different from the extension speed profile.
US11051977B2
An eye treatment apparatus is described. The apparatus includes an annular body that has a hollow optical zone in its center. An inner perimeter of the annular body surrounds the optical zone. The inner perimeter has a diameter that corresponds to a diameter of the eye's cornea. An outer perimeter of the annular body has a diameter such that the annular body can extend to underneath the eye lid in an open eye position when the eye treatment apparatus is in operation. In this way, the apparatus can be worn on the eye, where the hollow optical zone substantially corresponds to the cornea and does not interfere with the field of vision. The annular body also includes a storage chamber that stores therapeutic liquid for an eye. An outlet is coupled with the storage chamber such that, in operation, the therapeutic liquid can be dispensed to the eye.
US11051970B2
A single use device for capturing fecal matter excreted from the anus of a user. The device includes a flexible fecal matter container having a closed end and an opening that is in fluid communication with a volume enclosed by the flexible container. An adhesive is disposed about the opening of the flexible container and has a first side that is secured to the flexible container. A second side of the adhesive is constructed to be removably applied to the epidermis of the user proximate an anal opening of the user. The adhesive is shaped to cooperate with the epidermis to circumscribe the anus in a sealed manner without interfering or overlapping anatomy associated with urinary function or medical devices, such as a catheter, associated therewith.
US11051969B2
An adaptable ostomy base plate comprising a flexible top film, having a first section and a second section, and having at least a first elastic skin-friendly adhesive on a proximal surface of said flexible top film, a stoma-receiving through-going hole defining an inner boundary in said first section, said first section being adjacent to and extending radially from said through-going hole and said second section surrounding said first section defining an outer boundary of the base plate, and one or more release liners, the base plate has a substantially convex shape for initial engagement with a peristomal skin surface and can be inverted to a substantially concave shape to fittingly engage to a topography of the peristomal skin surface and the second section of the base plate is in the form of a plurality of petals extending away from the central area; and a plurality of bridges, each bridge formed between adjacent petals of the plurality of petals.
US11051964B1
A posture supportive garment for supporting for a user's chest, back, and shoulders, while simultaneously reinforcing body alignment in the thoracic region to improve posture may include a bra structure having right and left cups sized to accommodate a user's breasts; a support base sized to encircle a user's torso, the support base attached to a bottom portion of the right and left cups; and right and left shoulder straps ultimately attached to the right and left cups, respectively, and the support base, wherein each of the right and left cups includes a compression sling; each of the right and left shoulder straps includes a lined compression panel; and the support base is made of a compression material.
US11051960B2
There is disclosed a control system for controlling the inflation of a balloon in a balloon stent catheter arrangement including (i) a transducer adapted to receive a source of intracoronary arterial pressure in a patient's coronary artery and to provide arterial pressure waveform data indicative of the status of a patient's cardiac cycle based upon the intracoronary arterial pressure, (ii) a processing system adapted to process the arterial pressure waveform data, and (iii) an inflation pump adapted to inflate the balloon. The processing system is adapted to cause the inflation pump to inflate the balloon in diastole, corresponding to about 55% to about 85% of a single R-R interval of the cardiac cycle, by an amount sufficient to achieve fixation of the stent at a target site in the coronary artery.
US11051957B2
Systems, devices and methods for control of a prosthetic or orthotic device (POD) based on electromyography (EMG) signals are described. The POD may be a lower or upper limb POD having one or more joints. One or more EMG sensors may detect the EMG signals. The EMG sensors may be external, subcutaneous, intraperitoneal, epimysial, intramuscular, or other types. Control of the POD may be based on EMG and non-EMG signals, such as velocity, acceleration, position, force, etc. Voluntary and/or automatic control may be implemented, for example with voluntary muscle contractions and/or data based on velocity, acceleration, position, force, etc. In some embodiments, the neutral position of an ankle POD is adjusted based on EMG signals.
US11051956B2
A prosthesis cosmetic element for a prosthesis comprising a prosthesis joint which has an upper part and a lower part that is mounted thereon in a pivotal manner about a pivot axis, the prosthesis cosmetic element has a first frame part, which has at least one first securing device for fixing on the lower part, and a second frame part with at least one second securing device for securing on the upper part. The frame parts are mounted in a pivotal manner relative to each other, and the prosthesis joint is equipped with a rotational element on which an actuating element is arranged. The actuating element is accessible from the outside by a frame part or through a frame part.
US11051954B2
An expandable support device for tissue repair is disclosed. The device can be used to repair hard or soft tissue, such as bone or vertebral discs. A method of repairing tissue is also disclosed. The device and method can be used to treat compression fractures. The compression fractures can be in the spine. The device can be deployed by compressing the device longitudinally resulting in radial expansion.
US11051951B2
An expandable inter-body fusion device is presented. The expandable inter-body fusion device can have a first plate, a second plate, and an insert positioned substantially therebetween the first plate and the second plate. The first plate, the second plate, and the insert define an interior cavity. Moving the insert longitudinally with respect to the first and second plates increases or decreases the distance of the first plate with respect to the second plate, effectively expanding the inter-body fusion device and increasing the volume of the interior cavity.
US11051949B2
An expandable intervertebral implant having an upper body portion, a lower body portion opposite the upper body portion, a wedge member connecting the upper body portion to the lower body portion, a nose member having a tapered distal end and a proximal end opposite the distal end, and an actuator disposed between the nose member and the wedge member, for translation of the wedge member along a longitudinal axis of the implant. A pin disposed in a center of the nose member connects to the actuator for centering the nose member with the actuator. Translation of the wedge member along the longitudinal axis of the implant displaces the upper body portion and the lower body portion away from each other, thereby expanding the intervertebral implant.
US11051948B2
Methods and systems are provided for a hinge knee system. A hinge knee system may comprise a femoral component; an insert; a tibial tray configured to be coupled to the insert; a tibial bushing configured to be disposed between the tibial tray and the insert; a poly locking screw configured to secure the tibial tray to the insert; a hinge box configured to be disposed between the femoral component and the insert; one or more cross-pin bushings configured to be disposed within the hinge box; a cross-pin configured to secure the hinge box to the femoral component; a hinge post configured to couple the hinge box to the tibial tray; and a hinge post set screw configured to secure the hinge box to the hinge post.
US11051932B2
An implant delivery system for delivering a sheet-like implant is disclosed. The implant delivery system includes a distal guidewire port for receiving the proximal end of guidewire after the guidewire distal end has been affixed to a first point on bone or other tissue. The implant delivery system is tracked over the guidewire to a selected position defined by the guidewire attachment. The device includes an implant spreader assembly disposed proximate the distal end of a delivery shaft. The implant spreader assembly includes a first arm and a second arm. The arms are coupled to the delivery shaft such that the first arm and second arm are moveable between a closed position and an open position. When pivoting to the open position the distal end of each arm travels in a generally transverse direction to spread a sheet-like implant.
US11051931B2
A method is provided for rerouting flow through the small intestine of a patient with an implanted artificial sphincter that encircles a portion of the small intestine. The small intestine includes a duodenum, a jejunum extending from the duodenum, and an ileum extending from the jejunum. The method includes providing the artificial sphincter in an open state to thereby permit intestinal flow through the encircled portion of the small intestine such that the intestinal flow passes through the duodenum, the jejunum, and the ileum. The method further includes, in response to a user-activated electrical input, transitioning the artificial sphincter to a closed state to constrict the encircled portion of the small intestine and thereby redirect intestinal flow from a first portion of the small intestine to a second portion of the small intestine such that the intestinal flow bypasses at least a portion of the jejunum.
US11051908B1
The present disclosure relates to a patient anxiety management system for managing patient anxiety during a dental procedure. In one example, a patient anxiety management system is presented. The patient anxiety management system includes a control module that a patient can use to disactivate a medical device used by a dental professional by way of a trigger mechanism. Upon deactivating the medical device, a recording device, in communication with the control module, plays a recorded message to the patient during a programmable timeframe. Once the patient is calm, the system resets the medical device to an initial operation state by reconnecting but not reactivating the medical device so that the dental professional may resume the procedure when it is safe to proceed.
US11051906B2
An ergonomic body positioning system for supporting and positioning a user such that the user can maintain a neutral body position while providing improved access and visibility to a worksite. The body positioning system includes a base, a support arm, a stem mounted to the support arm, and at least one body support device.
US11051900B2
Embodiments herein describe tools and instruments for holding, transferring, delivering, deploying an implantable device and methods and means of aseptically storing and shipping the implantable device including but not limited to a device case for protecting, housing and filling the device, a surgical sizer for preparing the implantable site, a deployer for transferring the implantable device from the device case and delivering or deploying the implantable device at the prepared implantable site.
US11051895B2
The embodiments disclosed herein relate to various medical device components, including components that can be incorporated into robotic and/or in vivo medical devices. Certain embodiments include various modular medical devices for in vivo medical procedures.
US11051884B2
Described herein are apparatus and associated methods for the generation of at least one user adjustable, accurate, real-time, virtual surgical reference indicium. A method includes recording an image of an eye and producing a real-time multidimensional visualization using the recorded image. The method also includes determining at least one distinct visible feature within a patient specific pre-operative still image and producing the real-time, virtual surgical reference indicium in conjunction with the patient specific pre-operative still image. The method further includes aligning the real-time, virtual surgical reference indicium with the real-time, multidimensional visualization of the eye using the at least one distinct visible feature.
US11051882B2
A sub-microsecond pulsed electric field generator is disclosed. The field generator includes a controller, which generates a power supply control signal and generates a pulse generator control signal, and a power supply, which receives the power supply control signal and generates one or more power voltages based on the received power supply control signal. The field generator also includes a pulse generator which receives the power voltages and the pulse generator control signal, and generates one or more pulses based on the power voltages and based on the pulse generator control signal. In some embodiments, the controller receives feedback signals representing a value of a characteristic of or a result of the pulses and generates at least one of the power supply control signal and the pulse generator control signal based on the received feedback signals.
US11051873B2
Various forms are directed to systems and methods for dissection and coagulation of tissue. A method for detecting a short circuit in a surgical system configured to apply radio frequency energy and ultrasonic energy to a target surgical site that includes delivering radio frequency (RF) energy to an electrode of a surgical instrument, transitioning from delivering the RF energy to delivering ultrasonic energy to an ultrasonic blade of the surgical instrument, delivering an exploratory ultrasonic pulse to the ultrasonic blade, measuring an ultrasonic property of tissue engaged by the surgical instrument, wherein the ultrasonic property is associated with the exploratory ultrasonic pulse, determining whether the measured ultrasonic property is consistent with a behavior of low impedance tissue, and delivering ultrasonic energy to the ultrasonic blade to cut the tissue upon determining that the measured ultrasonic property is consistent with ultrasonic energy being applied to low impedance tissue.
US11051870B2
A device for compressing a renal artery prior to delivery of radiofrequency ablative energy to the renal nerves. The device includes a stent structure with a focal region that expands outwards to place the RF electrodes located on the stent structure in close proximity to the renal nerves. A covering is applied to the stent structure to prevent intimal hyperplasia.
US11051866B2
A surgical instrument includes an ultrasonic transducer, a shaft extending distally along a shaft axis, a waveguide acoustically coupled with the ultrasonic transducer and extending distally through the shaft, and an end effector at a distal end of the shaft. The end effector includes an ultrasonic blade acoustically coupled with the waveguide. A nodal support element is arranged within a distal portion of the shaft and encircles the waveguide at a distal-most acoustic node of the waveguide. The nodal support element includes a support portion aligned with the distal-most acoustic node, and a sealing portion extending axially from the support portion. The support portion engages an inner surface of the shaft and is configured to support the waveguide in coaxial alignment with the shaft axis. The sealing portion sealingly engages the inner surface of the shaft and is configured to prevent proximal ingress of fluid through the shaft.
US11051860B2
A system for securing a flexible member to a vertebra includes a flexible member, a fixation member, and an inserter. The flexible member includes two ends. The fixation member includes a head and a shank that defines a longitudinal axis of the fixation member. The head defines a slot that passes through the head orthogonal to the longitudinal axis. The slot receives a portion of the flexible member. The inserter includes a handle and a tubular member that has proximal and distal end portion. The proximal end portion is attached to the handle and the distal end portion extends from the handle. The tubular member defines a passage between the proximal and distal end portions. The distal end portion includes a couple for receiving the head of the fixation member with the portion of the flexible member received in the slot of the flexible member.
US11051858B2
Surgical instruments to properly implant interspinous/interlaminar stabilization devices, and instrumentation kits containing these instruments are provided. These surgical instruments may be configured to be disposable, or for single patient use, and therefore do not require resterilization for reuse, thus reducing risk of infection as a result of reuse and logistical costs associated with these resterilization procedures.
US11051852B2
A connection device attached to one structure includes structures having adjacent slots that are alligned to receive and permit placement of an elongated member, and are subsequently relatively movable to retain the elongated member to restrict or occlude the adjacent slot opening restricting removal, and further provides a sheer force between the structures each having the slot to receive the elongated member, to engage and secure the outer surface of a tubular member received into an aperture common through 2 adjacent members, each member aperture having an axis parallel to and offset from the other, wherein rotation of one of the 2 members causes the surface of the offset aperture and the surface of the non-offset aperture to apply a shear force and/or friction to engage and retain the tubular member. Access to the aperture is provided by slot extending from the aperture to the member periphery.
US11051847B2
A lead delivery system having a base for securing a lead delivery device to one or more anatomical structures of a patient and a lead advancer configured to incrementally advance a lead into a patient by a predefined amount.
US11051836B2
A surgical clip applier comprising a rotatable clip cartridge is disclosed. The surgical clip applier comprises a lockout that at least locks out the crimping drive of the surgical clip applier when the rotatable clip cartridge is empty.
US11051833B2
The devices and methods described herein relate to improved structures for removing obstructions from body lumens. Such devices have applicability in through-out the ho including clearing of blockages within the vasculature, by addressing the frictional resistance on the obstruction prior to attempting to translate and/or mobilize the obstruction within the body lumen.
US11051828B2
A rotation knob assembly for a surgical instrument includes an outer knob, an intermediate collar, an inner sleeve, a retaining clip, and screws. The outer knob defines a knob lumen extending longitudinally therethrough and longitudinal apertures disposed in radially spaced relation relative to a distal lumen portion of the knob lumen. The intermediate collar is disposed within the knob lumen and defines a collar lumen extending longitudinally therethrough. The inner sleeve is disposed within the knob lumen and extends through the collar lumen. The retaining clip includes a curved body disposed within an annular groove defined in an exterior surface the inner sleeve and prongs disposed at opposed ends of the curved body that are aligned with the longitudinal apertures of the outer knob. The screws extend through the prongs and into the longitudinal apertures to secure the outer knob and the inner sleeve with one another.
US11051824B2
Concepts related to embolic delivery, including embolic detachment systems and an embolic pusher retention mechanism/system are discussed.
US11051816B2
Incision and closure surgical device containing a guide for cutting instruments and a sutureless wound closure mechanism. A stick-to-skin tape has a central slit whose edges are reinforced by two strips that delimit a central incision groove. A removable central partition maintains a constant separation between the elastomeric strips before making the incision. A series of transverse conduits pass through the elastomeric strips and serve for drainage of the wound and for coupling the closing mechanism of the device. At the conclusion of the surgery, a removable pressure or magnetic closure comprises two bilateral flexible strips that are hooked together to approximate the elastomeric strips while facing the edges of the underlying wound. A complementary removable adapter element for laparoscopic surgery serves as a support for a trocar and as a gas containment valve. Another complementary removable adapter element serves as an ogive-shaped cutting guide for cutaneous excisional surgery.
US11051806B2
A buttress is applied to an end effector of a surgical stapler. The buttress is loaded on a platform of a buttress applier cartridge. The end effector is closed upon the platform. An adhesive layer of the buttress secures the buttress to the end effector. The buttress is thus adhered to the end effector when the end effector is opened. The end effector is then actuated on tissue of a patient, thereby stapling the buttress to the tissue.
US11051803B2
Suture/needle constructs are disclosed in which either a first round or flat section of suture can be crimped on a needle. If the first section is round, then a transition to flat second section is formed by a braiding machine. After a short space of flat, the braiding machine weaves a bifurcation into the second section, forming third and fourth suture sections. The third and fourth suture sections transition back together again into a woven fifth section at a distance from the needle, which forms a suture loop. This looped section of the suture can then be used for whipstitching a tendon or a ligament graft.
US11051792B2
To include a rotating holder 30 that is rotatably arranged in an opening of a casing 10 and detachably holds a part of a sperm sampler, a motor 50 that rotates and drives the rotating holder, a control unit 60, a battery 70, a single switch 20, 67, and an angular speed sensor 61 that detects an angular speed of the casing 10, where the control unit changes a rotation direction and a rotation speed of the motor according to a change in a turning angle of the casing 10.
US11051789B2
The present invention aims at providing an ultrasound image diagnostic apparatus capable of shortening the time required for measurement and calculation of an optimal sound velocity and obtaining an ultrasound image having excellent image quality at a tissue or lesion the operator desires to observe. There are provided an element data memory storing element data; a region-of-interest setter setting a region of interest; an optimal sound velocity calculator calculating an optimal sound velocity at the region of interest using the element data corresponding to the region of interest; a reconstruction region setter setting a reconstruction region that contains the region of interest and is larger than the region of interest; and an image reconstructor generating a reconstructed image by reconstructing the ultrasound image in the reconstruction region based on the optimal sound velocity.
US11051785B2
A heartbeat detection device includes a bone conduction microphone that converts, into a signal, displacement on the body surface of a user in a thickness direction of the body of the user, and an extractor that extracts a first frequency component and a second frequency component which are included in the signal. The first frequency component is based on audio information of the user, and the second frequency component is based on heartbeat information of the user. The heartbeat detection device is capable of estimating the physical and psychological state of the user based on the heartbeat information by extracting both the audio information and the heartbeat information, from a signal that has been output by the bone conduction microphone.
US11051781B2
In one embodiment, A medical diagnostic imaging apparatus includes: a scanner that images a first site of an object and generates medical image data, wherein the scanner acquires biological information from a sensor that detects the biological information at a second site of the object that is different to the first site, and images the first site based on the biological information that changes according to a movement at the second site of the object.
US11051774B2
The invention relates to a computed tomography radiological apparatus including: an X-ray source (22) capable of emitting an X-ray beam longitudinally towards an object, a device (32) for simultaneously splitting the beam into a plurality of beam portions each having a defined propagation direction relative to the longitudinal direction of emission of said X-ray beam, several sensors (20a-c) intended to receive beam portions which irradiated the object and are arranged transversely side by side relative to the longitudinal direction of the beam, the assembly consisting of X-ray source-splitting device-sensors being capable of turning about an axis of rotation (24) and of adopting different geometric orientations that are angularly shifted with respect to one another in order to, on the one hand, irradiate the object along each one of said geometric orientations of said assembly with the plurality of X-ray beam portions, and, on the other hand, to receive along each one of these geometric orientations the plurality of X-ray beam portions that irradiated the object, the geometric orientation of said assembly being defined by the position of a geometric axis (34) passing, on the one hand, through the focal point of the X-ray source, and, on the other hand, through the axis of rotation (24), the geometric axis (34) having been shifted transversely relative to the center of the plurality of sensors (20a-c).
US11051771B2
Intraoral three-dimensional (3D) tomosynthesis imaging systems, methods, and non-transitory computer readable media are used to generate one or more two-dimensional (2D) x-ray projection images and to reconstruct, using a computing platform, the one or more 2D x-ray projection images into one or more 3D images of an object, such as teeth of a patient, which can then be displayed on a monitor in order to enhance diagnostic accuracy of dental disease. The intraoral 3D tomosynthesis imaging system can include a wall-mountable control unit connected to one end of an articulating arm, the other end of which is connected to an x-ray source, which is configured to generate x-ray radiation that is acquired by an x-ray detector held at a desired position by an x-ray detector holder that is removably coupled to a collimator at an emission region of the x-ray source.
