US09085527B2
The invention relates to fatty acid acylated salicylate derivatives; compositions comprising an effective amount of a fatty acid acylated salicylate derivative; and methods for treating or preventing an inflammatory disorder comprising the administration of an effective amount of a fatty acid acylated salicylate derivative.
US09085524B2
The present invention concerns a method for the production of carboxylic acid esters containing the steps: a. Supplying of a component containing carboxylic acid and an alcohol; b. Bringing the component containing carboxylic acid in contact with the alcohol in a container for a conversion to carboxylic acid esters by means of esterification or transesterification, characterized in that the container is moved over a distance of at least 1 kilometer during the esterification or the transesterification. The present invention also concerns the use of a ship.
US09085519B2
There is provided a process for the preparation of a compound of formula I, wherein X, R1, R2a, R2b, R2c, R2d, R2e, R3a, R3b, R3c, R3d and R3e are as described in the description. Such compounds may, for example, be useful medicament (or intermediates for medicaments).
US09085516B2
The invention relates to the chemistry of fragrances and to the field of perfumery. It relates more particularly to compounds with a woody note, responding to the general formula: in which: the ring with 6 carbon atoms is saturated or has a double bond between carbons C1 and C2 or between carbons C1 and C6, R is selected from a C2-C5 alkyl or C2-C5 alkenyl group.
US09085514B2
The present invention relates to unnatural amino acids comprising a cyclooctynyl or trans-cyclooctenyl analog group and having formula (I) or an acid or base addition salt thereof. The invention also relates to the use of said unnatural amino acids, kits and processes for preparation of polypeptides that comprise one or more than one cyclooctynyl or trans-cyclooctenyl analog group. These polypeptides can be covalently modified by in vitro or in vivo reaction with compounds comprising an azide, nitrile oxide, nitrone, diazocarbonyl or 1,2,4,5-tetrazine group.
US09085511B2
This invention related to atropisomeric 1,8-bisphenolnaphthalenes and derivatives thereof of the general formula (I): which are useful in resolution of enantiomers, enantioselective recognition and asymmetric synthesis.
US09085507B2
The invention concerns desfesoterodine in the form of a tartaric acid salt, in particular in the polymorphic “R form”, as well as a process for its production. In a second aspect, the invention concerns the desfesoterodine of the invention in a microencapsulated form.
US09085506B2
The invention relates to an improved process for preparing 3-aminomethyl-3,5,5-trimethylcyclohexylamine, referred to hereinafter as isophoronediamine or, in abbreviated form, IPDA, by: I. preparation of isophorone by catalyzed aldol condensations with acetone as reactant; II. reaction of isophorone with HCN to form isophoronenitrile (IPN, 3-cyano-3,5,5-trimethylcyclohexanone); III. catalytic hydrogenation and/or catalytic reductive amination (also referred to as aminative hydrogenation) of 3-cyano-3,5,5-trimethylcyclohexanone, hereinafter called isophoronenitrile or, in abbreviated form, IPN, to give the isophoronediamine.
US09085499B2
The present process comprises a means for energy savings in one or more process pumps by driving the one or more pumps with a variable-speed driving means. The invention is particularly useful in the separation of an adsorbed product from a mixture of components using simulated-moving-bed adsorption associated with a large circulating stream pumped with variable-speed driving means for conservation of energy relative to the known art. The improvement is particularly applicable to a process for the separation of para-xylene from mixed C8 aromatics.
US09085496B2
An organic composition for use as ground covering capable of supporting plant life is presented. The organic composition is a mixture of filtration waste and topsoil, dirt, manure, wood chips, leaves, and/or sand. The filtration waste further includes carbon, diatomaceous earth, and sugar removed from filtering equipment after the refinement of raw sugar. In some embodiments, the filtration waste promotes the proliferation of organisms which decompose wood chips, leaves, and/or manure. The organic composition is applicable as a material applied within an area at a thickness which allows new plant growth, as an additive onto the surface of an area to promote plate growth, or as a component for mixture with soil as a soil supplement to promote plant growth.
US09085494B2
This invention provides processes and apparatus to convert biomass, including wood and agricultural residues, into low-ash biomass pellets for combustion, alone or in combination with another solid fuel. Some embodiments provide processes for producing low-ash biomass from cellulosic biomass, comprising providing an aqueous extraction solution with acetic acid; extracting the feedstock to produce an extract liquor containing soluble ash, hemicellulosic oligomers, acetic acid, dissolved lignin, and cellulose-rich solids; dewatering and drying the cellulose-rich, lignin-rich solids to produce a low-ash biomass; hydrolyzing the hemicellulosic oligomers to produce hemicellulosic sugars, wherein additional acetic acid is generated; removing a vapor stream comprising vaporized acetic acid from the extract; and recycling the vapor or its condensate to provide some starting acetic acid for the extraction solution. The disclosed processes can produce clean power from biomass. Co-products may include fermentable sugars, fermentation products such as ethanol, fertilizers, and lignin.
