摘要:
The present invention relates to LSD1 inhibitors for use in the treatment and/or prevention of a viral infection caused by and/or associated with RNA viruses, preferably Coronaviridae. The LSD1 inhibitors are able to inhibit or prevent the viral induced increased expression of inflammatory cytokines while sparing the expression of Interferon and Interferon-Stimulated Genes. The present invention further concerns a combination and a pharmaceutical composition including the molecules or combinations thereof.
摘要:
The subject of the present invention is a peptide, natural or synthetic, which comprises an amino acid sequence that has at least 80% sequence identity with the sequence SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYKCP-VAQLE (SEQ ID NO: 1). A further object of the present invention is said peptide which has at least 80% sequence identity with the sequence SEQ ID NO: 1 which is a JNK3 inhibitor for use in the prevention and / or treatment of neurodegenerative or neurodevel-opmental diseases.
摘要:
The present invention relates to compositions for elastomeric compounds for tyres, comprising polytetrazole cross-linking compounds characterized by precise activation temperatures, tyre components and tyres for vehicle wheels which comprise them. Advantageously, the present polytetrazole cross-linking agents give lower hysteresis and retention of the modulus of the compounds even under stress.
摘要:
A sensitized composite scintillator which optionally interacts with ionizing radiation is provided having a vitreous or plastic matrix in which there are incorporated perovskite nanostructures which sensitize light emitters.
摘要:
A device for measuring an angular inclination and angular inclination fluctuations of an electromagnetic radiation beam is adapted to detect the incidence angular inclination and the relative fluctuations with respect to a nominal axis of propagation of the beam, in a desired detection plane including the nominal propagation axis. A system and a method for measuring an angular inclination and angular inclination fluctuations of an electromagnetic radiation beam uses the device for measuring an angular inclination and angular inclination fluctuations of an electromagnetic radiation beam. A method measures a spatial shift of a focused laser beam, at the focusing point, with respect to a reference optical axis.
摘要:
It is described a method for realizing catalytically active electrochemical electrodes with maximized surface area. In the method, InGaN is deposited epitaxially in form of a thin layer on a Silicon substrate exposing a (111) crstal fac, thus forcing the InGaN electrode material to grow exposing a catalytically active surface. The substrate is then removed, the InGaN layer is made into fragments and these are transferred onto a conductive support with one-, two- or three-dimensional structure which can be a wire, a two-dimensional conductive foil which, possibly folded, or a three-dimensional conductive fabric, sponge or cage-like structure. It is thus possible to obtain an InGaN-based electrode with increased surface area and exposing surfaces with high catalytic activity.
摘要:
The present invention relates to a compound having formula (I) below or a pharmaceutically acceptable salt thereof: wherein:X is —COOH or NH2;R is a straight or branched C1-C10 alkylene chain; andR1 is H, straight or branched C1-C10 alkyl, aryl, or R2CO— wherein R2 is straight or branched C1-C10 alkyl, for use as antitumoral agents.
摘要:
The present invention relates to linear or branched polyamides obtainable by polymerisation of a mixture containing a bifunctional monomer of type AB and/or a monomer mixture of type AA+BB in the presence of: a) one or more molecules, having one or more carboxyl and/or amino functional groups, selected from carboxylic acids or an ester or an anhydride thereof, and/or amines and/or polyhedral oligosilsequioxanes (POSS); and b) one or more phosphorus containing molecules, reactive with only one reactive group during polymerization, containing at least a —POOH group and/or a salt thereof; and c) one or more metal hydroxides and/or metal salts, wherein the metal belongs to groups from 1 to 14 of the Periodic Table; provided that when the phosphorus containing molecules, as defined under b), contain the —POOH groups in salified form with a metal as defined under c), then the presence of the metal hydroxides and/or metal salts, as defined under c) is optional.
摘要:
The present invention relates to novel molecules suitable to the use in the separation/removal of carbon dioxide from gaseous mixtures as liquid-phase carbon dioxide absorbers and suitable to allow the subsequent release of the absorbed carbon dioxide in form of different ionic liquids, preferentially a glycine salt with choline hexanoate, ester between glycine and hexanoic alcohol (hexyl glycinate) and glycerol ester with glycine and hexanoic acid. The present invention also relates to a method and a plant for the capture of carbon dioxide from gaseous mixtures by using an absorber for carbon dioxide in liquid phase with a heating jacket.
摘要:
The present invention relates to inhibitors of the oncogenic protein kinase ALK of formula (I) as herein described and pharmaceutical compositions thereof, as well as to key intermediates towards their synthesis. The compounds of formula (I) are useful in the preparation of a medicament, in particular for the treatment of cancer.