US11051769B2
High definition, color images, animations, and videos for diagnostic and personal imaging applications are described along with methods, devices and systems for creating the images, as well as applications for using the images, animations and videos.
US11051766B2
The present disclosure pertains to a system for facilitating configuration modifications for a patient interface computer system based on an equivalent effort parameter. In some embodiments, the system obtains (i) one or more first measurements associated with a first subject, the first subject having a clinical coefficient, (ii) one or more second measurements associated with a second subject. The system determines (i) a first effort parameter based on the one or more first measurements, (ii) a second effort parameter based on the one or more second measurements, and (iii) an equivalent effort factor for the first subject based on the one or more first measurements, the one or more second measurements, and the clinical coefficient. The system causes a configuration of the patient interface computer system to be modified based on the equivalent effort factor.
US11051759B2
A system and method for monitoring respiration of a user, comprising: a respiration sensing module including a sensor configured to detect a set of respiration signals of the user based upon movement resulting from the user's respiration; a supplementary sensing module comprising an accelerometer and configured to detect a set of supplemental signals from the user; an electronics subsystem comprising a power module configured to power the system and a signal processing module configured to condition the set of respiration signals and the set of supplemental signals; a housing configured to facilitate coupling of the respiration sensing module and the supplementary sensing module to the user; and a data link coupled to the electronics subsystem through the housing and configured to transmit data generated from the set of respiration signals and the set of supplemental signals, thereby facilitating monitoring of the user's respiration.
US11051751B2
A system for monitoring medical conditions including pressure ulcers, pressure-induced ischemia and related medical conditions comprises at least one sensor adapted to detect one or more patient characteristic including at least position, orientation, temperature, acceleration, moisture, resistance, stress, heart rate, respiration rate, and blood oxygenation, a host for processing the data received from the sensors together with historical patient data to develop an assessment of patient condition and suggested course of treatment, including either suspending or adjusting turn schedule based on various types of patient movement. The sensor can include bi-axial or tri-axial accelerometers, as well as resistive, inductive, capacitive, magnetic and other sensing devices, depending on whether the sensor is located on the patient or the support surface, and for what purpose.
US11051749B2
Provided is a method for mapping a neural area involved in speech processing, including applying a plurality of recording electrodes to a surface of a cortex of a human subject, presenting a plurality of auditory stimuli to the subject wherein some of the plurality of stimuli are speech sounds and others of the plurality of auditory stimuli are non-speech sounds, recording brain activity during the presenting of the plurality of auditory stimuli, and identifying one or more brain areas wherein activity changes more after presentation of speech sounds than it does after presentation of non-speech sounds, wherein the human subject does not speak during the presenting and the recording. Also provided is a method for mapping a neural area involved in speech production wherein the human subject does not speak during presenting speech stimuli and recording neural activity.
US11051748B2
Methods, systems, and techniques for providing neurofeedback and for training brain wave function are provided. Example embodiments provide a Brain Training Feedback System (“BTFS”), which enables participants involved in brain training activities to learn to evoke/increase or suppress/inhibit certain brain wave activity based upon the desired task at hand. In one embodiment, the BTFS provides a brain/computer interaction feedback loop which monitors and measures EEG signals (brain activity) received from participant and provides feedback to participant. The BTFS may use an FFT based system or machine learning engines to deconstruct and classify brain wave signals. The machine learning based BTFS enable optimized feedback and rewards, adaptive feedback, and an ability to trigger interventions to assist in desired brain transitions.
US11051740B2
In one embodiment, an ECG monitoring system includes two or more electrodes configured to record cardiac potentials from a patient, at least one processor, and a rapid acquisition module executable on the at least one processor to: determine that an impedance of each electrode is less than an impedance threshold; record initial ECG lead data based on the cardiac potentials; determine that a noise level in each ECG lead of the initial ECG data is less than a noise threshold; start a recording timer once the noise level is below the noise threshold; record an ECG dataset while the noise level is maintained below the noise threshold until the recording timer reaches a predetermined test duration; store the ECG dataset and provide a completion alert.
US11051719B2
An electronic device includes a measurement unit configured to measure a contour of a body by the electronic device being moved along a surface of the body and a controller configured to generate a three-dimensional image of the body based on the contour. The controller is configured to generate the three-dimensional image by lining up a plurality of first contours measured along a first direction.
US11051718B2
Systems and methods for monitoring and treating patients with heart failure are described. A signal receiver may receive a heart sound (HS) signal and an impedance signal sensed from the patient. A heart sound detector circuit may use at least the received impedance signal to determine a HS detection window, and detect a HS component indicative of cardiac diastolic function from the received HS signal within the HS detection window. The system may include a heart failure detector circuit that may generate a cardiac diastolic function indicator (DFI) using the detected HS component and, in certain examples, may detect worsening heart failure using the generated DFI. The system may include a therapy circuit to deliver or adjust an electrostimulation therapy based on DFI.
US11051706B1
Systems, devices, and methods for tracking one or more physiological metrics (e.g., heart rate, blood oxygen saturation, and the like) of a user are described. For example, one or more light sources and one or more light detectors may be positioned on a wearable device such that light can be emitted towards the user's skin and further such that light reflected back to the wearable device can be measured and used to generate values for the one or more physiological metrics.
US11051704B1
Systems and methods include one or more entities including a sensor configured to provide data in at least a first protocol or standard from a first manufacturer and a second protocol or standard from a second manufacturer; and an electronic health record database configured to translate between the protocols and save the data in an intermediate format.
US11051694B2
A magnetic resonance imaging (MRI) radio frequency (RF) receive coil assembly is disclosed. The assembly comprises a deformable pad which comprises an array of tracking coils disposed on a surface of the deformable pad, each tracking coil corresponding to a grid point of the surface and configured to provide information of a position of the grid point. One or more RF receive coils are disposed within the deformable pad.
US11051689B2
A method, computer system, and computer program product for real-time pediatric eye health monitoring and assessment are provided. The embodiment may include receiving a plurality of real-time data related to an individual's eye health from a user device. The embodiment may also include assessing biometric indications relating to eye health based on the plurality of real-time data. The embodiment may further include generating a report on the assessed biometric indications. The embodiment may also include collecting clinical information from one or more databases. The embodiment may further include determining whether the assessed biometric indications reach pre-configured threshold conditions. The embodiment may also include generating alerts and recommendations based on analysis of the collected clinical information and the assessed biometric indications based on the assessed biometric indications satisfying the pre-configured threshold conditions.
US11051684B2
An endoscope light source device includes: a plurality of solid-state light sources; a plurality of collimating lenses that respectively collimate light beams emitted from the plurality of solid-state light sources into substantially parallel light beams; a multiplexing optical member that multiplexes the light beams that have been collimated into substantially parallel light beams by the plurality of collimating lenses; at least one diaphragm disposed between at least one of the plurality of solid-state light sources and a corresponding at least one of the plurality of collimating lenses; and a focusing lens that focuses multiplexed light beams from the plurality of solid-state light sources and causes the light beams to enter an end surface of a light guide of an endoscope, wherein the at least one diaphragm blocks more peripheral light as an optical path length from each of the plurality of solid-state light sources to the focusing lens becomes smaller.
US11051680B1
An endoscope stereo imaging device includes an endoscope lens assembly and an imaging module. The imaging module includes first, second and third lens assemblies, a beam splitter, first and second image sensors and a micro lens array. A light beam from the endoscope lens assembly is transmitted to the beam splitter after passing through the first lens assembly and is split into first and second portions of the light beam. The first portion light beam is transmitted to the first image sensor via the second lens assembly and forms a two-dimensional image. The second portion light beam is transmitted to the second image sensor via the third lens assembly and the micro lens array sequentially and forms a first three-dimensional image.
US11051678B2
A feeding tube assembly and feeding tube tip secure a viewing lens proximal of the distal end of the feeding tube tip. The feeding tube tip can include a plurality of protrusions that extend radially inward to secure the viewing lens. The feeding tube assembly and feeding tube tip can be used to improve image quality by keeping tissue from abutting the viewing lens as the feeding tube tip is inserted into a patient.
US11051677B2
An insertion system includes an insertion section and a rigidity variable portion provided in the insertion section. The rigidity variable portion includes a superelastic alloy member whose rigidity starts changing from a high-rigidity state to a low-rigidity state at a temperature, which varies with a degree of bending of the superelastic alloy member, and a heating member capable of switching between presence and absence of heating of the superelastic alloy member. The insertion system also includes a bending state detection sensor that detects a bending state of the rigidity variable portion, and a rigidity variable controller that controls switching between presence and absence of heating of the superelastic alloy member by the heating member to control the temperature of the superelastic alloy member.
US11051673B2
A dishwasher appliance includes a tub that defines a wash chamber for receipt of articles for washing. A sump is positioned at a bottom of the wash chamber for receiving fluid from the wash chamber. A fluid circulation assembly is at least partially disposed within the sump. The fluid circulation assembly is mounted in the sump with a resilient mounting post, whereby the fluid circulation assembly is vibrationally isolated from the sump.
US11051664B2
A dispenser for sheet products includes a housing having a space inside for accommodating a stack of sheet products, wherein the housing includes a dispensing opening for dispensing a sheet product from the front of the stack, an electronic controller configured to receive a pull-out signal indicating the removal of a product from the front of the stack through the dispensing opening and, upon receiving said pull-out signal, to send out a drive signal to transfer a number of sheet products from the front of the stack into a presentation position, and a pull-out detector for detecting the removal of a product from the front of the stack through the dispensing opening and for providing the pull-out signal to the controller.
US11051663B1
A dispensing assembly is disclosed herein. The dispensing assembly includes a housing comprising a plurality of side panels that together define a compartment; a self-contained cartridge for dispensing a paper product, the self-contained cartridge being removably received in the compartment of the housing; and an actuation subassembly being disposed in the housing, the actuation subassembly configured to advance the paper product disposed in the self-contained cartridge.
US11051657B2
A electronic grinder includes a main body removably attached to a grinding and dispensing chamber. The top of the main body is sealed by an upper cab and the bottom of the chamber is sealed by an openable lower cap. The main chamber includes a motor connected to a magnetically attached removable blade. The blade extends into the chamber when the grinder is assembled. When the lower cap is closed, the blade grinds material placed in the chamber. When the lower cap is opened, the blade functions as a fan to dispense ground material out of the chamber. The grinder also includes a display, an electronic scale, and an accessory cigarette lighter.
US11051655B2
A table (1) has a table top (2) containing an opening (3). A heating appliance (10) is in the opening (3) wherein the heating appliance (10) extends at least beneath the table top (2). The table top opening (3) comprises a recess (5) in which the heating appliance (10) is received, and the recess (5) has at least one wall (7) below the table top (2). The heating appliance (10) has a substantially sealed chamber (13) for receiving combustible fuel (47) with which the heating appliance (10) is used, and the chamber (13) has at least one window (35, 45).
US11051653B2
A grill including a first platen assembly, an second platen assembly movable with respect to the first platen assembly, a motor operable to move the second platen assembly with respect to the first platen assembly, and a control operable to measure movement of the second platen assembly with respect to the first platen assembly while the motor is off.
US11051641B2
The invention discloses portable beverage vessel for storing beverage to be consumed by a human, having a beverage container in which the beverage is stored; and an electronic device having a vessel controller, a transmitter and a receiver, said vessel controller being adapted to communicate with a beverage dispenser by exchanging messages using the transmitter and receiver of the electronic device; wherein the vessel controller is adapted to send an identification message to the beverage dispenser, by which the beverage dispenser can identify the portable beverage vessel. The invention also discloses a communicating between the portable beverage vessel and a fluid dispenser and a personal electronic device.
US11051639B1
A variable pressure blanket is disclosed. The variable pressure blanket includes a casing having a top fabric stitched to a bottom fabric to form a plurality of pockets having an interior volume. Discrete regions are arranged laterally across the casing to form distinct regions within the blanket. Each of the discrete regions have some of the pockets therein. Fill particles are disposed within the interior volumes of each of the pockets to generate a downward pressure. The pockets within one of the discrete regions have more fill particles than the pockets within the other discrete regions so that the one discrete region generates a greater downward pressure than the other discrete regions. The fill particles are non-insulative, while the top fabric and the bottom fabric may comprise an insulative material.
US11051637B2
A product management display system for merchandising product on a shelf includes using a trackless pusher mechanism that travels along a tray on which product is placed and one or more dividers for separating product into rows. The tray may include a notch for accessing the merchandising product from below and the product management display system may be thin to minimize vertical height. The trays may also be engaged with the shelf and may be, locked and unlocked.
US11051635B2
In general, example embodiments are drawn to a pillow having a body with a neck support and at least one arm extending from a first end of the neck support to a second end of the neck support, the at least one arm having forming a center void. In example embodiments, a cover may be provided over or around the body.
US11051634B2
An adjustable child carrier includes an adjustable bucket seat that can be adjusted to accommodate children of a wide range of sizes. The child carrier includes one or more adjustments that work alone or in cooperation to adjust the depth and width of the bucket seat area provided by the child carrier. The carrier is capable of supporting children of various sizes in an ergonomic position appropriate for the child's size.
US11051633B1
A vehicle mounted baby changing table including a changing table assembly, a vehicle assembly, a vehicle attachment and a table support assembly is disclosed. The vehicle mounted baby changing table further includes a changing table comprising a rectangular structure formed of a vertical back panel having a hingedly attached front panel, wherein the back panel is mountable to the rear side of vehicle seats. Such that the front panel folds down to a horizontal table surface that projects rearward within the vehicle back seat or cargo area.
US11051626B2
A foothold including a thermoelectric module includes a module housing in which a dissipation fan and a thermoelectric element are provided, and a blowing portion disposed at a first side of the module housing and having a blowing fan. Further, the thermoelectric module further includes a dissipation heat sink installed over the dissipation fan, and a cover provided at the upper portion of the module housing and having a top surface on which the user's feet may be placed.
US11051615B2
A storage rack having an embedded display may include a plurality of sections for holding a respective plurality of items. A first section may include, for example, a first vertical support, a second vertical support substantially parallel to the first vertical support, and a first set of horizontal supports substantially perpendicular to the first vertical support and the second vertical support. The first set of horizontal supports may include a first horizontal support disposed at a first height and a first depth in the first vertical support, and a second horizontal support disposed at the first height and the first depth in the second vertical support. The first horizontal support may extend from an inner wall of the first vertical support towards the second vertical support for a distance that is less than half of the distance between the first vertical support and the second vertical support.
US11051610B2
A toothbrush including a handle extending in a longitudinal direction and including an upper portion and a base. The upper portion includes an insert portion. The base is made of a flexible material and overlaps the insert portion and includes an interior cavity. A light is configured to emit light visible from outside the handle. An activation device is positioned in the interior cavity and is configured to be pressed in a direction transverse to the longitudinal direction to activate the light upon a user pressing the base.
US11051607B1
The painting system comprises a paint brush, a brush hose, a pump, a power source, a cap, and a suction hose. Paint may be pumped from a paint can to the paint brush by the pump such that the paint brush may continuously apply the paint to a surface without necessitating that bristles of the paint brush be dipped into the paint can. The cap may couple to the top of the paint can to retain the suction hose in position within the paint can. A bristle attachment of the paint brush may be detached so that the bristle attachment may be cleaned or replaced. A sprayer attachment may be coupled to the handle in place of the bristle attachment and may be activated to spray paint the surface.
US11051601B2
A device for guiding grooming of facial hair on a face and methods for using the device are disclosed. The device may include a strip of flexible material with an adhesive surface. The adhesive surface may temporarily attach the strip to a face having at least some facial hair. At least one edge of the strip may have a selected shape. The strip may be positioned on the face to cover a portion of the facial hair to be retained on the face while allowing an exposed portion of the facial hair to be removed by a shaving device. At least some part of the exposed portion of the facial hair lies along the edge of the strip with the selected shape.
US11051600B2
A hair wrap article comprises a plurality of swaths of cloth dimensionally cut and stitched together to form the article comprising a volume, wherein an article first end comprises a first volume opening greater than a second volume opening at an article second end. The article comprises a securing tab at an exterior portion of the article first end or a plurality of through slits, either one to receive and secure the article second end. The article may comprise the following: the securing tab comprising an isosceles trapezoid geometric configuration; a secondary securing tab proximate the securing tab to alternately operate to receive and secure the article second end; a semi-rigid ribbing stitched into the stitched together portion of the article; and a portion of the second volume opening may be stitched together to close the second volume opening to create an article second end internal volume.
US11051593B2
A bracelet clasp (1) of the deployant buckle type, including first and second strips (2, 4) articulated to each other via a first of their respective ends, between a closed position for wear, and at least one open position, the first strip (2) carrying a member (20) for attaching a first bracelet strand, the second, lower strip (4) having a loop member (28) at its second end defining a passage for a second bracelet strand and carrying a stud (30) intended to be inserted into a suitable hole in the bracelet strand to define an anchoring point of the latter to the clasp (1), the clasp (1) further including at least one locking member (11) for holding the first and second strips (2, 4) in their closed position, characterized in that the stud (30) is movable with respect to the loop member (28) and includes an actuator (34) arranged to move it and thereby define at least two predefined positions associated with a predefined useful bracelet length.
US11051590B2
The molded surface fastener has a base portion, right and left resin-intrusion-preventing wall portions standing on the base portion, and a plurality of engaging elements disposed between the right and left resin-intrusion-preventing wall portions. The resin-intrusion-preventing wall portions contain magnetic particles, and at least a part of a region formed of the resin-intrusion-preventing wall portions and the base portion has a concentration gradient portion in which a concentration of the contained magnetic particles is decreased toward at least one direction. This makes it possible to enhance the adhesion property between the part containing the magnetic particles and the part substantially containing no magnetic particles, and to suppress occurrence of cracks or the like between the containing part and the non-containing part of the magnetic particles at the time of manufacturing the molded surface fastener and at other times.
US11051587B2
A multicolored aglet connected to a shoelace has a unit slice, a pattern layer, and a white background layer. The unit slice is formed into two aglet bodies that are respectively sheathed on two ends of the shoelace, and has a mounting portion. The mounting portion of the unit slice is stuck to an outer side of the unit slice. The pattern layer is printed on and covers the inner side of the unit slice excluding the mounting portion, and is located between the unit slice and the shoelace. The white background layer is printed on the pattern layer and is located between the pattern layer and the shoelace. A method for producing the multicolored aglet is also provided.
US11051584B2
A sole structure with an integrated cleat member includes a plate member with a protruding portion that forms a first portion of the cleat member. A second portion of the cleat member is attached to the first portion and may be made of a less rigid material than the first portion. A supporting structure can be disposed inside the protruding portion. A method of forming the sole structure can include reshaping a portion of a plate member to form a protruding portion, molding a cleat tip portion onto the protruding portion and molding a supporting structure into a concave inner portion of the protruding portion.
US11051581B2
A footwear sole structure having a fluid-filled chamber including a tensile member is provided. The fluid-filled chamber includes a first barrier sheet, a second barrier sheet and the tensile member. The first barrier sheet is formed from a first thermoplastic material. The second barrier sheet is attached to the first barrier sheet and is formed from a second thermoplastic material. The first barrier sheet and the second barrier sheet cooperate to define an internal cavity. The tensile member is disposed within the internal cavity and is formed from a third thermoplastic material. A first weld attaches the first barrier sheet, the second barrier sheet, and the tensile member together by melding the first thermoplastic material of the first barrier sheet, the second thermoplastic material of second barrier sheet, and the third thermoplastic material of the tensile member.