US09085493B2
Produced is a silicon carbide-coated carbon base material in which a silicon carbide coating is densely and uniformly formed on the surface of a carbon base material, such as graphite. A production process includes the steps of: preparing a carbon base material the surface of which has basal plane sites of an SP2 carbon structure with no dangling bond and edge plane sites of an SP2 carbon structure with a dangling bond; and reacting the surface of the carbon base material with SiO gas in an atmosphere at a temperature of 1400° C. to 1600° C. and a pressure of 1 to 150 Pa to form silicon carbide, whereby the carbon base material coated with silicon carbide is produced.
US09085487B2
The present invention describes a chemical vapor-phase deposition for carbon nanotube synthesis in which cement clinker is used as a ceramic matrix for anchoring transition-metal nanoparticles. Using cement clinker as nanoparticle anchoring base of transition metals allows carbon nanotubes to be generated on cement clinker particles and grains, in this way producing a kind of cement that is nanostructured with carbon nanotubes. By this process, the carbon nanotube synthesis and integration to clinker are carried out in just one continuous and large-scale stage. The process described herein can be applied to conventional cement industry whose production may be rated as tons per day. The present invention also proposes—as part of the carbon nanotube synthesis on cement clinker—several enrichment alternatives of cement clinker by using transition metals for producing such nanostructured composite, which may or not be integrated to the conventional cement industry.
US09085484B2
A glass article including: at least one anti-glare surface having haze, distinctness-of-image, surface roughness, and uniformity properties, as defined herein. A method of making the glass article includes, for example, depositing sacrificial particles on a surface of the article; and contacting the resulting particulated surface with an etchant. A display system that incorporates the glass article, as defined herein, is also disclosed.
US09085480B2
There is provided a method of manufacturing a vitreous silica crucible having a suitably controlled inner surface property. The present invention provides a method of manufacturing a vitreous silica crucible by heating and fusing a silica powder layer in a rotating mold by arc discharge generated by carbon electrodes including: a preparation process for determining optimal fusing temperatures during heating and fusing the silica powder layer at plural points of different heights of the silica powder layer; a temperature measuring process for measuring actual temperatures during heating and fusing the silica powder layer at the plural points; a temperature controlling process for controlling the actual temperatures at the plural points so that the actual temperatures matches the optimal fusing temperatures at the respective points.
US09085479B2
The present invention provides a method for efficiently manufacturing a glass substrate for magnetic disk having good accuracy of a surface irregularity and an impact resistance. The method includes the steps of: performing press forming to molten glass to prepare a sheet glass material, the sheet glass material having a roughness of the principal surface of 0.01 μm or less and target flatness of a glass substrate for magnetic disk; chemically strengthening the sheet glass material by dipping the sheet glass material in a chemically strengthening salt, thereby preparing a disk substrate; polishing the principal surfaces of the disk substrate. A thickness of the sheet glass material prepared in the press forming step is larger than a target thickness of the glass substrate for magnetic disk by a polishing quantity of the principal surface polishing step.
US09085477B2
A method of reducing a sulfate concentration in wastewater comprises directing the wastewater stream to a precipitation reactor and mixing the wastewater stream with a calcium source and a calcium salt seed material to precipitate calcium sulfate. The precipitated calcium sulfate is then separated from a treated effluent and directed to a settling tank where the precipitated calcium sulfate is separated into heavier calcium sulfate precipitants and lighter calcium sulfate precipitants. The heavier calcium sulfate precipitants and the lighter calcium sulfate precipitants are separately recirculated to the precipitation reactor. A predetermined mass ratio of solids is maintained in the precipitation reactor.
US09085476B2
Liquid membrane systems are provided for use in pervaporation techniques that achieves high selectivity, ensure stability and prevent contamination of the fermentation broth. Tri-n-octylamine (TOA), tri-laurlyamine or tri-decylamine as a liquid membrane is immobilized in the pores of a hydrophobic hollow fiber substrate having a nanoporous hydrophobic coating on the broth side. The liquid membrane in the coated hollow fibers demonstrate high selectivity and reasonable mass fluxes of solvents in pervaporation. The mass fluxes were substantially increased with the same selectivity of solvents when an ultrathin liquid membrane was used. The addition of butanol into the feed solution increases membrane selectivity.
US09085467B2
The present invention relates to a process for the preparation of materials with nanometric dimensions and controlled shape, based on titanium dioxide. The invention also relates to a process for the preparation of titanium dioxide nanorods and nanocubes with anatase phase composition, which are highly suitable for photocatalytic use, in particular for applications involving photovoltaic cells, for example Dye Sensitized Solar Cells (DSSC), photoelectrolysis cells and tandem cells for the conversion of solar energy and the production of hydrogen.
US09085463B2
Provided herein are water-soluble, functionalized fullerenes, and processes for producing water-soluble, functionalized fullerenes. The process includes sulfonating a fullerene in an acidic solution comprising sulfuric acid to produce a sulfonated fullerene, isolating the sulfonated fullerene from the acidic solution without neutralizing the acidic solution, reacting the sulfonated fullerene with hydrogen peroxide to form a reaction product, and isolating a polyhydroxylated fullerene from the reaction product produced from reacting the sulfonated fullerene with the hydrogen peroxide. The process of producing water-soluble fullerenes further includes functionalizing a polyhydroxylated fullerene with one or more pendant functional groups by reacting the polyhydroxylated fullerene with one or more functional group precursors.