US11051574B2
Presented are intelligent electronic footwear with controller automated features, methods for making/using such footwear, and control systems for executing automated features of intelligent electronic footwear. An intelligent electronic shoe includes an upper that attaches to a user's foot, and a sole structure attached to the upper for supporting thereon the user's foot. A collision threat warning system, a detection tag, a wireless communications device, and a footwear controller are all mounted to the sole structure/upper. The detection tag receives a prompt signal from a transmitter-detector module and responsively transmits thereto a response signal. The footwear controller receives, through the wireless communications device, a pedestrian collision warning signal generated by the remote computing node responsive to the response signal. Responsively, the footwear controller transmits a command signal to the collision threat warning system to generate a visible, audible and/or tactile alert warning the user of an impending collision with a vehicle.
US11051572B2
An air inflatable and thus collapsible when air is removed, safety helmet preferably comprised of multiple inflatable lobes with a head conforming and surrounding inflatable ring and separate or integrated skull cap, for wear by the user, for placement on top of the lobes and/or for location within the chamber(s) formed of the lobes, or worn by the wearer directly upon the head, made of flexible, force absorbing and dissipating material. The lobes and ring are provided with quick release air inflation and deflation valves. The safety helmet can simply alternatively comprise air inflatable lobes with a minimally elastic outer covering to encase and minimize the movement or air within the chambers during a collision.
US11051569B2
Disclosed is a wearable thermal protection and perspiration management apparatus that includes a two-ply composite main body and an inner layer of elastic material. The two-ply main body includes an outer layer made of moisture absorbent material and an interior layer made of moisture wicking material this is arranged in contact with the outer layer of moisture absorbent material. The interior layer provides a moisture barrier which is adapted for preventing captured moisture from contacting a wearer's body. The inner layer of elastic material is adapted and configured to secure the two-ply composite main body in contact with the wearer's body. Preferably, the two-ply composite main body has a Thermal Protective Performance rating of greater than 35 cal/cm2.
US11051567B2
The present disclosure provides microstructured hydrophobic surfaces and devices for gripping wet deformable surfaces. The surfaces and devices disclosed herein utilize a split contact Wenzel-Cassie mechanism to develop multi-level Wenzel-Cassie structures. The Wenzel-Cassie structures are separated with a spatial period corresponding to at least one wrinkle eigenmode of a wet deformable surface to which the microstructure or device is designed to contact, allowing grip of the deformable surface without slippage. Microstructures of the present invention are specifically designed to prevent the formation of Shallamach waves when a shear force is applied to a deformable surface. The multi-level Wenzel-Cassie states of the present disclosure develop temporally, and accordingly are characterized by hierarchical fluid pinning, both in the instance of slippage, and more importantly in the instance of localization. This temporal aspect to the multi-level Wenzel-Cassie state delays or prevents the transition from a wrinkled eigenmode state in a deformable surface to a buckled state in a deformable surface.
US11051564B2
An article of apparel is formed that is effective to regulate the temperature of the wearer. In an embodiment, a textile substrate is obtained, and a thermal regulation composition is applied to a surface of the textile substrate at a first temperature and a first pressure to form a coated textile substrate. The coated textile substrate is dried to form a thermal regulation membrane disposed on the surface of the textile substrate, and the textile substrate with the thermal regulation membrane is compressed at a second pressure and a second temperature to position a portion of the thermal regulation membrane below the surface of the textile substrate. The textile substrate is incorporated into an article of apparel. The thermal regulation composition can include one or more system reactive components provided within a binder, where a system reactive components can include a cooling agent, a latent heat agent and/or a heat dissipation agent.
US11051560B2
A unified garment and method of use thereof are provided wherein the garment that includes a pair of adjustable panels that alternately enable (1.) covering a selected portion of skin of a wearer of the garment; and (2.) exposing the selected portion of the wearer's skin without requiring the wearer to disrobe from the garment. Each panel extends from a same inferior portion of the garment and are detachably attachable at respective attachment points to cause a tension to be imposed between each attachment point and the inferior portion. The garment may include a first pair of apertures adapted to each separately receive a wearer's arm and/or a second pair of apertures adapted to each separately receive a wearer's leg. The garment allows exposure of a wearer's skin to enable direct contact between the garment wearer and the skin of another person for the practice of skin to skin contact.
US11051551B2
An apparatus comprising a smokable material heater, configured to heat a first region of smokable material to a volatizing temperature sufficient to volatize a component of smokable material and to concurrently heat a second region of smokable material to a temperature lower than said volatizing temperature but which is sufficient to prevent condensation of volatized components of the smokable material. A method of heating smokable material is also described.
US11051544B2
A method of producing smoking articles, the method comprising a first step of providing a continuous array of first filter members (42), second filter segments (20) and tubular members (40). A tubular member (40) is provided between each pair of consecutive first filter members (42) and a second filter segment (20) is provided between each first filter member (42) and each tubular member (40). Each second filter segment (20) contains one or more breakable capsules, wherein each breakable capsule comprises an outer shell and an inner core containing an additive. The continuous array of first filter members (42), second filter segments (20) and tubular members (40) is then wrapped with a continuous sheet of plug wrap (44) to form a wrapped filter array, wherein the plug wrap (44) has a basis weight of less than 90 grams per square metre. The wrapped filter array is cut at an intermediate position along each first filter member (42) to provide multiple filter rods, each filter rod comprising two first filter segments (18), a tubular member (40) positioned between the first filter segments (18) and a second filter segment (20) provided between each first filter segment (18) and the tubular member (40). Next, a tobacco rod (12) is provided in axial alignment with and adjacent to each first filter segment (18) of one of the filter rods, and the filter rod and a portion of each tobacco rod (12) are wrapped in a tipping wrapper (50). Finally, the tipping wrapper (50) and the filter rod are cut at an intermediate position along the length of the tubular member (40) to form multiple smoking articles (10), each smoking article (10) comprising a tobacco rod (12) connected to a filter (14), wherein each filter (14) comprises a first filter segment (18) downstream of the tobacco rod (12), a second filter segment (20) downstream of the first filter segment (18), and a hollow tube segment (22) positioned between the second filter segment (20) and the mouth end of the filter (14). The hollow tube segment (22) defines a cavity (24) at the mouth end of the filter (14).
US11051543B2
An ingestible compositions includes a first polymer layer, an adhesive layer associated with the first polymer layer, where the adhesive layer includes an adhesive material and is configured to releasably adhere to the first polymer layer, an alginate layer adhered to the adhesive layer, and a second polymer layer associated with the alginate layer and configured to releasably adhere to the alginate layer. Aspects further include methods of making and using the compositions.
US11051539B2
Making a salt substitute includes forming a salt substitute precursor, providing the salt substitute precursor to a centrifuge, and centrifuging the salt substitute precursor to yield a salt substitute in the form of a solid and a centrate. The salt substitute precursor includes water, a chloride salt, a food grade acid, and an anticaking agent. The chloride salt includes potassium chloride. A pH of the salt substitute precursor is between 2 and 4, and the salt substitute precursor is a saturated or supersaturated solution, a suspension, or a slurry. The salt substitute includes a chloride salt, a food grade acid, and an anticaking agent. The salt substitute includes potassium chloride and is in the form of a crystalline solid including at least 95 wt % of the chloride salt, up to 1 wt % of the food grade acid, and up to 1 wt % of the anticaking agent.
US11051537B2
[Problem] To provide a sesame-containing liquid seasoning which has an enhanced aroma unique to sesame and also has an original aroma which is irresistible and addictive. [Solution] The present invention is a liquid seasoning containing sesame, including a linear alkanethiol and a dimethylpyrazine which is at least one of 2,5-dimethylpyrazine and 2,6-dimethylpyrazine, wherein the ratio of the peak area of the linear alkanethiol to the peak area of the dimethylpyrazine is 0.05 or more and less than 1.0 when the aroma components of the liquid seasoning are measured by solid phase microextraction-gas chromatography mass spectrometry. Such a liquid seasoning shows an enhanced aroma unique to sesame and an original aroma which is irresistible and addictive.
US11051534B2
Methods for separating lean and fat from beef or other meats and the separation apparatus are shown. The methods use microbiocidal fluids to reduce or eliminate possible sources of contamination.
US11051527B2
The invention relates to a method for making cheese wherein cheese is salted with a salting agent comprising milk minerals and NaCl or a mixture thereof. The invention also relates to ripened cheese having a ratio of K/Na of 0.39 to 4.0 and a K content of more than 0.08%.
US11051515B2
The invention relates to 3-acyl-benzamides of formula (I) as herbicides. In formulae (I) X, Y, Z and Rx represent radicals such as alkyl, cycloalkyl and halogen.
US11051514B2
The present invention relates to compounds of Formula (I): wherein R1 is as defined herein, or an acceptable salt, solvate, prodrug or hydrate thereof. The compounds of Formula I are inhibitors of metalloenzymes, such as lanosterol demethylase (CYP51).
US11051507B1
A bird deterrent and repellant device includes a pair of holding members adapted to attach to a surface, base members connecting the main holding members, and spike members protruding upwardly from the base members and extending laterally outwardly with respect to the main holding members for preventing birds from landing on areas adjacent to the device. The base members are pivotally connected to the pair of elongated main holding members at pivot points, which allows the base members to rotate about the pivots points to transition the device between a wide configuration and a narrow configuration. In the wide configuration, the extent at which the spike members extend laterally outwardly relative to the main holding members is maximized for covering larger areas. In the narrow configuration, the extent at which the spike members extend laterally outwardly relative to the holding members is decreased to create a more compact device.
US11051501B2
A fishing reel includes a reel body, a drive shaft, a handle, a first roller clutch, and a second roller clutch. The reel body includes a tubular body-side accommodating part. The handle includes a handle arm extending in a direction intersecting the drive shaft, and a tubular handle-side accommodating part disposed adjacent to the body-side accommodating part in the axial direction of the drive shaft and partially accommodating the drive shaft. The first roller clutch is disposed in the body-side accommodating part of the reel body and prohibits rotation of the drive shaft in a fishing line releasing direction. The second roller clutch is disposed in the handle-side accommodating part and transmits only rotation of the handle in a fishing line winding direction to the drive shaft.
US11051498B2
Non-human animals (and/or non-human cells) and methods of using the same are provided, which non-human animals (and/or non-human cells) have a genome comprising human antibody-encoding sequences (i.e., immunoglobulin genes). Non-human animals described herein express antibodies that contain immunoglobulin (Ig) light chains characterized by the presence of human Vλ domains. Non-human animals provided herein are, in some embodiments, characterized by expression of antibodies that contain human Vλ light chains that are encoded by human Igλ light chain-encoding sequences inserted into an endogenous Igκ light chain locus of said non-human animals. Methods for producing antibodies from non-human animals are also provided, which antibodies contain human variable regions and mouse constant regions.
US11051497B2
The invention provides improved non-human vertebrates and non-vertebrate cells capable of expressing antibodies comprising human variable region sequences. The present invention is directed to the provision of long HCDR3s from non-human vertebrates and cells. The present invention is also directed to the provision of novel V, D and J pairings in immunoglobulin heavy and light chain loci. Novel, biased antibody diversities and potentially expanded diversities are provided. The invention also provides for novel and potentially expanded diversity or diversity that is biased towards variable gene usage common to antibodies useful for treating and/or preventing certain diseases or conditions, such as infectious diseases. The invention also provides methods of generating antibodies using such vertebrates, as well as the antibodies per se, therapeutic compositions thereof and uses.
US11051496B2
The present invention provides a mouse with liver damage, having a high degree of damage against the mouse's original hepatocytes while having a uPA gene in a heterozygous form, and a method for efficiently preparing the mouse. Specifically, the method for preparing a mouse with liver damage having the uPA gene in a heterozygous form comprises the following steps of: (i) transforming mouse ES cells with a DNA fragment containing a liver-specific promoter/enhancer and cDNA that encodes a urokinase-type plasminogen activator operably linked under the control thereof; (ii) injecting the transformed mouse ES cells obtained in step (i) into a host embryo; (iii) transplanting the host embryo obtained in step (ii) via the injection of the ES cells into the uterus of a surrogate mother mouse, so as to obtain a chimeric mouse; and (iv) crossing the chimeric mice obtained in step (iii), so as to obtain a transgenic mouse in which the DNA fragment is introduced in a heterozygous form.
US11051493B2
A system for distinguishing identities based on nose prints of animals contains: an input end, a database, an identification unit, and an output end. The input end is configured to input image data. The database includes multiple animal identity data which are actual nose prints data, actual body information, actual face data, and identity information of the animals. The identification unit is electrically connected with the input end, the database, and an output end. The identification unit includes multiple identification programs configured to analyze the image data, thus obtaining compared nose prints data, compared body information, and compared face data of the animals. The compared nose prints data, the compared body information, and the compared face data of the animals are compared with the actual nose prints data, the actual body information, and the actual face data of the animal identity data respectively.
US11051491B1
The portable pet water dispensing system is configured for use with a companion animal. The portable pet water dispensing system is configured for use in a vehicle. The vehicle further comprises a passenger seat. An example of a suitable vehicle includes, but is not limited to an automobile. The portable pet water dispensing system is a watering device. The portable pet water dispensing system provides a source of water for the companion animal as the companion animal is traveling in the vehicle. The companion animal controls when the water is dispensed. The portable pet water dispensing system table comprises a harness, a housing, and a sipper water structure. The harness attaches the housing to the passenger seat. The housing contains the sipper water structure. The sipper water structure dispenses the water to the companion animal.
US11051483B1
The invention relates to the novel cotton variety designated 18R448B3XF. Provided by the invention are the seeds, plants, plant parts and derivatives of the cotton variety 18R448B3XF. Also provided by the invention are methods of using cotton variety 18R448B3XF and products derived therefrom. Still further provided by the invention are methods for producing cotton plants by crossing the cotton variety 18R448B3XF with itself or another cotton variety and plants and seeds produced by such methods.
US11051482B2
The present disclosure provides alfalfa plants exhibiting broad spectrum resistance to Race 1, Race 2, and Race 5 anthracnose. Such plants may comprise novel introgressed genomic regions associated with disease resistance from Race 1, Race 2, and Race 5 anthracnose. In certain aspects, compositions, including novel polymorphic markers and methods for producing, breeding, identifying, and selecting plants or germplasm with a disease resistance phenotype are provided. Also provided are alfalfa varieties designated as C0416C4164 and H0415C4114. Provided by the invention are the seeds, plants and derivatives of alfalfa varieties C0416C4164 and H0415C4114. Also provided by the invention are tissue cultures of alfalfa varieties C0416C4164 and H0415C4114, and the plants regenerated therefrom. Still further provided by the invention are methods for producing alfalfa plants by crossing alfalfa variety C0416C4164 or H0415C4114 with itself or another alfalfa variety and plants produced by such methods.
US11051477B2
A novel soybean variety, designated 5PMFU17 is provided. Also provided are the seeds of soybean variety 5PMFU17, cells from soybean variety 5PMFU17, plants of soybean 5PMFU17, and plant parts of soybean variety 5PMFU17. Methods provided include producing a soybean plant by crossing soybean variety 5PMFU17 with another soybean plant, methods for introgressing a transgenic trait, a mutant trait, and/or a native trait into soybean variety 5PMFU17, methods for producing other soybean varieties or plant parts derived from soybean variety 5PMFU17, and methods of characterizing soybean variety 5PMFU17. Soybean seed, cells, plants, germplasm, breeding lines, varieties, and plant parts produced by these methods and/or derived from soybean variety 5PMFU17 are further provided.
US11051476B2
A novel soybean variety, designated 5PVPG40 is provided. Also provided are the seeds of soybean variety 5PVPG40, cells from soybean variety 5PVPG40, plants of soybean 5PVPG40, and plant parts of soybean variety 5PVPG40. Methods provided include producing a soybean plant by crossing soybean variety 5PVPG40 with another soybean plant, methods for introgressing a transgenic trait, a mutant trait, and/or a native trait into soybean variety 5PVPG40, methods for producing other soybean varieties or plant parts derived from soybean variety 5PVPG40, and methods of characterizing soybean variety 5PVPG40. Soybean seed, cells, plants, germplasm, breeding lines, varieties, and plant parts produced by these methods and/or derived from soybean variety 5PVPG40 are further provided.
US11051472B1
A novel maize variety designated X13N187W and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X13N187W with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X13N187W through backcrossing or genetic transformation, and to the maize seed, plant and plant part produced thereby are described. Maize variety X13N187W, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X13N187W are provided. Methods for producing maize varieties derived from maize variety X13N187W and methods of using maize variety X13N187W are disclosed.
US11051470B2
A novel canola variety designated N00655 and seed, plants and plant parts thereof. Methods for producing a canola plant that comprise crossing canola variety N00655 with another canola plant. Methods for producing a canola plant containing in its genetic material one or more traits introgressed into N00655 through backcross conversion and/or transformation, and to the canola seed, plant and plant part produced thereby. Hybrid canola seed, plant or plant part produced by crossing the canola variety N00655 or a locus conversion of N00655 with another canola variety.
US11051466B2
A pressure compensation member, an irrigation drip emitter, drip lines and methods relating to same, are provided for delivering irrigation water from a supply tube to an emitter outlet at a reduced and relatively constant flow rate. The pressure compensation member being suitable for use in conventional emitters or alternate emitters being provided having either a uniform elastomeric emitter body configuration or a poly-material emitter body utilizing an elastomeric pressure compensation member. Various methods are also disclosed herein relating to the pressure compensation member, emitters and/or drip line using such pressure compensating members and/or emitters.
US11051465B2
A forestry harvester for delimbing a tree with an angular upper cutter and side cutters while advancing the tree by feed rollers, wherein when the feeding of the tree is stopped due to being incapable of cutting the limbs off, the angle-shaped upper cutter and the side cutters are moved relative to the tree with rotation of the feed rollers stopped to cut off the limbs of the tree therewith. The forestry harvester comprises a feed unit (1 or 100) including a pair of left-hand and right-hand clamp arms (8, 9 or 108, 109) and feed means (20 or 120), a chain saw box (22a) having a power chain saw (22), a delimbing unit (2) including an angle-shaped upper cutter (52) and a pair of cutter arms (26, 26) each having a side cutter (25), guide mechanism for guiding the delimbing unit for forward and rearward movement of the delimbing unit relative to the feed unit, and a hydraulic cylinder (47) actuated to move the delimbing unit (2) toward and away from the feed unit (1 or 100).
US11051463B2
A plant growing system includes a base component; and a container disposed on top of the base component. The container includes a container body having a floor surface at a lower end, and a wall having a lower edge coupled to the floor surface and extending upward from the perimeter of the floor surface to an upper edge. A drainage port is disposed through the wall near the lower edge of the wall.
US11051454B2
A binding material for binding a bale of crop material has bale identification tags used to identify properties of the bale that is bound by the binding material. The binding material includes at least one strand of a non-identifying filament and one strand of an identifying filament incorporating the identification tags, wherein the identifying filament is formed as a continuous identification element comprising a resonant material incorporated into the identifying filament during a production process.
US11051450B2
A walk reel mower has a traction frame that carries a rotatable cutting reel that pushes grass against a bedknife for cutting the grass. A handle assembly extends rearwardly and upwardly from the traction frame. The handle assembly carries a handle that is gripped by a user to operate the mower as the user walks on the ground behind the traction frame. The handle assembly has upper and lower portions that have a telescopic connection to one another to adjust the height of the handle above the ground to accommodate users of different heights.
US11051447B2
An air seeding system and method includes a manifold mounted across a plurality of row planter units. Electric motors are mounted on the manifold and are operatively connected to the seed meters. A microprocessor or controller adjusts the speed of the motors in response to field data input so as to adjust the rate of seed dispensement to achieve desired plant population. The motor speeds can be adjusted on the fly, without stopping the air seeder. The system senses ground speed, senses the raised and lowered positioned of the row planter units, and senses any blockage of the row planter units. The motors eliminate the need for a ground drive wheel.
US11058029B2
A processor module includes a first circuit substrate and a second circuit substrate each having a processor mounting area and a memory mounting area on one surface thereof. One processor is mounted in the processor mounting area, while comb-like arranged memory modules are mounted in the memory mounting area. The surface of the first circuit substrate and the surface of the second circuit substrate are combined face-to-face and positioned such that the processor mounting area and the memory mounting area of the first circuit substrate are placed face-to-face respectively with the processor mounting area and the memory mounting area of the second circuit substrate, and end parts of the plurality of comb-like arranged memory modules of the first circuit substrate and end parts of the plurality of comb-like arranged memory modules of the second circuit substrate are alternately arranged with clearances produced between adjacent memory modules.
US11058024B2
A rotary extending frame includes a frame, a handle, a plurality of friction pieces, and a plurality of positioning discs. The frame has a plurality of accommodation spaces and fastening portions. The handle is rotatably disposed on the frame and has a holding portion and a plurality of rotating portions connected to two ends of the holding portion and facing two side surfaces of the frame respectively. The friction pieces are disposed on the corresponding rotating portions respectively and are firmly attached on the two side surfaces. The positioning discs are disposed on the corresponding rotating portions respectively and are pivotally connected to the friction pieces. The friction pieces and the frame clamp the corresponding rotating portions, so that the rotating portions and the positioning discs are adapted to rotate relative to the friction pieces and the frame and rub against the corresponding friction pieces simultaneously.
US11058022B1
The vertical track and sliding mount for a smoke detector comprises a guide tube, a lifting tube, and a mounting base. The mounting base may be adapted to couple to a detector. The mounting base may be coupled to the top end of the lifting tube. The detector be raised and lowered by sliding the lifting tube vertically within the guide tube. As non-limiting examples, the detector may be a smoke detector, carbon monoxide detector, radon detector, natural gas detector, propane detector, or other residential environmental detector or alarm. In some embodiments, a height lock may hold the lifting tube at an elevated position or at a lowered position.
US11058020B2
The present disclosure discloses a wall mount device adapted to be fixed to a wall surface and carry an electronic device with connecting wires. The wall mount device comprises a wall mount, a first and a second wire arrangement component. The wall mount has an upper and a lower surface. The upper surface faces the wall surface and the lower surface faces the electronic device. The first wire arrangement component is positioned on the lower surface and adjacent to a first side of the wall mount. The second wire arrangement component is positioned on the lower surface and adjacent to a second side vertical to the first side of the wall mount. The connecting wires are sequentially and detachably accommodated in the first and the second wire arrangement component from the electronic device to fix the connecting wires to corresponding positions on the wall mount.
US11058008B2
A manufacturing method, Printed Circuit Board (PCB) panel, and a PCB are disclosed. The method includes forming a cavity in a PCB that is in a PCB panel that includes a frame and stays, mounting an electronic component, heating the PCB panel, and cutting the stays. The PCB panel includes a frame body and a PCB coupled to the frame body via stays. The PCB includes a cavity. A first cavity stay is located near the cavity. Extended lines extend from the cavity, and the cavity stay extends at least between the extended lines. The PCB includes a cavity and a connection point from a cavity stay near the cavity.
US11058007B2
A component carrier with a) a first component carrier portion having a blind opening; b) a component arranged in the blind opening; and c) a second component carrier portion at least partially filling the blind opening. At least one of the first component carrier portion and the second component carrier portion includes a flexible component carrier material, and the first component carrier portion and the second component carrier portion form a stack of a plurality of electrically insulating layer structures and/or electrically conductive layer structures. It is further described a method for manufacturing such a component carrier.
US11058002B2
A method for producing a wired circuit board, the method including the steps of: a first step of providing an insulating layer having an opening penetrating in the thickness direction at one side surface in the thickness direction of the metal plate, a second step of providing a first barrier layer at one side surface in the thickness direction of the metal plate exposed from the opening by plating, a third step of providing a second barrier layer continuously at one side in the thickness direction of the first barrier layer and an inner surface of the insulating layer facing the opening, a fourth step of providing a conductor layer so as to contact the second barrier layer, and a fifth step of removing the metal plate by etching.
US11057997B2
A high-frequency module (1) includes a substrate (10), a first electronic component (30) and a second electronic component (40) mounted on a main surface (10a) of the substrate (10). The substrate (10) has a protruding portion (20) projecting from the main surface (10a), the first electronic component (30) is mounted in a region of the main surface (10a) different from a region in which the protruding portion (20) is provided, and the second electronic component (40) is mounted on the protruding portion (20).
US11057994B2
Articles, electronic devices and related methods of fabrication interfacing graphene with a gallium liquid metal alloy.
US11057992B2
A method for manufacturing connection structure, the method includes arranging conductive particles and a first composite on a first electrode located on a first surface of a first member, arranging a second composite on a region other than the first electrode of the first surface, arranging the first surface and a second surface of a second member where a second electrode is located, so that the first electrode and the second electrode are opposed to each other, pressing the first member and the second member; and curing the first composite and the second composite.
US11057990B2
A flexible substrate and a method thereof are provided. The flexible substrate includes a first flexible layer fabricated with at least one conducting path, and configured to sustain an electric power within the conducting path, a second flexible layer fabricated with one or more sensors connected in a form of a matrix, and the second flexible layer configured to generate a signal upon receiving an interaction from at least one user, a third flexible layer fabricated in-between the first flexible layer and the second flexible layer, and configured to insulate the conducting path of the first flexible layer from a matrix connection of the second flexible layer, at least one support structure operatively coupled to the first flexible layer, the second flexible layer and the third flexible layer, and configured to receive the signal generated by the second flexible layer and to provide a support.
US11057976B2
A short to ground protecting circuit for an LED driver for providing a power supply voltage for N LED strings. The LED driver has an output terminal for providing a power supply voltage for the N LED strings and N feedback terminals having N detecting voltages respectively. For each i from 1 to N, the ith LED string is coupled between the output terminal and the ith feedback terminal, and the ith feedback terminal is configured to have the ith detecting voltage. The short to ground protecting circuit receives a short threshold voltage and N open fault signals, and generates N short indicating signals. And on the premise of the ith open fault signal is valid, and if the ith detecting voltage is less than the short threshold voltage for a preset time period, the ith short indicating signal is valid.
US11057975B2
A two-terminal IC chip and method thereof. For example, a two-terminal IC chip includes a first chip terminal and a second chip terminal. A first terminal voltage is a voltage of the first chip terminal, a second terminal voltage is a voltage of the second chip terminal, and a chip voltage is equal to a difference between the first terminal voltage and the second terminal voltage. The chip is configured to allow a chip current to flow into the chip at the first chip terminal and out of the chip at the second chip terminal, or to flow into the chip at the second chip terminal and out of the chip at the first chip terminal. The chip current is larger than or equal to zero in magnitude. The chip is further configured to change a relationship between the chip voltage and the chip current with respect to time. The chip is an integrated circuit, and the chip does not include any additional chip terminal other than the first chip terminal and the second chip terminal.
US11057965B2
A control device, for a water purifier, that dispenses hot water and that includes: an input unit that is configured to receive a command signal; and a controller that is configured to control the water purifier based on the command signal, wherein the controller is configured to: control power output of a heating unit that is configured to heat water stored in a hot water tank of the water purifier, and based on the power output of the heating unit, control temperature of hot water dispensed by the water purifier is disclosed.
US11057964B2
Apparatuses and methods are disclosed for heating objects. The apparatus may include two conveyer belts. Each conveyer belt may include a plurality of teeth. At least a portion of the two conveyer belts may be in parallel to each other. In the parallel portion, the conveyer belts may include opposite teeth that are symmetrical to each other and the object may be fitted in the opening of the symmetrical teeth and secured by the surrounding teeth.
US11057960B2
A user equipment for a mobile communication system, includes: a receiver configured to receive, from a base station, an RRC (Radio Resource Control) connection release message including information instructing a transition to a specific state; and a controller configured to cause the user equipment to transit to the specific state in response to receiving the RRC connection release message including the information. The specific state is a different RRC state from an RRC connected and an RRC idle, and a connection for the user equipment is maintained between the base station and a core network.
US11057952B2
A radio terminal according to one embodiment is configured to perform a relay between another radio terminal and a network. The radio terminal comprises: a transmitter configured to notify the network of first information indicating that the radio terminal is a relay terminal of the another radio terminal; a controller configured to forward data addressed to the another radio terminal to the another radio terminal via a connection between the another radio terminal through the radio terminal and the network; and a receiver configured to receive from the network a message indicating that the data addressed to the another radio terminal exists when at least part of the connection is released. The controller is configured to start control for establishing the connection in order to forward the data addressed to the another radio terminal in response to receiving the message.
US11057942B2
Disclosed are a data transmission method, device, and system. The method comprises: for the transmission of random access uplink data, according to the correspondence between preambles and data resources as described by a protocol, determining the data resource corresponding to the preamble in the uplink data transmission, different preambles corresponding to different data resources; transmitting the preamble and the uplink data that uses the determined data resource. In the embodiments of the present invention, a protocol describes the correspondence between preambles and data resources. For the transmission of random access uplink data, the data resource corresponding to the preamble in the uplink data transmission can be determined, and different preambles correspond to different data resources. Thus it can be ensured that different users use different data resources to bear uplink data, thereby enabling the data portion multiplexing for multiple users.
US11057929B2
A system for controlling access to priority access wireless resources divides a radio spectrum into first wireless resources for use by general access devices and second wireless resources for use by priority access devices. A base station receives, from a server, information concerning the first and second wireless resources, including resource entries corresponding to each of the first and second wireless resources. Upon receiving a request for available wireless resources from a general access device, the base station provides one of the resource entries corresponding to the second wireless resources. The system includes a general access device which aggregates resource entries for the first and second resources for communication with another general access device. When the general access device detects priority access to the second resource, the general access device either releases the second resource or reduces transmission power on the aggregated first and second resources.
US11057928B2
Embodiments herein relate to a method performed by a scheduling node (12) for scheduling an uplink transmission from a wireless device (10) to the scheduling node (12), which wireless device (10) is connected to a Primary Cell, Pcell, of the scheduling node in a licensed or unlicensed frequency band, and wherein the wireless device (10) is also connected to at least one Secondary Cell, SCell, in an unlicensed frequency band. The scheduling node determines at least one Listen Before Talk, LBT, parameter associated with an LBT procedure and informs the wireless device (10) about the determined at least one LBT parameter in a scheduling grant of the uplink transmission.
US11057924B2
A method includes receiving information at a user equipment from a first apparatus, the information indicating to the user equipment is to communicate with a second apparatus.
US11057923B2
Embodiment of the present application provides a transmission method, a terminal device, and a base station, used to solve the technical problem in the related art that there is no method supporting CBG-based retransmission and ACK/NACK feedback. The transmission method comprises: receiving by the terminal device a downlink control channel; and acquiring by the terminal device a first indication field from the downlink control channel, the first indication field being used to indicate whether each code block group (CBG) in the corresponding CBGs in an initial transmission of TB needs to be retransmitted.
US11057904B2
A connection between mobile terminating (MT) user equipment (UE) and a base station can be established by receiving a paging message at the MT UE from the base station that includes a page reason indicator indicating that the MT UE is being paged for a voice call, and, at least partially in response to receipt of the paging message, sending a Radio Resource Control (RRC) Connection Request message from the MT UE to the base station that includes an establishment cause indicating that the MT UE is requesting a connection with the base station for the voice call. The establishment cause indicating that the MT UE is requesting a connection for a voice call can allow the base station to prioritize the MT UE's RRC Connection Request message over RRC Connection Request messages from other UEs in congested conditions.
US11057901B2
Methods, systems, and storage media for dynamic allocation of communication channels among multiple wireless networks are disclosed. The example embodiments may provide interference mitigation and control among a plurality of wireless protocols operating in an environment. Other embodiments may be disclosed and/or claimed.
US11057886B2
The disclosure relates to a method performed by a UE, for using subframes of a radio access network for a D2D communication. The method comprises determining subframes available for D2D communication among subframes of the radio access network. The subframes available for D2D communication exclude a number of subframes of the radio access network, such that a periodicity of the D2D communication in number of subframes divides the number of subframes available for D2D communication. The method also comprises using the determined subframes for enabling D2D communication.
US11057884B2
Provided is a terminal apparatus including: a measurement unit that can measure a time difference between reception and transmission by the terminal apparatus; a transmitter that can report a measurement result of the time difference based on an event associated with the measurement of the time difference, wherein in a case that the prescribed Transmission Time Interval (TTI) length is configured, and in addition, in a case that the measurement result is greater than a prescribed threshold, the transmitter reports the measurement result to the terminal apparatus. The transmission efficiency is thus improved.
US11057880B2
This disclosure provides systems, methods, and apparatus, including computer programs encoded on computer-readable media, for per-station punctured transmissions. A wireless local area network (WLAN) device may determine available resource units (RUs) within a wireless channel that has a punctured frequency range. The WLAN device may allocate a plurality of RUs, from among the available RUs, for to include data for a same station. For example, a physical layer protocol data unit (PPDU) may include more than one RU for a first station. The RUs that are allocated to the first station may exclude the punctured frequency range. In some implementations, the plurality of RUs may be separated by at least the punctured frequency range. A signaling header in the PPDU may indicate which RUs are allocated to the first station. By allocating a plurality of RUs in a PPDU, a WLAN may support per-station puncturing within the PPDU.
US11057871B2
Methods, systems, and devices are described for wireless communications. A wireless device may receive an allocation of uplink resources for an uplink transmission of uplink control information (UCI) during a long physical uplink control channel (PUCCH), which may range from four to fourteen symbol periods in length. The wireless device may identify a frequency hopping location based on the length of the PUCCH and a number of bits used to represent the UCI. In some cases, the frequency hopping location partitions the long PUCCH into a first set of symbol periods and a second set of symbol periods. After identifying the frequency hopping location, the wireless device may transmit a UCI message, which may include information and reference symbols, over a first frequency bandwidth during the first set of symbol periods and over a second frequency bandwidth during the second set of symbol periods.
US11057862B2
A Wireless Local-Area Network (WLAN) access point includes a WLAN transmitter, a WLAN receiver, and a processor. The WLAN transmitter is configured to transmit WLAN packets via one or more transmit antennas, and to send a timing-synchronization signal over an internal interface. The WLAN receiver is configured to receive, via one or more receive antennas, echo packets including reflections from an object of a selected subset of the WLAN packets transmitted by the WLAN transmitter, to receive the timing-synchronization signal from the WLAN transmitter over the internal interface, and to time-synchronize the echo packets and the corresponding WLAN packets using the timing-synchronization signal. The processor is configured to estimate one or more parameters of the object based on the time-synchronized echo packets and WLAN packets, and to output the estimated parameters to a user.
US11057860B2
A method for at least one service provider to collect wireless communication unit location related data for multiple mobile network operators, MNOs. The method comprises, at a base station supporting multiple MNOs: broadcasting on a first frequency only a first public land mobile network identifier, PLMN-ID, of a first MNO at a first instant in time for detection by first wireless communication units associated with the first MNO; receiving location related information from the first wireless communication units associated with the first MNO in response to the broadcast first PLMN-ID; broadcasting on a second frequency only a second PLMN-ID of a second MNO, at a second instant in time for detection by second wireless communication units associated with the second MNO; and receiving location related information from the second wireless communication units associated with the second MNO in response to the broadcast second PLMN-ID.
US11057855B2
The present invention relates to a method of detecting an access address of a physical channel in a Bluetooth signal to which channel coding is applied, the method including: performing initial signal processing in a unit of a specific length in a preamble section of a Bluetooth signal; and performing channel decoding in the specific length for a preamble part remained after the initial signal processing, wherein the specific length is a bit pattern length of a bitstream which is repeated in the preamble section or a length of a bitstream input for channel decoding. According to the present invention, channel decoding is performed in a unit of a bit pattern length of an access address from the remaining preamble part, and thus detection of the access address is available even though a start point of the access address is not provided.
US11057854B2
Features of the present disclosure implementing techniques that allow the user equipment (UE) to autonomously (e.g., without the network control) manage timing synchronization of a plurality of carriers using sidelink synchronization signal (SLSS) from one or more other UEs in order to identify a synchronization source. A synchronization source associated with a frequency carrier from a set of frequency carriers may be selected according to one or more SLSS sync source selection techniques or rules. For instance, the described solution may be utilized to enable UEs to autonomously perform V2X carrier aggregation (CA). In some examples, the synchronization carrier(s) to be searched may be determined based on the SLSS capability of the UE (e.g., transmission and reception of SLSS capabilities of the UE).
US11057852B2
A communication method and system for converging a fifth generation (5G) communication system for supporting higher data rates beyond a fourth generation (4G) system with a technology for Internet of things (IoT) are provided. The communication method and system may be applied to intelligent services based on the 5G communication technology and the IoT-related technology, such as smart home, smart building, smart city, smart car, connected car, health care, digital education, smart retail, security and safety services. A method by a terminal for acquiring a system information (SI) message is provided. The method includes receiving, from a base station, a plurality of synchronization signal blocks (SSBs), determining at least one physical downlink control channel (PDCCH) monitoring occasion associated with each of the plurality of SSBs in an SI window, and monitoring at least one PDCCH monitoring occasion associated with at least one of the plurality of SSBs to acquire the SI message.
US11057847B2
Provided is a base station apparatus, a terminal apparatus, and a communication method, capable of improving communication performance such as throughput and communication efficiency in a system using a plurality of frame formats. A terminal apparatus according to the present invention, includes a reception unit to receive information indicating at least one frame structure out of a plurality of frame structures from the base station apparatus, a control unit to perform a transmit power control associated with the frame structure, and a transmission unit to generate a transmit signal based on the frame structure and the transmit power control and transmit the transmit signal to the base station apparatus.
US11057842B2
The present disclosure relates to a transmission power control method and device capable of dynamically selecting optimal transmission power for the nodes in wireless network considering its surrounding interference. An embodiment comprises calculating a reduced transmitted power which will cause a corresponding reduced received power, such that: (a) transmitter interface and receiver interface can maintain connectivity of the active link with the reduced transmitted power, in the antenna direction between transmitter interface and receiver interface; (b) the reduced transmitted power does not create additional link-interference edges from any other active link, even if the transmission power of the other active link is maintained, in the antenna direction between the transmitting interface of the other active link and the receiver interface; and (c) the reduced transmitted power does not create additional hidden nodes, such that a CSRange of the reduced transmission power is still sufficient to inhibit transmission by any other interfering network node interface, in the antenna direction between said any other interfering network node and the receiver interface.
US11057839B1
A Fifth Generation New Radio (5GNR)/Long Term Evolution (LTE) User Equipment (UE) controls power consumption. The 5GNR/LTE UE selects a 5GNR transmit power and an LTE transmit power. The UE transmits 5GNR signals at the 5GNR transmit power and transmits LTE signals at the LTE transmit power. The UE averages Uplink (UL) Hybrid Automatic Repeat Request (HARQ) Block Error Rate (BLER) for an error sampling period. The UE compares the average UL HARQ BLER to an error threshold. When the average UL HARQ BLER exceeds the threshold, the UE decreases 5GNR transmit power and increases LTE transmit power. The UE may average UL path loss for a loss sampling period and compare the average UL path loss to a loss threshold. The UE may decrease 5GNR transmit power and increase LTE transmit power when the UL HARQ BLER and the UL path loss both exceed their thresholds.