US09085452B2
A carbonated water manufacturing device, including a sleeve and a bottle cap which are mutually independent, wherein the sleeve includes a sleeve body and a plug body inside the sleeve; the sleeve body and the plug body are provided with a first through-hole and a second through-hole at their side surfaces, respectively; the bottle cap is provided with a perforated through-hole whose bottom is connected with an injection tube; the upper part of the bottle cap is fittingly connected with the lower part of the plug part; the opening at the lower part of the sleeve body is fittingly connected with the lower part of the outer edge of the bottle cap, and the top of the sleeve body acts on the carbon dioxide housing body in the sleeve body; the connection of the lower part of the bottle cap and the injection tube is provided with a check valve.
US09085448B2
A crimping device for crimping a cap around a flange of a container is provided. The crimping device comprises a disc having a first disc member and a second disc member adjacent the first disc member, wherein the second disc member extends outwardly beyond the first disc member and has a hardness lesser than that of the container and a motion device for producing a relative movement between the disc and the flange of the container so as to effect crimping of the cap around the flange.
US09085446B1
The pivotable auto lift is an improvement over post-based auto lifts, and includes an adaptor that engages onto an in-ground receiver such that the adaptor rotates thereon. A first post connects with a pivot adaptor to rotate about an in-ground receiver, whereas a second post connects to a cross-brace spanning between the first post and second post. The first post, the cross-brace, and the second post collectively rotate about a central axis of the first post, and are able to rotate a full 360 degrees. Both the first post and the second post include auto lifting members thereon. The auto lifting members each engage underneath of a vehicle, and from a particular side. The in-ground receiver is rigidly secured to the floor and sub-floor such that the pivot adaptor rests thereon, and is incapable of separating when fitted thereon.
US09085443B2
The invention relates to a locking system for a telescopic crane jib, in particular for a mobile crane, in which a lock is established between a telescoping cylinder (10, 20) and a telescopic part (1-4) by means of a locking unit (21) in order to extract and retract the telescopic parts, and the locking unit (21) is disposed on the telescoping cylinder (10, 20) in such a way that it can be moved longitudinally.
US09085439B2
A spindle (10) suitable for winding up coreless rolls (11) of a stretchable plastic film; the spindle (10) comprises a tubular body having a peripheral wall (12) defining at least one internal chamber (14) connectable to a pressurized air source. A plurality of perforations (17) extends from the internal chamber (14) of the spindle (10), through the peripheral wall (12) and a protective layer (19) of hard chrome having a sandblasted outer surface (18) with an average roughness ranging between 6 and 6.5 μm, obtained by dry sandblasting.
US09085438B2
A tissue roll holder includes an interior ventilated chamber holding potpourri or other scented products, a spring-loaded spindle and spacers for holding the interior surface of a tissue roll spaced apart from the chamber.
US09085436B2
A sheet ejecting device includes: a sheet ejecting unit configured to eject a sheet; a stacking unit on which the sheet that is ejected by the ejecting unit is stacked; an aligning unit configured to align the sheet in a direction orthogonal to the direction in which the sheet is ejected; and a blowing unit configured to be provided to the aligning unit and blow a wind toward the ejected sheet.
US09085432B2
A medium overlapped-feed preventing may include a feed roller which is structured to abut with the information recording medium and carry the information recording medium; a separation roller oppositely disposed to the feed roller and is urged toward the feed roller and is rotated in the same direction as the feed roller for separating overlapped information recording media which are carried in an overlapped-feed state; and a gate mechanism provided with a gate part through which one piece of the information recording medium is capable of being passed but two pieces of the information recording medium in an overlapped state are unable to be passed. The gate part may disposed on a downstream side in a sending-out direction of the information recording medium with respect to an imaginary line which is formed by connecting a rotation center of the feed roller with a rotation center of the separation roller.
US09085429B1
An intermittent feeding mechanism applied in the automatic document feeder (ADF) of a business machine. By design of integrating components, manufacturing costs and assembly work can be reduced efficiently, thus associated costs can be further reduced. Besides, the built-in design of the present disclosure can reduce the installation space and facilitate the miniaturization of a business machine.
US09085423B2
A device for feeding a book block, which is formed of at least one printed sheet and transported flat, to a processing station in a clocked manner includes a first and a second transport device. The first transport device has a comb-shaped introduction flap and transport units. The introduction flap includes teeth disposed on a base part and recesses formed between the teeth. The second transport device has a transport duct and a transport finger. The transport duct has a contact surface, a clearance and a gap. The first transport device engages, by the introduction flap, in the clearance. The recesses are open in a direction facing away from the transport duct. The transport units are disposed on a first side of the introduction flap. The introduction flap is connected to a controllable drive and has a pivot axis disposed on a second side of the introduction flap.