US11057838B2
A method of adapting the output power of a radio transmitting entity within a cage having at least one aperture. The method includes the steps of providing at least one sensor operable to sense the condition of the at least one aperture and providing a controller to adjust the output power of the radio transmitting entity in accordance with the sensed condition of the at least one aperture.
US11057837B2
A device, such as a base station or user equipment (UE), may identify a narrowband reference signal (NB-RS) energy per resource element (EPRE) for a NB-RS to be transmitted in a wireless transmission. The device may identify a ratio of a narrowband physical downlink shared channel (N-PDSCH) EPRE to the NB-RS EPRE for orthogonal frequency division multiplexing (OFDM) symbols containing neither a cell-specific reference signal (CRS) nor a NB-RS. In deployments where NB transmissions are transmitted in a guard-band adjacent to a wideband system bandwidth, a device may identify a second ratio for N-PDSCH EPRE to CRS EPRE within OFDM symbols containing CRS. In deployments where NB transmissions are transmitted in-band with the wideband system bandwidth, a device may identify a third ratio of NB-RS EPRE to CRS EPRE, and a fourth ratio of N-PDSCH EPRE to NB-RS EPRE within OFDM symbols containing NB-RS transmissions.
US11057821B2
A method and a device for connecting to a hidden wireless access point, where a wireless routing device broadcasts a visible wireless access point to a user device, and the wireless access point has a corresponding hidden wireless access point; the user device obtains identification information and MAC address information of the visible wireless access point by scanning, and thereby acquires identification information of the hidden wireless access point corresponding to the visible wireless access point; and then, the user device sends a connection request with respect to the hidden wireless access point to the wireless routing device, and if the connection request is successfully authenticated, the user device is successfully connected to the hidden wireless access point.
US11057816B2
Notifying served user equipments (UEs) of the presence or absence of cell-specific reference signal (CRS) symbols transmitted by neighboring base stations in the physical downlink shared channel (PDSCH) region of a subframe can be achieved through various of signaling techniques. The served UE may be notified by communicating a one or multi-bit indicator in a physical layer signaling channel of the serving cell, such as the physical downlink control channel (PDCCH) of the subframe. Alternatively, the served UE may be notified through higher layer signaling.
US11057813B2
The present application discloses a method and an apparatus for transmitting downlink data, to resolve the issue of erroneous transmission of downlink data of UE when the UE moves from an EPS network to a 5G network. The method comprises: after receiving a request message for updating a session management context of the UE, a session management function entity in embodiments of the present application determining that the UE has moved from a first network to a second network; the session management function entity notifying a user plane function entity to delete a user plane connection of the UE in the first network, and creating a user plane connection of the UE in the second network, such that the user plane function entity transmits downlink data of the UE through the newly created user plane connection.
US11057806B2
A method of operating first and second terminal devices for transmitting data in a device-to-device communication mode in a wireless telecommunications system supporting communications on a first carrier operating over a first frequency band and a second carrier operating over a second frequency band. The first terminal device transmits control signalling on the first carrier and this is received by the second terminal device. The control signalling comprises an indication of that the first terminal device intends to transmit data to the second terminal device using the device-to-device communication mode on the second carrier after a carrier switch-over time. The first terminal device then proceeds to transmit data to the second terminal device on the second carrier using the device-to-device communication mode after the carrier switch-over time. The first and second terminal devices may cease communications on the second carrier after a carrier switch-back time.
US11057800B2
Aspects of the present disclosure provide techniques that may be utilized by a UE for performing neighbor cell measurement and reselection in narrowband deployment scenarios, such as NB-IoT deployment scenarios. For example, a method for wireless communications by a user equipment (UE), can include determining, while communicating in a serving cell, information regarding one or more transmission deployment mode parameters of at least one neighbor cell, and performing a neighbor cell search with measurement of narrowband reference signals (NRS) based on the one or more transmission deployment mode parameters.
US11057795B2
Example transmission rate control methods and apparatus are described. One example method includes obtaining a user equipment aggregate maximum bit rate (UE-AMBR) by a master base station. The master base station determines, based on the UE-AMBR, a first UE-AMBR used for the master base station and a second UE-AMBR used for a secondary base station. The master base station sends the second UE-AMBR to the secondary base station, and sends instruction information used to instruct the secondary base station to control data splitting for the master base station to the secondary base station. In this application, a transmission rate between each base station and a UE is controlled by allocating a UE-AMBR.
US11057793B2
Techniques for reducing latency between terminal stations in a wireless local area network. In an aspect, two stations in close proximity may be configured to associate with a common access point, by causing one or more of the stations to disassociate from a current access point and reassociating with the common access point. The identity of the common access point may be independently derived at each terminal station using simple broadcast messaging procedures, without the need for extensive communications or handshaking between the stations. In an alternative aspect, a terminal station may repeat the disassociation and reassociation procedures without knowledge of the other station's BSSID, until a measured latency drops below a threshold.
US11057790B2
Apparatuses, systems, and methods for a wireless device to perform a method including performing one or more of periodic beam quality measurements and/or event-based beam quality measurements, determining, based at least in part on one or more of the periodic beam quality measurements and/or the event-based beam quality measurements, a recommended beam quality measurement configuration, and transmitting, to a base station serving the UE, the recommended beam quality measurement configuration. In addition, the UE may perform receiving, from the base station, instructions regarding the beam quality measurement configuration. The instructions may include instructions to activate, deactivate, and/or modify at least one beam quality measurement configuration. In addition, the instructions may be based, at least in part, on the recommended beam quality measurement configuration.
US11057788B2
A method and system for detecting abnormal values in an LTE network is provided: dividing measured data into a training and a testing set; defining clusters and parameters in the training set, and finding the cluster to which each point belongs using clustering algorithms; calculating a likelihood of each point based on parameters and clustering results; assigning the likelihood into an abnormal, an intermediate or a normal region according to a set warning and alarming threshold; and applying a calculated model to the testing set, the likelihood of each point is calculated and assigned to a region, thereby finding abnormal values in the testing set. The variation of data points versus time may be better understood by introducing time axes into the model, thereby multiple abnormal values may be discovered from a sequence of multiple points. The method can immediately detect abnormal values and the error rate is low.
US11057786B2
Wireless directional communication is performed in the millimeter wave (mmW) band by nodes in a wireless mesh network. Beacon frames are configured to incorporate an activity indicator that signals active and inactive communication directions on the mmW, with a flag for each respective direction of communication (transmit or receive). The activity indicator is utilized to enhance route and beam selection so as to obtain connections subject to less interference, and/or that create less interference to other stations. The activity indicator is also, or alternately, utilized for improving selections of a connection to an access point (AP) or station (STA) or mesh station (MSTA), toward reducing interference, or selecting which beam from a given AP, STA, or MSTA is to be utilized. Distributed interference and resource coordination can be initiated, and/or rerouting determined, based on the activity indicator.
US11057784B2
A data communication system able to provide a speedy response to a user equipment transmitting data includes a base station and a data center. The base station is disposed adjacent to the data center, the base station is coupled between the data center and the user equipment, and the base station transmits data provided by the user equipment to the data center. The data center processes first data from the user equipment, and transmits a second data to the user equipment through the base station. Therefore, the data transmission time between the data center and the user equipment is shortened, and the data can be quickly fed back to the user equipment.
US11057783B2
A communication method, a secondary network node, and a terminal are provided. The method includes: a secondary network node acquires a network state of a cell served by the secondary network node; the secondary network node updates a network configuration of the cell served by the secondary network node according to the network state of the cell served by the secondary network node; the secondary network node sends first update configuration information to a terminal, wherein the first update configuration information is used for updating the network configuration of the cell served by the secondary network node.
US11057781B2
The invention relates to wireless repeater systems and methods. In embodiments, such systems and methods involve receiving a wireless transmission signal; and processing the wireless transmission signal using a digital signal processing facility (DSP); wherein the DSP is adapted to filter at least one sub-band of the wireless transmission signal using a digital bandpass filter.
US11057780B2
In an aspect of the disclosure, a method, a computer-readable medium, and an apparatus are provided. The apparatus may be a UE. The UE receives, from a base station, one or more downlink reference signals on an unlicensed carrier. The UE determines that the base station occupies the unlicensed carrier for a predetermined first channel occupancy time based on the one or more downlink reference signals. The UE receives, on the unlicensed carrier and in the predetermined first channel occupancy time, a control burst including a plurality of down link control channels. The UE attempts to decode a first down link control channel directed to the UE from the control burst.
US11057778B2
Technologies are shown for trust delegation that involve receiving a first request from a subject client and responding by sending a first token having first permissions to the subject client. A second request from a first actor includes the first token and responding involves linking the first actor to the subject client in a trust stack and sending a second token to the first actor with second permissions, the second token being a first complex token that identifies the subject client and the first actor. A third request from a second actor includes the second token and responding to the third request involves linking the second actor to the first actor in the trust stack, and sending a third token to the second actor partner with third permissions, the third token being a second complex token that identifies the first actor and the second actor.
US11057775B2
This application provides a key configuration method. A session management network element receives a request for end-to-end communication and obtains a security policy, where the security policy is determined based on at least one of: a user security requirement that is of the user equipment and that is preconfigured on a home subscriber server, a service security requirement from the user equipment, a security capability requirement supported by the user equipment, a security capability requirement from a carrier network, and a security requirement of a device on the other end of the end-to-end communication. The session management network element obtains a protection key used for protecting the end-to-end communication. The session management network element sends the security policy to the devices on two ends of the end-to-end communication.
US11057774B1
The disclosed technology includes a method and system for preventing or reducing cyber-attacks in a 5G network. A first node in a 5G network can detect that a first connected device is at risk of a cyber-attack based on one or more conditions and can broadcast to a plurality of nodes in the RAN that the first connected device is at risk of the cyber-attack. The first node can receive a first message from a second node of the plurality of nodes confirming or acknowledging that the first connected device is at risk of the cyber-attack. In response to receiving the first message from the second node confirming or acknowledging that the first connected device is at risk of the cyber-attack, the system can deauthorize the first connected device.
US11057756B2
A method of tracking at least one emergency service provider is disclosed. An electronic history is compiled that includes at least one identifier of a service provider, at least one identifier of an event to which the service provider responded, and GPS data identifying the geographic location of the service provider at each time interval within the duration of the event. A user interface within which is displayed a first identifier of a first event is generated to a display device. A selection of the event identifier is received from a user. In response to the selection of the identifier, an aerial view of a geographic region within which the first event took place is generated. At least one icon is displayed in the aerial view representing the service provider at the geographic location corresponding to at least one time interval during the event.
US11057750B2
An intelligent device controlling method, a mobile terminal, and a computing device are provided. A mobile terminal for controlling intelligently a device according to an embodiment of the present disclosure receives a call for a call connection, selects at least one control target device to control an operation while the call is connected, based on a location of the mobile terminal, selects a control item of the at least one control target device using a plurality of pre-learned control methods, and controls the control item for the at least one control target device in a state where the call is connected. Accordingly, it is possible to improve a call environment by controlling an operation of a device around a smart phone at the time of a call connection of the smart phone. At least one of a mobile terminal and an intelligent computing device of the present disclosure is associated with an artificial intelligence module, an unmmanned aerial vehicle (UAV), a robot, an augmented reality (AR) device, a virtual reality (VR) device, and a device related to a 5G service.
US11057749B2
The present disclosure provides a short message service (SMS) in a mobile communication system, to thus guarantee continuity of the SMS service. According to an embodiment of the present disclosure, an operating method of a control node for providing a message service in a mobile communication system includes receiving a message from a user equipment (UE) or a message delivery center, determining an active or inactive state of the message service using a first interface, and if the message service using the first interface is disabled, transmitting detach request information for re-attach of the UE to the UE.
US11057745B2
A data transmission method and a related apparatus are disclosed. The method is performed by a local MBMS functional entity, and includes obtaining local MBMS bearer information by using an interface between the local MBMS functional entity and an MBMS functional entity in a core network, after receiving application layer data sent by a local application server, determining a local MBMS bearer information matching the application layer data, and sending the application layer data based on the local MBMS bearer information matching the application layer data.
US11057738B2
A method for detecting a context of a mobile device equipped with sensors and a context detection module in which the sensors are assigned to at least two groups, each of which comprises at least one sensor, and each group is allocated a group classifier adapted to detect, in a form of a classification result, currently identified, by means of a given classifier, context of the device based on indications of the sensors belonging to the given group, characterized in that with a use of the context detection module, whereas the groups of sensors are ordered hierarchically, and the device context is detected by reading a classification result indicated by the classifier of the currently active group, wherein in case of detection of an identified context in the active group, switching on power supply of the sensors and activating classification in a group with a level higher by one level and reading the context indicated by said group's classifier, wherein based on the results of the classification indicated by the higher groups' classifiers, executing adaptation of the configuration of lower groups' classifiers.
US11057735B2
A transportation controller (TC) computing system for monitoring a user computing device location and triggering location-based events using geo-fencing is provided. The TC computing system includes at least one TC computing device configured to register a customer with a transportation controller (TC) service using registration data received from a user computing device associated with the customer. The TC computing device is also configured to receive, in response to the user computing device detecting a first geo-fence, first travel data associated with a trip of the customer. The TC computing device is further configured to validate the trip using the first travel data, receive, in response to the user computing device detecting a second geo-fence, second travel data associated with the trip of the customer, and determine a first transaction amount for the trip based on the first travel data and the second travel data.
US11057733B2
A method of determining the location of a user in an area. A user requests a transmitting device from a transmitter providing device. The transmitter providing device associates an identification code with the user, and the transmitting device transmits that identification code. One or more of receiving devices receive the identification code transmitted by the transmitting device, and send details of the received identification code to the user location determining device. The user location determining device then determines the location of the user, using the received details from the one or more receiving devices.
US11057730B2
Methods, apparatuses, and computer program products are provided in order to provide 3D audio playback using audio head-mounted devices. The apparatuses may be configured to receive at least one of position and orientation of a first head-mounted device in relation to a first user device, wherein the at least one of the position and orientation received is used to train a model using machine learning. At least one signal quality parameter may be determined based on input data and a filter pair may be determined corresponding with a direction to which a spatial audio signal is rendered based at least in part on the at least one signal quality parameter and the model so as to control spatial audio signal reproduction to take effect a change in the at least one of the position and orientation of the first head-mounted device during rendering of the spatial audio signal.
US11057710B2
A loudspeaker having: a magnetic unit, a voice coil axially movable in the air gap of the magnetic unit, a basket fixed to the magnetic unit, a membrane fixed to the cylindrical support of the voice coil and connected to the basket, and a vibrating element fixed to said membrane by means of a rim. The vibrating element has a base fixed to the membrane, a shank that projects from the base and a mass that projects from the shank in cantilever mode.
US11057704B2
An example method of operation may include receiving audio data, via one or more microphones of a network device, from an audio source, determining a location of the audio data based on a direction and amplitude of the received audio data, modifying the audio data for output via a loudspeaker of the network device, and outputting, via the loudspeaker, the modified audio data.
US11057703B2
An apparatus and method for an audio user interface solution that avoids the time variation problems seen when using an acoustic echo canceler in an audio system. The solution as disclosed and claimed herein results in lower CPU usage in the audio system because a synchronous sample rate correction (SSRC) is performed on the sample rate multiple rate content and the asynchronous sample rate correction (ASRC) is applied on a small number of signals used to feed the ASRC.
US11057702B1
A system and method for reducing audio feedback, and in particular ‘howling’, during a communication session involving two or more computing devices. The system determines that a first device is likely to join a meeting in which another, second device is already joined. In response, the system can cause the second device to broadcast a signal that, if detected by the first device, will indicate that the two devices are in auditory range of one another. As a result, the system can preemptively mute the audio components of the first device to prevent an audio stream of the first device from interfering with the audio already streaming via the second device.
US11057697B2
A wearable speaker system includes a bellows tube that holds a weight inside, and a speaker unit where a space inside the speaker unit and a space inside the bellows tube communicate with each other. The bellows tube is accommodated in the enclosure, and both end portions of the bellows tube are fixed to the enclosure.
US11057695B2
The present disclosure provides an in-ear headphone device including a loudspeaker having a loudspeaker diaphragm and a microphone, wherein the device is arranged to provide a noise cancelling audio signal to the loudspeaker. The loudspeaker and microphone are acoustically coupled within a device housing, and the device includes an acoustic tube coupling the device to an ear canal of a user. The acoustic tube is associated with an acoustic tube axis defining a projection plane perpendicular to the acoustic tube axis. The loudspeaker and microphone are arranged such that a projection area of the loudspeaker diaphragm onto the projection plane and a projection area of the microphone onto the projection plane are non-intersecting. The disclosure further provides an in-ear headphone device set including a first and a second in-ear headphone device.
US11057690B2
Systems and methods for creating a spectrum assignment for use by an optical network element are provided. In one implementation, an optical network element may include line devices configured to communicate optical signals with external network elements along one or more degrees. The optical network element may also include add/drop devices configured to perform at least one of adding one or more optical channels to the optical signals and removing one or more optical channels to the optical signals. The line devices and add/drop devices are configured to receive control signals from a spectrum management controller, the control signals being configured to allocate a first spectrum assignment for routing the optical signals through the line devices and further configured to allocate a second spectrum assignment for routing the optical signals through the add/drop devices. For example, the second spectrum assignment may be different from the first spectrum assignment.
US11057678B2
A media presentation and distribution system (MPDS) that handles rules-based presentation of non-programming media items, receives a user request (which includes user parameters) for delivery of programming media content at a first client device and transmits a media stream that includes the programming media content with a plurality of identifiers present with the programming media content. The MPDS further receives a request that includes one or more user preferences from the first client device, based on a detection of the plurality of identifiers. The MPDS further determines a set of non-programming media items for delivery to first client device based on the user parameters, targeting parameters, goals associated with a non-programming media item. The MPDS further generates rules and constraints information for non-programming media items and instructs a delivery of the set of non-programming media items and the rules and constraints information to first client device.
US11057677B2
A method includes receiving, at a server, a first content item and a second content item from a content source. The first content item is distinct from the second content item. The method includes generating, at the server, a modified content item by combining a first portion of the first content item and a second portion of the second content item. The method includes initiating transmission of the modified content from the server to a first device. The method also includes, after a first portion of the modified content item is transmitted, initiating transmission of a second portion of the modified content item from the server to a second device distinct from the first device. The second portion is subsequent to the first portion in a playback order of the modified content item.
US11057675B2
A media streaming device is provided that includes a media streaming module, a super capacitor and a protection module. The media streaming module provides the media stream. The super capacitor has a first terminal coupled to a power-supplying path and a second terminal coupled to a ground terminal. The protection module includes a current limiter and a disabling unit. The current limiter receives a power signal and performs current-limiting to generate a fixed-current power to charge the super capacitor and supply power to the media streaming module through the power-supplying path. The current limiter further detects a voltage of the first terminal of the super capacitor. The disabling unit disables the media streaming module when the voltage of the first terminal of the super capacitor is not higher than a voltage threshold value, and enables the media streaming module when the voltage is higher than the voltage threshold value.
US11057672B2
A node (200) of a communication network determines a precision to be applied for reporting of consumption of streamed content. The node (200) sends configuration information (304) indicating the precision towards a plurality of client devices (10). After receiving reports of consumption (308) of the streamed content from at least some of the client devices (10), the node (200) adapts the precision to be applied for said reporting of consumption of the streamed content and sends further configuration information indicating the adapted precision towards the client devices (10).
US11057662B2
A method is disclosed to include receiving first viewership information for a media segment displayed on a first electronic device, the first viewership information including a first viewership event associated with the media segment, where media content includes at least the media segment. The method can include receiving second viewership information for an overlay content segment displayed on a second electronic device, the second viewership information comprising a second viewership event associated with the overlay content segment. The method can include determining that a first viewership level for the overlay content segment is greater than a second viewership level for the media segment in view of the first viewership event or the second viewership event. The method can include sending a display instruction to a content management device instructing the content management device to send the overlay content segment to the first electronic device and the second electronic device.
US11057641B1
Provided is a method of motion estimation for processing a video stream comprising a plurality of frames, the method including segmenting at least one frame, from among the plurality of frames, into a plurality of blocks, determining an event density factor for each block included in a frame, wherein the event density factor of the block corresponds to a number of events accumulated in the block across frames in a predetermined time duration, comparing the determined event density factor with a threshold value, estimating a motion vector of the block based on the comparison, and processing the block in the video stream based on the estimated motion vector of the block.
US11057638B2
A method of video processing is provided to include maintaining one or more tables, wherein each table includes one or more motion candidates and each motion candidate is associated with corresponding motion information; performing a conversion between a current block and a bitstream representation of a video including the current block by using motion information in a table; and updating, after performing of the conversion, one or more tables based on M sets of additional motion information associated with the current block, M being an integer.
US11057635B2
A method for generating a video synopsis may include: segmenting a video file into a plurality of video fragments. The method may also include extracting moving object information from the video fragment based on a distributed computing method and determining a plurality of index files based on the moving object information. The method may further include combining the plurality of index files and generating a video synopsis based on the moving object information and the combined index file.
US11057625B2
A method of partitioning in video coding for JVET, comprising representing a JVET coding tree unit as a root node in a quadtree plus binary tree (QTBT) structure that can have quadtree or binary partitioning of the root node and quadtree or binary trees branching from each of the leaf nodes. The partitioning at any depth can use asymmetric binary partitioning to split a node represented by a leaf node into two child nodes of unequal size, representing the two child nodes as leaf nodes in a binary tree branching from the parent leaf node and coding the child nodes represented by final leaf nodes of the binary tree with JVET, wherein further partitioning of child nodes split from leaf nodes via asymmetric binary partitioning is allowed recursively along the same branch in any order with symmetric partitioning.
US11057624B2
The present invention provides an image encoding method and an image decoding method. The image encoding method of the present invention comprises: a first dividing step of dividing a current image into a plurality of blocks; and a second dividing step of dividing, into a plurality of sub blocks, a block, which is to be divided and includes a boundary of the current image, among the plurality of blocks, wherein the second dividing step is recursively performed by setting a sub block including the boundary of the current images as the block to be divided, until the sub block including the boundary of the current image does not exist among the sub blocks.
US11057622B2
A video decoder configured to determine a block of video data is intra predicted using an angular intra prediction mode, wherein the angular intra prediction mode is one of a bottom-left intra prediction mode or a top-right intra prediction mode; determine an aspect ratio of the block; locate one or more reference samples corresponding to the angular intra prediction mode; apply position dependent intra prediction combination to the reference samples to determine modified reference samples based on the aspect ratio of the block; and generate a predictive block for the block based on the modified reference samples.
US11057617B2
Aspects of the disclosure provide a method and an apparatus for video coding. In some examples, the apparatus includes processing circuitry. The processing circuitry decodes prediction information of a current block in a current picture from a coded video bitstream and the prediction information is indicative of inter prediction. The processing circuitry determines, for the current block, motion information including a first motion vector (MV) that has a x component and a y component where each of the x and y components has a fractional MV precision that is 2−N of a sample size in the current block and has one of 2L+1 MV values with the fractional MV precision. N is an integer larger than 2 and L is a positive integer. The processing circuitry reconstructs at least one sample of the current block based on the motion information.
US11057589B2
An electronic sitter management system coupled to patient surveillance network having a plurality of video cameras, each camera transmitting a stream of surveillance video of a respective patient room. The sitter management system includes at least one sitter management device and a plurality of sitter devices. Each device being assigned a plurality of patient rooms and capable of receiving a plurality of streams of surveillance video for the corresponding plurality of patient rooms and simultaneously displaying a plurality of video images of the corresponding plurality of patient rooms. Each device is also capable of transmitting sitter device availability information to the sitter management device. The sitter management device being capable of recognizing a sitter device being unavailable and reassigning the plurality of patient rooms previously assigned to the unavailable device to other of the plurality of sitter devices that are available.
US11057586B2
A method of transmitting a broadcast signal, includes generating at least one first link layer packet including data packets that include broadcast data in a link layer that is a layer between a physical layer and a network layer, generating at least one second link layer packet including link layer signaling information in the link layer and transmitting the broadcast signal including the at least one first link layer packet and the at least one second link layer packet in the physical layer, wherein a header of the at least one first link layer packet includes packet type information for indicating a packet type of the data packets before being included in the at least first link layer packet, wherein the data packets are Transport Stream (TS) packets or Internet Protocol (IP) packets, and wherein the TS packets are header compressed TS packets or header uncompressed TS packets.
US11057583B2
A bullet comment processing method and apparatus, a server, and a storage medium are provided. When a bullet comment needs to be released, at least one candidate track matching a to-be-released bullet comment format is identified; then, a display duration of an existing bullet comment content in each candidate track is determined as a first duration corresponding to the each candidate track, and a display duration of a to-be-released bullet comment content when being placed in the each candidate track is determined as a second duration corresponding to the each candidate track; the second duration and the first duration of the each candidate track are compared, and a target track is identified to display the to-be-released bullet comment, where the second duration of the target track is greater than the first duration; and the to-be-released bullet comment content is displayed at the target track.
US11057580B2
There is provided a light receiving device including: a pixel including a first tap configured to detect a charge photoelectrically converted by a photoelectric conversion unit, and a second tap configured to detect a charge photoelectrically converted by the photoelectric conversion unit; a first comparison circuit configured to compare a first detection signal detected by the first tap and a reference signal; a second comparison circuit configured to compare a second detection signal detected by the second tap and the reference signal; a first zero reset signal generation circuit configured to generate a first zero reset signal that is supplied to the first comparison circuit when the first comparison circuit performs an auto zero operation; and a second zero reset signal generation circuit configured to generate a second zero reset signal that is supplied to the second comparison circuit when the second comparison circuit performs an auto zero operation.
US11057579B2
An anti-overexposure circuit structure and an electronic device using the same are provided. An anti-overexposure circuit structure includes a first capacitor, a second capacitor, a photo diode, a first switch and a control circuit. The photo diode is coupled to the first capacitor and the second capacitor. The first switch is serially connected to the photo diode. The control circuit is coupled to the first switch and configured to: control the first switch to be turned off when SOC of the first capacitor or SOC of the second capacitor the SOC is lower than a predetermined level. As a result, it can prevent pixel unit of the electronic device from being overexposed.
US11057570B2
A vehicle includes at least one camera configured to obtain images around the vehicle, a display configured to display an output image based on the images around the vehicle, an inputter configured to receive a user's command, and a controller configured to determine a display mode of the output image based on the user's command and change an exposure value of the camera based on brightness information of a predetermined area corresponding to the display mode.
US11057567B2
The present invention is applicable to the field of videos. Provided are an anti-shake method and apparatus for a panoramic video, and a portable terminal. The method comprises: acquiring, in real time, a current state timestamp, an accelerometer numerical value and an angular velocity numerical value of a gyroscope in a portable terminal; performing estimation using extended Kalman filtering combined with the accelerometer numerical value and the angular velocity numerical value to obtain an amount of rotation of the portable terminal to a world coordinate system; synchronizing the timestamp of the gyroscope with a timestamp of a panoramic video frame; performing quaternion interpolation on the state of the gyroscope to acquire a rotation matrix corresponding to the panoramic video frame; and rotating a panoramic image according to the current rotation matrix to generate a stable video frame.
US11057561B2
Techniques are described for automated operations involving capturing and analyzing information from an interior of a house, building or other structure, for use in generating and providing a representation of that interior. Such techniques may include using a user's mobile device to capture visual data from multiple viewing locations (e.g., video captured while the mobile device is rotated for some or all of a full 360 degree rotation at each viewing location) within multiple rooms, capturing data linking the multiple viewing locations, analyzing each viewing location's visual data to create a panorama image from that viewing location, analyzing the linking data to determine relative positions/directions between at least some viewing locations, creating inter-panorama links in the panoramas to each of one or more other panoramas based on such determined positions/directions, and providing information to display multiple linked panorama images to represent the interior.
US11057550B2
A camera lens control system includes a hand control unit equipped with an adaptive display for marking. The adaptive display is electronically controlled or programmed to display any desired objects for marking. The hand control unit includes a body, a control knob attached to the body, and a marking ring concentrically coupled with the control knob. The control knob is configured to receive a user input for controlling a lens setting. The marking ring includes a display configurable to display one or more markings corresponding to the lens setting.
US11057549B2
In one aspect, a device includes at least one processor and storage accessible to the at least one processor. The storage includes instructions executable by the at least one processor to identify coordinates of a camera relative to a screen and to present on the screen a video stream next to the coordinates responsive to identifying the coordinates of the camera.
US11057547B2
To enable a receiving side to appropriately perform processing of obtaining display image data from transmission video data having a predetermined photoelectric conversion characteristic. Input video data is processing and transmission video data having a predetermined photoelectric conversion characteristic is obtained. Encoding processing is applied to the transmission video data and a video stream is obtained. A container of a predetermined format, including the video stream, is transmitted. Information indicating a photoelectric conversion of the input video data is inserted into the video stream and/or the container.
US11057539B2
Provided is a method of embedding and extracting watermark data that is robust against geometric distortion and low-quality photographing and for which the probability of successfully extracting watermark data for an original image is high, while the probability of successfully extracting the watermark data in the case of unauthorized copying is seriously impaired. The data embedding method according to an embodiment of the present invention comprises a step of converting the noise-based image using watermark data, and a step of adjusting the original image using the converted noise-based image.
US11057527B2
A system for providing emergency telephone call solutions for wireless devices using a voice over data network, the system having the voice over data network to recognize an emergency call from one of the wireless devices, to determine whether a cellular network is available to receive the emergency call, and to transmit the emergency call to the cellular network, a gateway for converting the emergency call between a first format for the voice over data network and a second format for a public switched telephone network associated with the cellular network, a mobile virtual network operator to communicate information associated with the emergency call to the cellular network and to the voice over data network, and the voice over data network and the cellular network to route the emergency call and the information associated with the emergency call to an emergency authority.
US11057516B2
Systems and methods for providing called devices with sets of context data associated with communication sessions are disclosed. In one implementation, a method for generating context data associated with a communications session may include receiving, from a calling device at a first subsystem, a request to establish a communications session. The request may include a first identifier associated with the calling device. The method may further include receiving, at a second subsystem, activities data associated with the calling device that transmitted the request to establish the communications session. The activities data may include a second identifier associated with the calling device and may be indicative of device activities of the calling device. In addition, the method includes determining, using the first identifier and the second identifier, that the received activities data is associated with the calling device that transmitted the request to establish the communications session, generating context data associated with the communications session based on the received activities data, generating visual content based on the generated context data, and establishing the communications session in response to receiving, from a user of the called device, an input command to accept the request.
US11057507B2
An electronic assembly and an electronic device are provided. The electronic assembly includes a receiver, a first circuit board, a flashlight, a second circuit board, and a sensor. The first circuit board has a first surface and a second surface opposite to the first surface, the receiver is disposed on the first surface and electrically connected to the first circuit board, the flashlight is disposed on the second surface and electrically connected to the first circuit board, the second circuit board is disposed on one side of the receiver away from the first circuit board, the sensor is disposed on one side of the second circuit board away from the receiver and is electrically connected to the second circuit board.
US11057502B2
A computer readable storage medium, system and method for improving automated testing systems to include a first and second behavioral data. The first behavioral data is collected periodically and the second behavioral data is collected in real time. The receipt of the first behavioral data and a second behavioral data are followed by the receipt of a system configuration template. A test case is updated based on the first and second behavioral data, and an automated test environment is reconfigured based on the first behavioral data, second behavioral data, and the system configuration template. The test executes in the automated test environment producing a test result.
US11057496B2
A device executing an application in a distributed system may transmit a query for capabilities of one or more components in the distributed system to a capability service and receive a response. Based on the response, the device may determine whether a first capability criteria that is based on a first version of the application is met. If the first capability criteria is met, the device may execute the first version of the application. If the first capability is not met: the device may transmit a subscription request to subscribe to one or more particular capabilities; and optionally may determine a second version of the application for which a second capability criteria is met and execute the second version until receiving a notification to the subscription. The capability service may have a capability store that is updated upon a capability change in the one or more components in the system.
US11057489B2
Embodiments of this disclosure provide a content deployment method and a delivery controller. The content deployment method includes: receiving, by a delivery controller, a content deployment request from an application server controller, where the content deployment request includes identification information of requested content and address information of an application server storing the requested content; and sending, by the delivery controller, a first deployment cache request to a first cache server, where the first deployment cache request includes the identification information of the requested content and the address information of the application server, and the first deployment cache request is used to request the first cache server to obtain the requested content from the application server and cache the requested content. With the content deployment method and the delivery controller in the embodiments of this disclosure, content deployment under control of a content provider can be implemented.
US11057484B2
Methods and apparatuses that generate a subtopic identifier identifying a client application within a client device that can support multiple users are described. The client application may be associated with a server application hosted in one or more application servers. Notification services may be registered with the application servers from the client application to forward identifiers associated with the client application for one of the multiple users to the server application to enable the server application to push notification messages to the client device selectively for the client application for that user. When receiving a notification message from the application server, the notification message may be examined to forward the notification message directly to the client application for that user without invoking other applications in the client device if the notification message carries a subtopic identifier of the client application.
US11057475B2
Disclosed are methods, systems and apparatus for resuming a transmission link. The method may comprise: if a connection between a first server and a third server that are adjacent to each other in a transmission link is interrupted, a second server serving as a next node of the third server sends a breakpoint resuming request to the first server; on the condition that the first server and the second server mutually determine that the resuming condition between the two is satisfied, the first server establishes a compensation connection egress port of the first server to an ingress port of the second server; and resumption is performed through the compensation connection. The abnormal connection in the transmission link can be compensated and resumed through a node in a private network, so that the idle processing capacity of each node can be utilized, and the utilization rate of processing resources can be improved.
US11057473B2
In the present disclosure, an appropriate control-target device is caused to carry out an operation without the control-target device being designated. A linking system (7) includes: a linking server (1); a device controlling server (2); one or more devices (4); and an information providing server (5). In a case where the device controlling server (2) has received from the linking server (1) an instruction for carrying out an operation in accordance with a linking rule, the device controlling server transmits (2) a command to carry out the operation to at least one device, the at least one device having been identified by the device controlling server (2) from among the one or more devices (4) in accordance with a user specified in the linking rule. The information providing server (5) transmits, to the linking server (1), notification of a trigger for the operation.
US11057461B2
The techniques and systems described herein implement an improved peer matching service by coordinating peer matching requests across multiple peer matching nodes configured within a peer matching unit so that resource consumption can be spread out and resource limitations are not exceeded. Moreover, the peer matching service can determine if a peer matching unit is overloaded (e.g., experiencing an increased number of requests in a given time interval that is causing performance degradation), and the peer matching service can implement an action to scale out the number of requests within the peer matching unit (e.g., re-distribute some peer matching requests to another peer matching unit). In various examples, the peer matching service can determine if peer devices are co-located peer devices based on location information and can generate a list that prioritizes the co-located peer devices.
US11057457B2
Images of key phrases or hashtags appear on televised feeds. Image processing techniques, such as feature locating algorithms or character recognition algorithms, can be used to locate the images of key phrases in the images. Then, character recognition algorithms can be used to generate a list of candidate key phrases for the key phrase in image format. However, identification of the key phrase in image format is not completely accurate with conventional methods. Social media content items associated with the televised feed are used to filter the list of candidate key phrases. Using known information about the televised feed as well as about key phrases in text format in the social media content items, candidate key phrases in the list of candidate key phrases can be scored and, thus, a final candidate key phrase selected based on the scores.
US11057455B1
This disclosure describes techniques for providing an abstraction layer for one or more file transfer tools that may operate on a public network, or on a network controlled by an organization or enterprise. In some examples, a computing system may serve as a front-end for a managed file transfer system that may hide some details of the operations performed by the file transfer system. The computing system may interact with one or more managed file transfer systems (or similar systems) to provision a data path between computing systems, perform a file transfer between the computing systems, perform sustainment tasks associated with the data path, and/or perform lifecycle management tasks associated with the data path.
US11057452B2
A content delivery network with at least one first content server bound to a first domain associated with a first characteristic (e.g., popular) associated with content servable from the content delivery network. The content delivery network includes at least one second content server bound to a second domain associated with a second characteristic (e.g., unpopular) associated with content servable from the content delivery network. At least one processing device including computer executable instructions for receiving a request to provide an embedded resource including either a first host name associated with the first domain or a second host name associated with the second domain.
US11057451B2
A method is provided for synchronizing a source device with a sink device. The source device transmits a stream of packets to the sink device. The source device receives feedback from the sink device indicating packet arrival times of the packets at the sink device. Based on the feedback, in some aspects, the source device determines an average time shift in the packet arrival times at the sink device, wherein the average time shift is relative to expected packet arrival times of the packets at the sink device. In some such aspects, the source device detects that the average time shift exceeds a threshold, and in response to the detecting, adjusts a streaming time of the stream of packets to synchronize, within a predefined tolerance, the source device with the sink device.
US11057448B2
A method for receiving a streaming service is disclosed. The method for receiving a streaming service may be a method performed at a terminal for receiving a streaming service for a video content coded in a layered manner and may include the steps of: (a) sequentially requesting a transmission of at least one video data for a basic layer to be stored in the idle space of a buffer; and (b) sequentially requesting a transmission of video data for a layer of an increased level if the buffer does not have idle space, performed during the decoding of video data corresponding to a single video chunk, where step (b) may be repeated with the level of the layer increased during the decoding of video corresponding to a single video chunk.
US11057447B2
A method and system for delivering content are disclosed. A media stream including media data is received from a content provider at a content delivery network (CDN) server. The CDN server creates a uniform protocol data unit (PDU) comprising the media data. A plurality of requests to receive the uniform PDU are received at the CDN server from a plurality of devices is received at a CDN server. Each device is associated with a unique IP address. The CDN server communicates the uniform PDU over a network to the plurality of devices using the unique IP address for each of the plurality of devices.
US11057445B2
The invention concerns a method for adapting the downloading behavior of a client terminal configured to receive a multimedia content from at least one server, said multimedia content being defined by at least one representation, wherein it comprises the steps of: requesting (S0) a first part of said multimedia content with a given representation; detecting (S1) if a cache between is located along the transmission path the client terminal and a server, based on the request of said first part; in case (S3) a cache is detected, requesting a second part of said multimedia content with a representation depending on at least one performance criterion.
US11057444B1
Systems, methods, and non-transitory computer-readable media can determine that a broadcaster of a first live content stream has identified at least one user of a social networking system to join as co-broadcaster. A merged live content stream is published through the social networking system, the merged live content stream including the first live content stream of the broadcaster and a second live content stream associated with the at least one identified user. At least one notification is sent to one or more other users of the social networking system. The notification informs the one or more other users about the merged live content stream.