US09085419B2
A removable cartridge cleaner assembly is provided that has an insertion device for ease in installing an elongate cartridge assembly carrying belt cleaner assemblies onto an elongate support extending across a conveyor belt in an operative position thereon. In one form, an elongate lever handle pivotally connected to the elongate cartridge assembly can be used to generate a leveraged insertion force, preferably by an operator that does not need to reach into the operating envelope of the conveyor system, e.g. beyond tensioning mechanisms or under the belt. The handle and the cartridge assembly can have an over-center locking mechanism therebetween for providing the operator tactile feedback as to when pivoting of the lever handle has caused the cartridge assembly to be shifted to its operative position on the support.
US09085416B2
An apparatus includes a cable track configured to be coupled to a moveable object and to be pushed and pulled by the movable object without buckling. The cable track is configured to transport at least one signal or material to or from the moveable object. The cable track has a fluid compartment defined between walls of the cable track. The walls of the cable track are configured to be separated when fluid is inserted into the fluid compartment and to approach one another in a bent portion of the cable track. The cable track may further include a web coupled to the walls, where the web is configured to limit the separation of the walls.
US09085409B2
A dispensing head for a tube with a housing having a receiving chamber an outlet fitting of the tube an outlet opening, and an interior space surrounded by walls of the housing. An annular wall section of the housing separates the receiving chamber from an annular area of the interior space of the housing, an outlet valve is provided in the interior space, the outlet valve having a valve body, a valve seat and a pressure chamber designed so that the valve body and the valve seat are movable from a closed position to an open position by pressurization of the medium contained in the pressure chamber in order to allow discharge of the medium through the discharge opening. A medium path is provided within the housing, which connects an inlet opening to the pressure chamber.
US09085398B1
Disclosed herein are food pouch containers comprising a back portion having an interior cavity; a front portion; a top hole; and a surface dividing the back portion into an upper cavity, inside the back portion, and a lower cavity. In some embodiments, the lower cavity is inside the back portion, while in other embodiments, the lower cavity is an exterior cavity. Also disclosed are food pouch containers comprising a back portion having an interior cavity; a front portion; a top hole; means for contouring the food pouch from a bottom thereof; and means for contouring the food pouch from at least a side thereof.
US09085397B2
The present invention provides an assembly for introducing a dose of a mixing substance into a container, said assembly comprising a dosing part (3) and a supply part (2), which dosing part is arranged for receiving the dose and which supply part comprises an outlet (14) for introducing the dose into the container. The dosing part and the supply part are configured to cooperate with one another, such that a pressure chamber having a changeable volume is formed adjacent to the outlet when the supply part and the dosing part are joined together, which pressure chamber functions to enable a pumping action for pumping the dose into and out of the container. The invention further provides a method for inserting such a dose into a container.
US09085394B2
The present invention is directed toward an improved elastic drawstring for use with a trash bag. The elastic drawstring is comprised primarily of a two-component polyethylene blend. The first polyethylene component is a linear low-density polyethylene (LLDPE) having a density of 0.915 g/cc or less, with a preferred range of between 0.900 g/cc and 0.915 g/cc. In certain preferred embodiments, the density of the first polyethylene component is approximately 0.906 g/cc. The second polyethylene component is a low-density polyethylene (LDPE) having a density of between 0.915 g/cc and 0.929 g/cc. In a preferred embodiment, the second polyethylene component has a density of approximately 0.918 g/cc.
US09085393B2
A connecting portion is provided between a first thick portion and a second thick portion in a cutting portion. Further, a thinnest portion on which a stress can be concentrated is provided to the connecting portion. Accordingly, when tearing a base material film of a bag body, the connecting portion can guide a cutting line toward the thinnest portion to position the cutting line in the thinnest portion, so that the bag body can be easily opened.
US09085387B2
The present invention relates to a bottle which is formed of a synthetic resin material into a cylindrical shape with a bottom. A bottom wall portion of a bottom of the bottle includes: a ground contact portion; a rising peripheral wall portion; a ring-shaped movable wall portion; and a depressed peripheral wall portion. The movable wall portion is rotatably disposed about a connecting part with the rising peripheral wall portion so as to move the depressed peripheral wall portion upward, and a concave and convex portion is formed over an entire circumference of the rising peripheral wall portion.
US09085385B1
A box includes a front connected to two front attachment panels, a back connected to two back attachment panels, first and second sides, a bottom, a first top panel connected to the front having flanges on opposite sides, each of the flanges being respectively connected to one of the front attachment panels, and a second top panel having flanges on opposite sides, each of the flanges being respectively connected to one of the back attachment panels. One of the top panels includes a tab and the other does not; the flanges of the top panel that includes the tab extend to the outer edge of such top panel; the flanges of the other do not extend to the outer edge of such top panel; and the flanges and tab are configured to lock the top panels in a closed configuration.
US09085380B2
An apparatus for filling containers with pharmaceutical articles comprises a transfer element (1) arranged to receive articles from a conveyor (V) and to transfer them to a mouth (I) of an article accumulating conduit (C) positioned above a container. A sensor (8, 9) detects article characteristics and counts the articles. A mobile element (2) has a first curved surface (21) and a second curved surface (22), the element being movable between a first orientation (P1), in which the first curved surface enables an advancement of articles detected as being whole towards the mouth (I) of the accumulating conduit (C), and a second orientation (P2), with the second curved surface (22) arranged to prevent a continuity of advancement for the articles detected as not being whole, diverting these away from the mouth of the accumulating conduit (C).
US09085376B2
A force modulating apparatus for minimizing and/or blocking forces such as the Coriolis force, gravitational, and centrifugal force, simulating the environment of the cosmos. A stabilizing method for material with respect to light and the structure of atoms.
US09085373B2
Aerospace ground maneuver light, comprises a reflector (14), the reflector (14) defining a light exit plane (18), an LED light source (26) arranged outside of the area defined by the reflector (14) and its light exit plane (18), and a mounting bar (22) which has a longitudinal extension and at which the LED light source (26) is mounted. The mounting bar (22) extends across the reflector (14) and is spaced apart from the light exit plane (18) of the reflector (14) and comprises a mounting side (24) facing towards the reflector (14) and its light exit plane (18), with the LED light source (26) arranged on the mounting side (24) for emitting light towards the reflector (14).
US09085372B2
The aircraft includes at least one engine having contra-rotating rotors, the engine or at least one of the engines having imbalances associated with at least one ellipse. The aircraft includes a means capable of controlling the engine or at least one of the engines such that, at a given engine speed, the large axis of the ellipse or at least one of the ellipses extends in a direction for which the vibrations generated by the engine or engines have a minimum intensity in at least one predetermined site, particularly in a predetermined area, of the aircraft.
US09085369B2
An aircraft nacelle includes a cowling, an engine housed in an internal volume of the cowling, and at least one thrust reverser, an air passage duct being formed between an internal wall of the cowling and an external wall of the engine. The cowling includes a fixed cowling part and a moving cowling part that is translationally movable between a plurality of positions, at least one of the positions varying an air flow through the duct. The moving cowling part includes the at least one thrust reverser so that translational movement of the moving cowling part also allows the moving cowling part to switch from a position in which the at least one thrust reverser is retracted into a reverse-thrust position in which a bypass flow is deflected to generate a reverse thrust.
US09085365B2
A ventilation system for ventilation of an aircraft area includes a ram-air duct with an air inlet, a first ram-air duct branch and a second ram-air duct branch parallel to the first ram-air duct branch. A supply line connected to the ram-air duct is adapted to supply air flowing through the ram-air duct to the aircraft area to be ventilated. In the first ram-air duct branch a conveying device is arranged. In the second ram-air duct branch a heat exchanger of an aircraft system to be supplied with cooling energy is arranged. The ventilation system provides ventilation to the aircraft area during ground operation without requiring the conveying device to flow air through the heat exchanger.
US09085362B1
A deployable net capture apparatus which is mounted on an unmanned aerial vehicle to enable the interception and entanglement of a threat unmanned aerial vehicle. The deployable net capture apparatus includes a deployable net having a cross-sectional area sized for intercepting and entangling the threat unmanned aerial vehicle, and a deployment mechanism capable of being mounted to the unmanned aerial vehicle. The deployment mechanism includes an inflatable frame or a rod for positioning the net in a deployed position.
US09085356B2
A method of minimizing the consequences of an off-specification landing for the occupants of an aircraft (1) having a rotary wing (10) and a fuselage (7) extending along a longitudinal anteroposterior plane of symmetry (4) between a first side (5) and a second side (6) of said aircraft (1), said aircraft having landing gear provided with at least first contact means (21) connected by a first fastener device (30) to the fuselage and at least second contact means (22) connected by a second fastener device (50) to the fuselage, the first contact means and the first fastener device being arranged on said first side (5), the second contact means and the second fastener device being arranged on said second side (6). The fastener elements of said first and second fastener devices (30, 50) are then dimensioned differently.
US09085345B2
A water vessel is provided. The water vessel includes a hull, a deck, and a ramp. The hull has a front end, an aft end, a starboard side, a port side, a bottom, a bow at the front end, and a stern at the aft end. The bow is movable between a closed configuration and an open configuration. The deck is in the region of the bow. The ramp is located between the bottom of the hull and the deck in a retracted position. When the bow is in the open configuration, the ramp is movable to an extended position in which the ramp extends from the front end of the hull.
US09085336B2
A bicycle operating device basically has a fixed member, a movable member, a positioning mechanism, a first pivoting member and a second pivoting member. The positioning mechanism is operatively arranged to selectively maintain the movable member in any one of a plurality of holding positions. The first pivoting member is pivotally mounted with respect to the fixed member to pivot about a first axis to operatively engage the positioning mechanism. The second pivoting member is pivotally mounted with respect to the fixed member to pivot about a second axis that is offset from the first axis. The second pivoting member includes first and second contacting parts for selectively contacting the first pivoting member at different radial positions causing the first pivoting member to pivot in response to pivotally movement of the second pivoting member.
US09085329B2
Disclosed is an automotive rear vehicle body structure comprising: a rear subframe (21) having right and left side member segments (22), and a cross member segment (23) coupling the side member segments (22) together; and a rear suspension supported by the rear subframe (21). The cross member portion (23) has right and left lateral portions (23S) each composed a pipe-like shaped member extending vehicle-widthwise inwardly and downwardly from each of the right and left side member segments (22), and a central portion (23C) composed of a pipe-like shaped member coupling the lateral portions (23S) together. The central portion (23C) is disposed at a height position below a vertically middle position between an upper-arm support section (28) and a lower-arm support section (29).