US11057440B2
A method for processing a message in a group session of a social networking application is performed at a computer device. The method includes: receiving a session message in a group session; extracting a child application identifier carried in the session message; determining a session identifier corresponding to the group session to which the session message belongs; obtaining page data that corresponds to the child application identifier and that is associated with the session identifier; and rendering, according to the page data, a child application page in a child application that is invoked in an environment provided by the social networking application and that corresponds to the child application identifier.
US11057428B1
Disclosed herein are methods, systems, and processes for tracking honeytokens. A malicious attack from an attacker is received at a honeypot and a determination is made that an attack event associated with the malicious attack has compromised deceptive credential information maintained by the honeypot. A unique credential pair that corresponds to the deceptive credential information sought by the attack event is generated and a honeytoken tracker state table is modified to include the unique credential pair and attack event metadata in association with the attack event. The unique credential pair is then transmitted to the attacker.
US11057423B2
A system for distributing virtual entity behavior profiling in cloud deployments is disclosed. In particular, the system may include conducting entity behavior profiling closer to where data and data logs are generated, such as at a hypervisor server, in a distributed fashion. By doing so, the system may reduce bandwidth consumption typically associated with transferring data to a central processing system, may be able to use more data collected closer to sources of data generation, and may provide faster reaction times because of the faster processing of data enabled by the system. Additionally, the system may assist with reducing false positives associated with malware detection and other compromises associated with entities by aggregating the results of distributed computations at different sites.
US11057416B2
Example embodiments disclosed herein relate to analyze code of a web application associated with a framework. The code is loaded. Data objects of the framework that are used by the code are modeled using local parameters with explicit control flow. The code is analyzed to identify at least one vulnerability by analyzing one or more execution paths of the code using the explicit control flow.
US11057411B2
A log acquirer acquires a communication log to be analyzed obtained from communications in a predetermined network. A log analyzer detects a terminal conforming to an analysis rule using a signature generated based on the characteristics of a communication log generated by a terminal infected with malware. A primary scorer and a secondary scorer calculate a score indicating the degree of threat for a detection result including the information on the terminal detected by the log analyzer and an analysis rule to which the terminal conforms using the information on the analysis rule and the information on the detection result. A detection result display unit outputs the detection result and the score calculated by the primary scorer and the secondary scorer.
US11057407B2
Detecting malware attacks is described herein. A computer-implemented method may include receiving, via a processor, events from a plurality of activity monitors. The method also include extracting, via the processor, a plurality of behavioral features from the received events. The method may further include detecting, via the processor, a malware attack based on the extracted behavioral features using a malware identification model trained on private data and public data using a machine learning technique, wherein the private data includes private enterprise attack findings. The method may also include executing, via the processor, an ad hoc protection improvement based on the detected malware attack.
US11057401B2
A state detection section (105) detects states of a plurality of controllers (300, 400) included in a communication system (600). An attack determination section (103) selects, from among a plurality of whitelists (110) each of which is associated with a combination of states, a whitelist (110) associated with the combination of the states of the plurality of controllers (300, 400) detected by the state detection section (105). The attack determination section (103) detects an attack on the communication system (600) by using the selected whitelist (110).
US11057396B2
An intelligent transportation system, ITS, station (600) comprising: a host processor (640); and a memory (664) operably coupled to the host processor (640). The host processor (640) is configured to: perform verification per identity that includes precomputation of data for a plurality of neighbouring ITS stations of the ITS station (600); store precomputation data for the verified identity of the plurality of neighbouring ITS stations in the memory (664); and extract from memory (664) and use the stored precomputation data for a respective neighbouring ITS station to perform an accelerated verification of a subsequent message received from that neighbouring ITS station.
US11057395B2
Information stored in a Hypertext Transfer Protocol (HTTP) session is monitored. Based on the monitoring, authentication information in the information stored in the HTTP session is identified.
US11057381B1
A credentials store definition identifying a remote credential store is received. The credential store definition includes access information to enable access to the remote credentials store. A credentials object is created in an internal database based on a credentials object definition. The credentials object identifies a security credential to retrieve from the remote credentials store to access an external resource. At runtime, a request to access the external resource is received, and based on receiving the request, the security credentials identified by the credentials object are retrieved from the remote credential store using the access information. The retrieved security credential is provided to a processing component to access the external resource.
US11057380B2
A method of detecting fraudulent activity during authenticating users and user identifications includes initiating a user's device to capture a sequence of images of the user to be authenticated commencing when the camera is operational and prior to receiving from the user a selection of the control that triggers capture of images and continuing until detecting that the user has selected the control to trigger capture of images, thereby enabling capture of activity performed by the user prior to and contemporaneous with selecting the control, including any attempted fraudulent activity of the user to be authenticated. Video, still images and audio of the user seeking authentication can be captured.
US11057378B2
A device for removing security on content using biometric information includes a memory configured to store content on which security has been set based on first biometric information of a user; and a controller configured to obtain second biometric information of the user, which is of a different type than the first biometric information, and remove the security on the content based on the second biometric information, in response to a user input for executing the content.
US11057369B2
A method for use in a hybrid network ecosystem comprising an enterprise network and a reconciliation network, the method comprising generating, by at least one first computing node in the enterprise network or the reconciliation network, a first digital facilitator, wherein the first digital facilitator enables a first device to use a private key to access data associated with a distributed ledger operation. The method also comprises transmitting, via the reconciliation network, the data from the first computing device to a second computing device, wherein the first computing device and the second computing device are connected via the reconciliation network.
US11057362B2
A method of dynamic adaptive authentication includes receiving a request from a user to access a resource of a network and determining whether the resource is protected. In response to determining that the resource is protected, a dynamic authentication chain is generated. The dynamic authentication chain includes a plurality of authentication schemes that are arranged in a particular order. The method also includes challenging the user with the dynamic authentication chain and receiving a set of credentials from the user based at least in part on the particular order of the dynamic authentication chain. The method includes determining whether the set of credentials satisfies the dynamic authentication chain. In response to determining that the set of credentials satisfies the dynamic authentication chain, the user is authenticated.
US11057356B2
A chat robot may be used to facilitate interaction with a user in the determination of whether to initiate and process a data subject access request (DSAR). At a DSAR submission webpage, the chatbot may interact with a user to determine the information the user is in need of and/or the actions that the user may take. The chatbot may provide the information desired by the user, avoiding the processing overhead of submission and fulfillment of a DSAR. The chatbot may also facilitate completion of a DSAR on behalf of the user when needed.
US11057354B2
The present invention relates to a method and a system that enable a sender to send a message to a recipient in an anonymous way, allowing the recipient to respond to the sender after receiving the message. No data related to the sender and the recipient are retained in the system.
US11057351B1
A system and method for transferring media over a VPN connection are provided. The method includes receiving a first request for connection to a first target at a VPN server from a user device, upon which a domain name of the first target is resolved at the VPN server. A session identification (ID) string for the first request is generated, and the first request and the session ID string are sent from the VPN server to a proxy media server (PMS). A second request for connection to the first target or to a second target, different from the first target is received at the VPN server. The session ID string for the second request is determined or assigned or both, and the second request and the session ID string are sent from the VPN server to the PMS.
US11057343B2
Many hybrid cloud topologies require virtual machines in a public cloud to use a router in a private cloud, even when the virtual machine is transmitting to another virtual machine in the public cloud. Routing data through an enterprise router on the private cloud via the internet is generally inefficient. This problem can be overcome by placing a router within the public cloud that mirrors much of the routing functionality of the enterprise router. A switch configured to intercept address resolution protocol (ARP) request for the enterprise router's address and fabricate a response using the MAC address of the router in the public cloud.
US11057341B2
Systems and methods for reducing fall back from long term evolution voice calls (VoLTE) to legacy systems. The system can include one or more lookup tables including ranges of internet protocol (IP) addresses for a plurality of user equipment (UE). The lookup tables can be stored on one or more network entities, such as on a proxy call session control function (PCSCF). In the event that a policy charging rules function (PCRF) is unable to establish a Gx session with the relevant packet gateway (PGW), the PCSCF can provide the name and/or the IP address for the appropriate PGW to the PCRF. The PCRF can then send a session request AVP to the IP address to cause the PGW to initiate Gx binding. The system enables VoLTE calls to be established despite problems with the PCRF and reduces fallback to legacy systems.
US11057340B2
Disclosed are various embodiments for providing split-tunneled network connectivity on a per-application basis. A request to make a universal datagram protocol (UDP) connection to a remote host specified by an internet protocol (IP) address in the request is received from a network driver. A hostname lookup table is queried to determine a hostname associated with the IP address for the remote host. A policy is identified based on the hostname associated with the IP address for the remote host. Then, the UDP connection is routed based on the policy.
US11057338B2
An electronic communications method includes sending, by a user device, an electronic communication to a device. The electronic communications method further includes receiving, by the user device, an electronic confirmation message. The electronic communications method further includes sending, by the user device, electronic information. The electronic communications message further includes receiving, by the user device, a value. The value is based on electronically analyzing simultaneous electronic information being sent to the device. The electronic communications message further includes receiving, by the user device, an electronic recommendation message. The electronic recommendation message includes a recommended schedule of communications based on the score. The electronic communications method further includes sending, by the user device, an electronic request message based on the value and the electronic recommendation message.
US11057335B2
A computer-implemented method is disclosed for use with a portable electronic device having a display. The method enables switching between electronic inboxes that can be accessed from the electronic device. In some configurations, the method includes, while the device is displaying emails in a first inbox, detecting user selection of a first icon. The method further includes, in response to user selection of the first icon, displaying a set of inbox selection icons; and, in response to user selection of one of the inbox selection icons, displaying emails in a second inbox corresponding to the inbox selection icon selected by the user.
US11057334B2
Message management and classification techniques are described. In one or more implementations, a message received from a sender for delivery via a user account is examined to extract one or more features of the message. A determination is then made as to whether the message corresponds to one or more categories based on the extracted features, the categories usable to enable features to be applied to the message in a user interface.
US11057333B2
Methods, apparatus, systems, and computer-readable media are provided for incorporating application links into message exchange threads. One or more cues emanating from a message exchange thread involving two or more message exchange clients may be detected. The one or more cues may trigger incorporation, into the message exchange thread, of a selectable link to a distinct application. At least one candidate application that is installed on a given client computing device operated by a message exchange thread participant may be identified. The candidate application may be associated with content of the message exchange thread. A selectable link may be incorporated into a transcript of the message exchange thread displayed in a graphical user interface of a message exchange client operating on the given client computing device. The selectable link may be operable by the participant to expose to the participant an interface associated with a respective candidate application.
US11057326B2
A social network activity mode that is implemented using social network activity rules is identified. The social network activity rules allow only social network posts of relevance to a particular activity of a user to be presented to the user. The social network activity mode is applied to a group of social network posts. Based upon applying the social network activity mode to the group of social network posts, social network posts that comply with the social network activity rules of the social network activity mode are provided to the user and social network posts that do not comply with the social network activity rules of the social network activity mode are blocked.
US11057320B2
An improved chat bot operation enables multiple teams to leverage a common bot deployment, rather than requiring each team to build and deploy their own. A context-aware operation identifies a user's context and selects a context file, from among a plurality of context files, to tailor actions and responses. Each team thus has a reduced workload in generating a context file rather than an entire bot deployment. An exemplary method includes: receiving a first chat content from a first chat session; determining a first context for the first chat content; selecting, based at least on the first context, a first context file from a plurality of context files; determining, based at least on the first chat content and the first context file, a first action for the chat bot, wherein determining the first action for the chat bot comprises parsing the first context file; and executing the first action.
US11057311B2
This electronic device for receiving data via an asynchronous communication network including at least one elementary network, is configured to be connected to said elementary network and comprises: a receiving module configured to receive several successive data frames via the asynchronous communication network, each frame being sent over the elementary network according to a predefined sending table and with a minimum time gap between the sending time instants of two successive frames, a verification module configured, for at least two received data frames, to estimate a network jitter from the minimum time gap and reception time instants of at least two frames received on said elementary network, then to compare the estimated jitter to an authorized range of network jitter values.
US11057310B2
A method for data communication between a first node and a second node over a data paths coupling the first node and the second node includes transmitting messages between the first node and the second node over the data paths including transmitting at least some of the messages over a first data path using a first communication protocol, and transmitting at least some of the messages over a second data path using a second communication protocol and determining that the first data path is altering a flow of messages over the first data path due to the messages being transmitted using the first communication protocol, and in response to the determining, adjusting a number of messages sent over the data paths including decreasing a number of the messages transmitted over the first data path and increasing a number of messages transmitted over the second data path.
US11057309B2
Embodiments of the present disclosure provide a management method, and a management device and a system that are based on the method. The method includes: sending, by a second management device, an update request to a first management device, where the update request is used to request the first management device to update requirement information of a subnet managed by the first management device; and then, determining, by the first management device, that the subnet can satisfy the update request, or determining that the subnet cannot satisfy the update request. In the solutions in the embodiments of the present disclosure, the second management device can request the first management device to update the requirement information of the subnet managed by the first management device, thereby preventing a management fault of an entire network slice when a subnet managed by the second management device cannot satisfy a preset requirement.
US11057307B1
Approaches, techniques, and mechanisms are disclosed for assigning paths to network packets. The path assignment techniques utilize path state information and/or other criteria to determine whether to route a packet along a primary candidate path selected for the packet, or one or more alternative candidate paths selected for the packet. According to an embodiment, network traffic is at least partially balanced by redistributing only a portion of the traffic that would have been assigned to a given primary path. Move-eligibility criteria are applied to traffic to determine whether a given packet is eligible for reassignment from a primary path to an alternative path. The move-eligibility criteria determine which portion of the network traffic to move and which portion to allow to proceed as normal. In an embodiment, the criteria and functions used to determine whether a packet is redistributable are adjusted over time based on path state information.
US11057302B2
Methods of sending a packet, NUMA nodes and non-transitory machine-readable storage mediums are provided in examples of the present disclosure. In one aspect, a first NUMA node queries a forwarding table based on a destination IP address of a packet to be forwarded to obtain a plurality of egress interfaces corresponding to the destination IP address; obtain, for each of the plurality of egress interfaces, node information of a second NUMA node to which the egress interface belongs, determining that the egress interface is on the first NUMA node when the node information of the second NUMA node is same as node information of the first NUMA node, wherein the second NUMA node is on the network device; and send the packet via an egress interface which belongs to the first NUMA node and is in the plurality of egress interfaces.
US11057295B1
The problem of looping at the egress of a transport network with a CE multihomed to a protected egress PE and a backup/protector egress PE can be avoided by (a) enabling the protector egress PE to distinguish between fast reroute (FRR) traffic coming from the protected egress PE and normal known unicast (KU) traffic coming from a PE of the transport network that is not attached to the same multihomed segment; (b) receiving, by the protector egress PE, known unicast data, to be forwarded to the CE; (c) determining, by the protector egress PE, that a link between it and the CE is unavailable; and (d) responsive to determining that the link between the protector egress PE and the CE is unavailable, (1) determining whether the known unicast traffic received was sent from the protected egress PE or from another PE of the transport network that is not attached to the same multihomed segment, and (2) responsive to a determination that the known unicast traffic received was sent from the protected egress PE, discarding the known unicast traffic received, and otherwise, responsive to a determination that the known unicast (KU) traffic received was sent from another PE of the transport network that is not attached to the same multihomed segment, sending the known unicast traffic, via a backup tunnel, to an egress PE which protects the protector egress PE.
US11057285B2
Infrastructure management device(s) may monitor IT device(s) communicatively connected over a network. IT device state(s) may be determined for at least one of the IT device(s). Action(s) may be performed on one or more IT device(s), determined at least in part, by the state of the IT device(s).
US11057282B2
Systems and methods are provided for receiving, from a computing device, a selection of a template for a custom microservice and configuration parameters for the custom microservice, generating the template for the custom microservice using the configuration parameters, the template for the custom microservice comprising defined interfaces for accessing core microservices, defined integration points for integration with a system providing the core microservices, and stubs for custom components for the custom microservice, and providing the template for the custom microservice to the computing device, wherein custom components for the custom microservice are added to the template via the computing device using the stubs for the custom components. The systems and methods further provide for registering the custom microservice to be exposed to and accessed by a tenant with authorization to access the custom microservice along with the core microservices.
US11057269B2
Method and system arranged for configuring Intelligent Electronic Device, IED, process bus network switches from a substation specification according to IEC 61850 standard, said method comprising: calculating, from a substation topology file and from control function and substation bay library files, a Substation Specification Description file and substation traffic demand flow files comprising a GOOSE message profile subscription file and a Sampled Values message profile subscription file; generating destination MAC addresses; simulating the process bus communication network using said substation traffic demand flow files and process bus communication network topology, said topology comprising said process bus network switches, respective links and IED links; calculating the shortest path between each publisher IED and each subscriber IED; calculating a switch multicast filtering rule file, for each switch output port, comprising a multicast filter rule that allows the calculated shortest paths; translating the filtering rule file into a file acceptable by the switch.
US11057268B2
Apparatuses and methods enable connecting tunnels channeling data flow from a user terminal and to a mobile network through a virtual switch in a network device which is configured to provide a service by processing data in the data flow. A method performed by a device having one or more processors includes establishing a first tunnel between the device and a node of the mobile network, and a second tunnel between the device and another network device of the mobile network, the first tunnel and the second tunnel operating according to Internet protocols. The method further includes connecting the first tunnel to the second tunnel using a virtual switch running on the device, and connecting a virtual machine running on the device to the virtual switch, the virtual machine being configured to provide a service by processing data in the data flow.
US11057263B2
The current document is directed to methods and systems that efficiently distribute virtual-machine images (“VM images”) among servers within large, distributed-computer-system-implemented IAAS platforms to facilitate temporally and computationally efficient instantiation of virtual machines within the servers. In implementations discussed below, VM images are stored in a distributed fashion throughout one or more distributed computing systems, using several different VM-image-distribution models, in order to balance computational-resource usage, temporal constraints, and other factors and considerations related to VM-image distribution and VM instantiation.
US11057259B2
A master information block (MIB) received by a terminal from a base station includes information associated with a first subcarrier spacing for at least one system information block (SIBx) (x=1, 2, 3, . . . ) and a random access response. The SIBx, received based on the first subcarrier spacing, includes information associated with a second subcarrier spacing for a physical random access channel (PRACH). A random access preamble is transmitted to the base station based on the second subcarrier spacing, and the random access response is received from the base station based on the first subcarrier spacing.
US11057252B2
A transmitting apparatus for a wireless communication system, where the wireless communication system includes an OFDM based waveform corresponding to a plurality of pre-defined subcarrier spacing values including at least a first subcarrier spacing value Δf1 and at least a second subcarrier spacing value Δf2. The transmitting apparatus includes a processor and a transmitter where the processor is configured to generate a signal S1 that is a NSF time repetition of an another signal S2. A duration of the another signal S2 is 1/Δf2, NSF=Δf2/Δf1 is an integer greater than 1, and the transmitter is configured to transmit a symbol comprising S1.
US11057250B2
In order to enable a UE receiving a narrowband signal transmitted using in-band resources to use the LTE reference signals to assist the UE in receiving the narrowband signal using an in-band deployment, a phase rotation employed by the base station may be fixed relative to a known reference position in time. An apparatus for wireless communication at a base station may determine a phase offset for a narrowband signal for transmission using wideband resources, the phase offset having a relationship to a reference point in time and transmit the narrowband signal using the determined phase offset. An apparatus for wireless communication at a UE may receive a narrowband signal having a frequency location within a wideband signal and rotate a symbol of the wideband signal by a per symbol phase offset having a relationship of the phase offset to a reference point in time.