US09085326B2
A pillar covering for motor vehicles is described The pillar covering has a carrier part having an integrated window guide web and a mounting element, a narrowing at the point of contact of the window guide web with the carrier part, and a cover part connected to the carrier part via a contact surface, whereby the carrier part and the cover part form at least one common end portion and the contact surface within the end piece runs over a length of at least 1 mm at a mean angle of 5° to 60° above or below a mean axis along the contact surface outside the end piece.
US09085316B2
A learning function is configured to determine a plurality of piecewise linear function coefficients based on measured data for an electric power-assisted steering (EPS) system. The measured data include a vehicle speed. The learning function is further configured to model a hysteresis loop of the EPS system using a piecewise linear function based on the plurality of piecewise linear function coefficients to determine an average friction. An average friction change compensator is configured to adjust friction-based EPS system compensation based on the average friction for a plurality of vehicle speed intervals of the vehicle speed.
US09085309B2
A parking brake for a railway vehicle includes a pneumatic cylinder having a cylinder wall, a first wall opposite a second wall, and a piston movable within the pneumatic cylinder. At least one spring extends between the piston and the second wall for biasing the piston against the first wall. A gear box is fixed relative to the second wall and includes a hand wheel. A spindle is operatively connected to the gear box to affect movement of a manual reset mechanism having a threaded shaft and a ball screw nut rotatably engaged with the threaded shaft. A pushrod is connected to the manual reset mechanism and extends through the cylinder and the first wall. When the hand wheel is rotated, the manual reset mechanism is rotated to cause the pushrod to move relative to the piston corresponding to the direction of the rotation of the hand wheel.
US09085302B2
A modular robotic vehicle includes a chassis, driver input devices, an energy storage system (ESS), a power electronics module (PEM), modular electronic assemblies (eModules) connected to the ESS via the PEM, one or more master controllers, and various embedded controllers. Each eModule includes a drive wheel containing a propulsion-braking module, and a housing containing propulsion and braking control assemblies with respective embedded propulsion and brake controllers, and a mounting bracket covering a steering control assembly with embedded steering controllers. The master controller, which is in communication with each eModule and with the driver input devices, communicates with and independently controls each eModule, by-wire, via the embedded controllers to establish a desired operating mode. Modes may include a two-wheel, four-wheel, diamond, and omni-directional steering modes as well as a park mode. A bumper may enable docking with another vehicle, with shared control over the eModules of the vehicles.
US09085297B2
To improve the drivability of a driver while performing an output restriction. A hybrid vehicle has an output restriction control unit that releases or restores an output restriction in accordance with a predetermined operation by the driver, and a predetermined release rate or a predetermined restoration rate can be set for the release or the restoration of the output restriction.
US09085296B2
A hybrid vehicle which runs on power from at least one of an electric motor and an engine includes a transmission ratio changing unit for changing a ratio of electrical transmission to mechanical transmission of an output of the engine, an engaging/disengaging control unit for releasing a clutch when the hybrid vehicle is shifted from a drive mode in which at least the engine works as a drive source to a series drive mode, and a required output calculation unit for calculating a required output based on an accelerator pedal opening and a running speed. When the required output exceeds a sum of an output of the electric motor which is driven by electric power supplied from the battery and the output of the engine while the hybrid vehicle is running on the drive mode in which at least the engine works as a drive source with the clutch engaged, the transmission ratio changing unit increases the ratio of electrical transmission to mechanical transmission of the output of the engine, and the engaging/disengaging control unit releases the clutch at a time point when the mechanically-transmitted output of the engine becomes 0, with the clutch engaged. Consequently, when the hybrid vehicle is shifted from the drive mode in which at least the engine works as a drive source to the series drive mode in which the electric motor works as a drive source, the power transmission engaging/disengaging unit can be released while satisfying the required output.
US09085290B2
A hovercraft without lift fan includes: a hull; and a power device; wherein the hull includes: a main body; and two sub-bodies; wherein bottom surfaces of the sub-bodies are lower than a bottom surface of the main body, the two sub-bodies are symmetrically aligned under a front portion of the bottom surface of the main body, the two sub-bodies are provided with a distance therebetween; an outer surface of the sub-body and an outer surface of the main body form an aligned side surface or an unified side surface; the aligned side surface or the unified side surface extends towards a space under the bottom surfaces of the main body and the sub-bodies for forming a main sidewall; an inner side surface of the sub-body extends towards a space under the bottom surface of the sub-body for forming a sub-sidewall.
US09085289B2
A method for operating an electrically controllable brake system for a motor vehicle having at least one electrically actuated valve arrangement for setting a pressure difference between a second brake pressure and a first brake pressure, wherein in a first time interval a predetermined first pressure difference is set and an associated first power consumption value of the pump is identified; in a second time interval a predetermined second pressure difference is set and an associated second power consumption value of the pump is identified; a correction value is obtained from the first power consumption value and the second power consumption value; the correction value is taken into account for setting a set-point value for the pressure difference.
US09085281B2
A remote keyless entry system includes a portable communication device for communicating with an electronic control module of a transportation vehicle. The transmitter has at least two selectable communication channels for broadcasting communications signals to the transportation vehicle. A vehicle based electronic control module communicates with the portable communication device. The electronic control module includes a receiver that includes at least two selectable communication channels for receiving RF signals from the portable communication device. A controller selectively energizes the receiver for measuring a RSSI voltage level of each selectable communication channel of the receiver over respective predetermined time periods. The controller determines which of the at least two selectable communication channels includes a lowest noise level based on the measured RSSI voltage level. A channel status update signal is broadcast from the electronic control module to the portable communication device identifying the selected communication channel having the lowest noise level.
US09085276B2
An airbag for a motor vehicle includes a support structure with a plurality of support elements. The support structure is moveable from a storage position to a support position and by which a support volume of the airbag is covered at least partially in the support position. At least one of the support elements is curved at least in one section in the support position.
US09085275B2
An active bolster for a vehicle is provided, wherein the bolster comprises an expansible hollow interior that is inflatable and is self-supporting in both an inflated and in an uninflated position. The bolster has an inflator module for inflating the expansible hollow interior. The bolster has an inner wall for projecting inwardly into the vehicle and away from the side of the vehicle on inflation of the expansible hollow interior. The bolster may have a relatively non-expansible component located between a first expansible chamber and a second expansible chamber. The bolster may comprise an outer wall having an attachment portion for attaching the outer wall to a portion of the side of the vehicle.
US09085270B2
Apparatuses and methods for adjusting a position of at least one component of a vehicle for a user of the vehicle. A user is identified with a user key associated with the user. The user key and a vehicle identifier associated with the vehicle are transmitted to a server remote from the vehicle. At least one user setting for the vehicle is received from the remote server, with the at least one user setting relating to the user key, the vehicle identifier, and the position of the at least one component. A vehicle system setting is updated with the at least one user setting so as to adjust the position of the at least one component based on the at least one user setting when the vehicle system setting does not correspond with the at least one user setting.
US09085267B2
Certain embodiments of the invention may include a self-securing container to the back of a pickup truck. According to certain embodiments of the present invention, the bottom side of the container may be shaped to be securely mounted on the left or right hump in the bed. According to other embodiments, the present invention may include at least one protruding portion to securely fit a channel guide on the right or left side wall of the bed. According to other embodiments, the present invention may include a tool box that may be secured to the back of the pick-up truck without the use of any additional tools or other structures or fasteners.
US09085261B2
A rear vision system for a vehicle includes a rearward facing camera disposed at a rearward portion of a vehicle equipped with the rear vision system. The rearward facing camera is operable to captures images rearward of the equipped vehicle. When a trailer is near and/or attached to the equipped vehicle and is rearward of the equipped vehicle, a processor is operable to process the captured images and, responsive at least in part to such processing, is operable to determine a trailer angle of the trailer relative to a longitudinal axis of the equipped vehicle.
US09085260B2
Light for motor vehicles and the like provided with a lighting device comprising a pair of power supply lines flowed through by a primary supplying current, two or more lighting branches each comprising one or more light sources adapted for being flowed through by a secondary supplying current; and an electronic control circuit configured to determine the secondary current flowing through each lighting branch; limit the primary supplying current to a predetermined minimum value when the secondary current flowing through at least one of said lighting branches is lesser than a predetermined threshold current; control the simultaneous transition of the light sources from a pre-lighting state to a complete-lighting state, when each of the secondary currents flowing through the lighting branches is greater than or equal to the predetermined current threshold.
US09085258B2
Described is a loading ramp for loading a small vehicle into the bed of a truck, for being carried by the truck, and for optimizing storage space provided by the truck. The loading ramp is adapted to be mounted to a truck and is capable of an up position and a down position. When at the down position, the loading ramp defines a gradient between a ground surface and the bed of the truck. The gradient supports a small vehicle, such as an ATV, to the extent that the small vehicle is loaded into the bed of the truck by traversing the gradient. When at the up position, the loading ramp is carried by the truck such that the loading ramp does not limit the storage space provided by the truck and, in particular embodiments, makes available storage space provided by the truck that would otherwise be occupied.
US09085254B2
A head restraint includes a base element on which two wing elements are mounted by at least one hinge so as to rotate about a vertical axis. The hinge has a pin and a recess which are frustoconical. The support structure of each wing element is in two parts.
US09085252B2
A vehicle seat assembly adjacent a vehicle body panel includes a vehicle seat that has a seat bottom and a seat back pivotable with respect to the seat bottom. The vehicle seat assembly includes a striker assembly with a fixed striker fixed to the vehicle body panel, and a pivotable striker pivotably supported on the fixed striker. The pivotable striker is pivotable between a first position in which the pivotable striker extends further than the fixed striker toward the seat back, and a second position in which the fixed striker extends further than the pivotable striker toward the seat back. A latching mechanism fixed to the seat back latches to the pivotable striker when the pivotable striker is in the first position, and latches to the fixed striker when the pivotable striker is in the second position.