US11057248B2
A baseband system includes: an estimation and compensation circuit estimating frequency-independent non-ideal effects based on an original IQ signal pair, and compensating the original IQ signal pair based on a result of the estimation to obtain a compensated IQ signal pair; a channel estimation and equalization circuit performing channel estimation and equalization based on the compensated IQ signal pair to obtain an equalized IQ signal pair; and a tracking and compensation circuit obtaining a result of tracking of residual quantities of the aforesaid non-ideal effects based on the equalized IQ signal pair, and compensating the equalized IQ signal pair based on the result of the tracking to obtain an output IQ signal pair.
US11057247B2
A transmitting device includes an output node, at least one driver circuit and transition equalization circuitry. The driver circuit drives an output data signal including a data transition onto the output node. The output of the transition equalization circuitry is coupled to the output node. The transition equalization circuitry begins to drive the output node at the data transition and ends driving of the output node a pre-determined delay after beginning to drive the output node. The transition equalization circuitry drives the output node by injecting current onto the output node if the data transition is a positive transition, and sinking current from the output node if the data transition is a negative transition.
US11057245B2
A wireless communication method and a wireless communication device. An electronic device for a first communication device in a wireless communication system includes: storage device configured to store an analog codebook for the first communication device, the analog codebook including a plurality of sets of first configuration parameters for a set of phase shifters of the first communication device; and a processing circuit configured to: perform channel estimation on a first channel from a second communication device to the first communication device respectively based on the plurality of sets of first configuration parameters and signal transmission from the second communication device, select a set of first configuration parameters corresponding to ones of channel estimation results that satisfy a first predetermined condition to generate a reduced analog sub-codebook, configure signal transmission from the first communication device to the second communication device based on the analog sub-codebook.
US11057228B2
The present invention relates to a method for performing wake-up signalling between a host device and a client device of a communication system, said host and said client device being in a two-wire connection (1) with each other and at least one of said host and said client device being in an idle state, said host and said client device each comprising a data controller (3) arranged for data communication control and a power state controller (5) arranged to switch the device between at least an active state and said idle state, whereby the data controller of said at least one of said host and client device is disabled during the idle state. The method comprises—generating in the power state controller of said host or client device a wake-up signal and transmitting said wake-up signal via said two-wire connection to the other device, said other device being in said idle state,—detecting said wake-up signal with said power state controller (5) of said other device and, upon said detecting, setting a control signal to transition said other device out of said idle state.
US11057224B1
A method for performing a physical unclonable function generated by a non-volatile memory write delay difference includes a resetting step, a writing step, a detecting step, a terminating step and a write-back operating step. The resetting step includes resetting two non-volatile memory cells controlled by a bit line and a bit line bar, respectively. The writing step includes performing a write operation on each of the two non-volatile memory cells. The detecting step includes detecting a voltage drop of each of the bit line and the bit line bar, and comparing the voltage drop and a predetermined voltage difference value to generate a comparison flag. The terminating step includes terminating the write operation on one of the two non-volatile memory cells according to the comparison flag. The write-back operating step includes performing a write-back operation on another of the two non-volatile memory cells.
US11057218B2
A token or other storage device uses Internet identities to set file access attribute rights. Subsequently, requests to access a file can be controlled by confirming the Internet identity of the requestor by either validating the request with a known public key or retrieving the public key from an Internet identity provider. Files may be stored encrypted and may be re-encrypted with the public key associated with Internet identity making the request.
US11057215B1
Techniques for performing hash validation are provided. In one technique, a signature request that includes a first hash and a data identifier is received from a client. In response, the data identifier is identified and sent to a data repository, data that is associated with the data identifier is received from the data repository, a second hash is generated based on the data, and a determination is made whether the second hash matches the first hash. If the two hashes match, then the first hash is sent to a cryptographic device that generates a digital signature, which is eventually transmitted to the client. Alternatively, the digital signature is transmitted to the client prior to the first hash being validated. In a related technique, a server receives the signature request and sends the data identifier to a hash validator, which interacts with the data repository and generates the second hash.
US11057214B2
An authentication method using visual cryptography in a smart terminal, including: receiving, from an authentication server, a key image in which a user's individual cryptography string generated by the authentication server is separated; requesting user authentication from the authentication server; after requesting the user authentication, receiving, from a camera, an encrypted image shown on a display device; extracting an encrypted area from the received encrypted image; converting the extracted encrypted area to match with the key image in size and shape and overlaying the encrypted area with the key image pre-stored in the smart terminal; displaying an authentication code shown in an area where the encrypted area is overlaid with the key image and receiving the authentication code to transmit the authentication code to the authentication server; and after transmitting the authentication code, receiving an authentication result from the authentication server to provide the authentication result to the user.
US11057210B1
A user device can segment a secret (e.g., a data recovery key) into a master segment and a shared segment such that possession of both segments is necessary and sufficient to reconstruct the secret. The user device can provide the master segment to a server system. The user device can further segment the shared segment to generate a set of M shares such that any subset of the shares that includes at least a threshold number t of the shares can be used to reconstruct the shared segment, while fewer than t shares provide no information about the shared segment. The M shares can be distributed to shareholder devices. To reconstruct the secret, a recovery device can obtain the master segment and at least t of the M shares, then reconstruct the secret.
US11057202B2
A pulsed light high-speed polarization locking method of a continuous variable quantum key distribution system is disclosed. An integral type optical detector is used for converting energy of a single pulsed light into a peak voltage of an output electric pulse in real time so as to achieve real-time measurement of light pulse energy without conducting high-speed data sampling and simplify the data acquisition and processing. By utilizing the FPGA hardware, a conditional simulated annealing algorithm is quickly operated to search the target polarization state and achieve high-speed polarization locking under the pulsed light. In addition, the power change of a local oscillator is monitored in real time to strengthen the resistance of the system against local oscillator dithering attack. The present invention can effectively solve a problem of rapid fluctuations of polarization state of pulsed light caused by complex external environments.
US11057200B2
An apparatus for enhancing secret key rate exchange over quantum channel in QKD systems includes an emitter system with a quantum emitter and a receiver system with a quantum receiver, wherein both systems are connected by a quantum channel and a service communication channel. User interfaces within the systems allow to define a first quantum channel loss budget based on the distance to be covered between the quantum emitter and the quantum receiver and the infrastructure properties of the quantum channel as well as a second quantum channel loss budget associated to the loss within the realm of the emitter system. The emitter system is adapted to define the optimal mean number of photons of coherent states to be emitted based on the first and the second quantum channel loss budgets.
US11057180B2
A feedback Information sending method and a terminal are disclosed. In an embodiment a method includes receiving, by a terminal device within a first transmission time interval (TTI), a transport block (TB) sent by an access network device, wherein the TB comprises at least two code blocks (CBs), and wherein the at least two CBs comprise a first part of the CBs and a second part of the CBs and sending, by the terminal device, first feedback information and second feedback information to the access network device when the terminal device receives the second part of the CBs within a second TTI and does not receive the first part of the CBs, wherein the first feedback information indicates whether the terminal device correctly decodes the first part of the CBs, wherein the second feedback information indicates whether the terminal device correctly decodes the second part of the CBs, and wherein the second TTI is after the first TTI in a time sequence.
US11057171B2
Aspects of the disclosure provide an apparatus for wireless communication. The apparatus includes a transceiver and a processing circuit. The transceiver is configured to transmit and receive wireless signals. The processing circuit is configured to configure a field within a data unit for buffer information report, determine a first scale factor for scaling a first value indicative of buffered traffic of a first category, and a second scale factor for scaling a second value indicative of buffered traffic of a category, configure the field to include the first scale factor with the first value and the second scale factor with the second value, and provide the data unit to the transceiver for transmitting to another apparatus that allocates resources for transmission between the two apparatuses.
US11057167B2
A method and apparatus may include configuring a split bearer. The split bearer is configured with a first data path between a user equipment and a first network node, and the split bearer is also configured with a second data path between the user equipment and a second network node. The split bearer is configured for a switching operation. The switching operation includes an operation where data transmission is restricted to be towards only one of the first data path and the second data path. The method also includes first transmitting on the split bearer towards the first data path. The method also includes performing the switching operation. The transmitting towards the first data path is switched to transmitting towards the second data path. The method also includes second transmitting on the split bearer towards the second data path.
US11057157B2
An apparatus may comprise a processing resource operatively coupled to a memory resource and a frame determination component operatively coupled to the processing resource and the memory resource. The frame determination component may cause a counter corresponding to a particular station associated to the apparatus to be stored in the memory resource, the counter to be incremented in response to receipt of a transmission frame containing an invalid starting sequence number (SEN) and a deauthentication frame to be transmitted in response to receipt of a threshold number of transmission frames containing the invalid.
US11057153B2
Certain aspects of the present disclosure provide techniques for a multi-user data packet, such as a physical downlink shared channel (PDSCH) packet. A method by a base station (BS) includes sending a control channel, such as physical downlink control channel (PDCCH), scheduling a plurality of user equipment (UEs) for a data packet transmission and sending data for the plurality of UEs in a single transport block on the scheduled data packet. The UE receives the control channel and data packet, and determines the data in the multi-user data packet that is intended for the UE.
US11057140B2
Disclosed are a method for transmitting a signal, a terminal device and a network device. The method comprises: a terminal device determining a time domain position, in a first transmission cycle, of a synchronization signal block burst of a cell where the terminal device is located; and the terminal device receiving, according to the time domain position of the synchronization signal block burst in the first transmission cycle, a synchronization signal block sent by a network device. The method, the terminal device and the network device in the embodiments of the prevent application can reduce the computation complexity of the terminal device, reduce the detection time and save on the power consumption.
US11057135B2
A transmitter includes a memory, and a processor configured to generate a first clock parallel signal by performing serial-parallel conversion of a first clock signal acquired by using a reference clock and generate a second clock parallel signal by performing serial-parallel conversion of a second clock signal acquired by using the reference clock, generate first compressed information by compressing the first clock parallel signal on the basis of clock periodicity and generate second compressed information by compressing the second clock parallel signal based on the clock periodicity, generate a serial signal by adding a synchronization signal indicating a top of a multiplexed signal to the multiplexed signal generated by time-division multiplexing of the first compressed information and the second compressed information, and transmit the serial signal to a receiver.
US11057134B2
A programmable and universal video serving platform enabling brand safe digital ads to be inserted into linear television cable and broadcast programming feeds. A linear programming feed includes a cue message that indicates a spot for ad insertion into the programming feed. Detection of the cue message triggers the generation of a VAST protocol ad request from the video serving platform to a digital ad server, the request including programmable fields that are configured to obtain data to generate standard and custom VAST tag information, including audience impression information and distribution platform information as needed. The digital ad server delivers a VAST response back to the video serving platform identifying a digital ad for insertion, and the video serving platform enables playout of the selected digital ad during the designated insertion spot into the programming feed. This process can be implemented for national cable and broadcast network advertising such that VAST-driven ads can be placed to run on the entire footprint of the cable or broadcast network, or just in a particular geographic market.
US11057133B2
A device for receiving signals captured by a satellite antenna, comprising a front circuit and a digital circuit, the front circuit and the digital circuit being galvanically isolated relative to each other by isolation means, the front circuit comprising a first electric mass, an input port, a universal head power supply component, and an output module of a switched-mode power supply of the universal head power supply component, the digital circuit comprising a second electric ground, an output port, reception components arranged to acquire the input signals, so as to convert them to output signals and to apply the output signals on the output port, an input module of the switched-mode power supply, and a control component arranged to generate control signals intended for the universal head power supply component.
US11057131B2
A method for measuring a Synchronization Signal Block (SSB) by a terminal in a wireless communication system. In particular, the method may include: receiving a cell list including information of at least one first cell, first SSB transmission periodicity information for the at least one cell, and second SSB transmission periodicity information for a second cell that is not included in the cell list; measuring Reference Signal Received Power (RSRP) for an SSB of the at least one first cell based on a first SSB measurement window, which is set up by using the first SSB transmission periodicity information; and measuring RSRP for an SSB of the second cell based on a second SSB measurement window, which is set up by using the second SSB transmission periodicity information.
US11057128B1
A wireless communication device may determine that a channel is to be used to transmit an advertisement. The wireless communication device may determine a channel-specific gain associated with transmitting the advertisement via the channel. The wireless communication device may generate the advertisement to include information identifying a channel identifier of the channel and the channel-specific gain. The wireless communication device may transmit the advertisement for locationing based on a received signal strength indicator (RSSI) of the advertisement.
US11057113B1
One embodiment can provide an optical transceiver based on silicon photonics. The optical transceiver can include an optical transmitter and an optical receiver. The optical transmitter or the optical receiver can include one or more semiconductor optical amplifiers (SOAs) configured to amplify optical signals to be transmitted by the optical transmitter or optical signals received by the optical receiver, respectively, thereby facilitating the optical transceiver to meet an optical power budget requirement of a high-speed optical link.
US11057112B1
The present disclosure is generally directed to a monitor photodiode (MPD) submount for use in optical transceivers that includes a body with a conductive trace pattern disposed on multiple surfaces of the same to allow for vertical mounting of an associated MPD and simplified electrical interconnection with TOSA circuitry without the necessity of electrical interconnection. The MPD submount includes a body defined by a plurality of sidewalls. At least one surface of the body provides a mounting surface for coupling to and supporting an MPD. The MPD submount further includes a conductive trace pattern that provides at least one conductive path that is disposed on the mounting surface and on at least one adjoining sidewall. The portion of the at least one conductive path disposed on the adjoining sidewall extends substantially transverse relative to the surface defining the transceiver/transmitter substrate when the MPD submount is coupled to the same.
US11057108B1
A lighting system employs out-of-band (OOB) commissioning techniques, and includes a plurality of uncommissioned luminaires located in a space and a commissioning device. The commissioning device receives, via a visible light camera, over a VLC communication band, a respective VLC code of a respective uncommissioned luminaire. Commissioning device receives via a radio frequency (RF) transceiver, over an RF commissioning network band, a respective RF identifier of the respective uncommissioned luminaire. In response to receiving the respective VLC code and the respective RF identifier, commissioning device determines whether the respective uncommissioned luminaire is in a candidate luminaire roster of candidate luminaires suitable for commissioning in the space. Based on the determination of whether respective uncommissioned luminaire is in the candidate luminaire roster, commissioning device accepts or rejects commissioning of the respective uncommissioned luminaire in the space.
US11057101B2
An active repeater device includes a primary sector and at least a secondary sector communicatively coupled to the primary sector receives or transmits a first beam of input RF signals having a first beam pattern from or to a base station, respectively. The primary sector includes an baseband signal processor and a first radio head (RH) unit. The secondary sector comprises a second RH unit. The first beam pattern covers a first geographical area. Beamforming coefficients are generated to convert the first beam pattern of the first beam of input RF signals to a second beam pattern. A second beam of output RF signals in the second beam pattern is transmitted from or received by, respectively, the secondary sector to or from, respectively, a plurality of user equipment (UEs) based on the generated beamforming coefficients and the received first beam of input RF signals.
US11057100B2
Technology for a repeater is disclosed. The repeater can include a first multiband filter. The repeater can include a second multiband filter. The repeater can include one or more first-direction signal paths communicatively coupled between the first multiband filter and the second multi-band filter. At least one of the one or more first-direction signal paths can be configured to amplify and filter signals in two or more spectrally adjacent bands. The repeater can include one or more second-direction signal paths communicatively coupled between the first multiband filter and the second multi-band filter. At least one of the one or more second-direction signal paths can be configured to amplify and filter signals in two or more spectrally adjacent bands.
US11057099B2
A communication circuit for communication at a carrier frequency via multiple antenna elements of a radio apparatus is disclosed. The communication circuit comprises a plurality of radio units, wherein each radio unit of said plurality of radio units is arranged to be connected to a separate antenna element. An LO signal generation unit is arranged to generate a plurality of LO signals at distinct frequencies, and supply a unique LO signal of the plurality of LO signals to each radio unit of the plurality of radio units. A corresponding radio apparatus and method are also disclosed.
US11057097B1
Examples described herein provide single and dual radio modes by a network device. Examples may include configuring a network device to communicate with a plurality of client devices using one of a single radio mode and a dual radio mode. Examples may include, based on a relation between a first amount of traffic received by the network device from a first subset of the client devices and a second amount of traffic received by the network device from a second subset of the client devices, reconfiguring the network device to communicate with the plurality of client devices using the other one of the single radio mode and the dual radio mode. Examples may include communicating, by the network device, with the plurality of client devices using the other one of the single radio mode and the dual radio mode.
US11057095B2
Various communication system may benefit from the appropriate selection of communication parameters. For example, certain wireless communication systems may benefit from the user of a low-overhead high-rank codebook. A method can include determining a first partition of a precoding matrix with a higher resolution and a second partition of the precoding matrix with a lower resolution. The method can also include feeding back the first partition and the second partition.
US11057061B2
Apparatuses and methods for simultaneously operating as a wireless radio and monitoring the local frequency spectrum. For example, described herein are wireless radio devices that use a secondary receiver to monitor frequencies within the operating band and prevent or avoid interferers, including in particular half-IF interferers. The systems, devices, and methods described herein may adjust the intermediate frequency in a superheterodyne receiver to select an intermediate frequency that minimizes interference. In particular, described herein are apparatuses and methods that use a second receiver which is independent of the first receiver and may be connected to the same receiving antenna to monitor the geographically local frequency spectrum and may detect spurious interferers, allowing the primary receiver to adjust the intermediate frequency and avoid spurious interferes.
US11057055B2
Wireless communication devices are adapted to employ Golay-based matrices for encoding a wireless transmissions. According to at least one example, a wireless communication device can identify an information vector to be transmitted as a wireless communication. A Golay-based generator matrix may be selected based on a length of the information vector, where the selected Golay-based generator matrix is generated by shortening a Golay generator matrix by removing a plurality of columns of systematic bits and a plurality of rows to obtain the shortened generator matrix, and extending the shortened generator matrix to obtain an extended generator matrix by adding columns to at least the systematic bits and appending rows to obtain a desired matrix size. A respective bit value may be determined for bits in each added column and for at least some of the bits in each appended row. Other aspects, embodiments, and features are also included.
US11057053B2
Systems and methods of communicating using asymmetric polar codes are provided which overcome the codeword length constraints of systems and methods of communicating that use traditional polar codes. Used herein, asymmetric polar codes refers to a polarizing linear block code of any arbitrary length that is constructed by connecting together constituent polar codes of unequal length. Asymmetric polar codes may be known by other names. In comparison to conventional solutions for variable codeword length, asymmetric polar codes may provide more flexibility, improved performance, and/or reduced complexity of decoding, encoding, or code design. The system and method provide a flexible, universal, and well-defined coding scheme and to provide sound bit-error correction performance and low decoding latency (compared with current length-compatible methods which can be used with current hardware designs). For the most part, the provided embodiments can be implemented with nearly all available current encoding/decoding polar code techniques.
US11057049B2
Provided is an encoder, a decoder, a computer-readable medium and methods of forward error correction channel encoding/decoding within a HARQ scheme, based on a generalized quasi-cyclic low-density parity-check code comprising a Cordaro-Wagner component code.
US11057037B2
A touch switch includes a light-pervious plate, a first peripheral frame, a second peripheral frame and an electrical switch module. The light-pervious plate has a predetermined shape. The first peripheral frame corresponds in shape to the light-pervious plate. One side face of the first peripheral frame is coupled to one side face of the light-pervious plate. The second peripheral frame corresponds in shape to of the first peripheral frame. One side face of the second peripheral frame is coupled to another side face of the first peripheral frame. The electrical switch module corresponds in shape to the second peripheral frame. One side face of the electrical switch module is coupled to another side face of the second peripheral frame. The side face of the electrical switch module is provided with at least one light sensitive switch.