US09085251B2
A storage apparatus for a seat of a vehicle, in which the seat is stored in a storage space formed therebelow, so that it is possible to secure a wider luggage space as compare with the related art and reduce unit cost without using a separate slide rail. In addition, the storage apparatus variously uses the space of a back seat when shifted between a passenger space (seating mode) and a luggage space (luggage mode) of the multi-functional back seat, which is vertically movable and foldable.
US09085250B2
A base suitable for use with a child safety carrier includes a shell body, a platform movably assembled with the shell body, a latch mechanism and a plurality of cushion structures. The latch mechanism includes a holding frame and a latch, the holding frame being affixed with one of the shell body and the platform, and the latch being assembled with the other one of the shell body and the platform. The holding frame includes locking openings, and the latch is operable to engage with any of the locking openings to lock the platform with the shell body. The cushion structures are respectively disposed adjacent to the locking openings. When collision occurs, the latch can interact with one of the cushion structures to cause deformation or break of the cushion structure so that the platform is displaced relative to the shell body.
US09085248B2
A vehicle seat and reclining mechanism are disclosed that provide for adjusting the angle of inclination of a seat back relative to a seat base and also permits easy entry to the area behind the seat by allowing the seat back to be released to move between an adjusted angle of inclination and a position in which the seat back is folded over the seat base. The reclining mechanism may include three or four release mechanisms that are all coaxially attached to the vehicle seat to permit the seat back to pivot about a single axis.
US09085246B1
A stabilization assembly for a vehicle includes a vehicle seat and a slide assembly. The vehicle seat includes a first frame member, a second frame member spaced opposite the first frame member, and a torque tube disposed between and attached to the first frame member and the second frame member. The slide assembly includes a track defining a channel therein, a rail translatable within the channel, and a bracket attached to the rail. A lift linkage interconnects the vehicle seat and the slide assembly, is attached to the bracket and the torque tube, and is rotatable with respect to the bracket about a pivot axis. The stabilization assembly also includes a locking sprocket attached to the bracket, rotatable about the pivot axis during a non-energy management condition, and not rotatable about the pivot axis during an energy management condition. A vehicle including the stabilization assembly is also disclosed.
US09085245B2
A commercial vehicle seat is provided including a seat part, a backrest part and a seat substructure for arrangement on a body part of a commercial vehicle, in which the seat substructure includes a transverse oscillation device comprising a cross slide part which is capable of oscillating transversely to the length of the commercial vehicle and by means of which at least the seat part is mounted so as to be capable of oscillating transversely to the direction of travel on a base carrier part of the seat substructure, and includes a locking device for fixing the cross slide part on the base carrier part, wherein the locking device includes two locking units which are spaced apart along the length of the commercial vehicle and have respective locking elements which are mounted pivotally about vertical pivot axes or displaceably along linear axes and are arranged so as to be synchronously operable in a horizontal plane between two transverse rail units of the transverse oscillation device.
US09085244B2
A table for a vehicle includes a table main body, and an extending and retracting mechanism which connects the table main body to a base so as to be extended and retracted relative to the base. The mechanism includes link mechanism units which extend and retract the table main body relative to the base by a link movement, an operation part which is connected to the link mechanism units and operates the link mechanism units, and a cancel mechanism unit which prevents the link mechanism units from being operated without through an operation of the operation part. The cancel mechanism unit is configured such that when one of the link mechanism units is operated in a direction without through the operation of the operation part, an operating force is not transmitted to the operation part.
US09085238B2
A system for providing power to a power network includes an energy storage device connected to the power network, a sensor connected with the energy storage device for measuring a state of the energy storage device during a rest period, which corresponds to a time span during which a current through the energy storage device is reduced to a level that enables an estimation of a state of the energy storage device. The system further includes a controller connected to the sensor for measuring a state of the energy storage device. The controller selectively establishes rest periods for the energy storage device. The rest periods are established by optimizing between minimization of disruption to normal operation and a need to update a measurement of the state of the energy storage device.
US09085237B2
Provided is a speed limiter, wherein a vehicle speed is detected, and a speed limit displayed on a speed sign is detected based on an image captured by a front monitoring camera. A speed difference between the vehicle speed and the speed limit is calculated, and an accelerator sensitivity gain is set using the speed difference as a parameter. Then an accelerator opening degree is corrected with the accelerator sensitivity gain to obtain a pseudo accelerator opening degree. A target throttle opening degree is set based on the pseudo accelerator opening degree and an engine rpm.
US09085234B2
A vehicle includes a fuel tank disposed adjacent to a propeller shaft in a widthwise direction of the vehicle, and a differential unit coupled to a rear end of the propeller shaft. The differential unit includes a differential gear coupled to the rear end of the propeller shaft, a housing positioned rearward of the fuel tank to accommodate the differential gear, a bracket member fixed to the rear sub-frame, a plurality of bolts that fasten the housing and a first bracket together, and a stay member provided separate from the bolts to couple the housing and the first bracket together.
US09085230B2
A motorcycle including a vehicle body frame with a single down frame extending downwardly and rearwardly from a head pipe supporting a front fork in a steerable manner. An engine main body arranged behind the down frame, said engine main body being mounted on the vehicle body frame. A pair of left and right radiators arranged separately on left and right sides of the down frame respectively, said pair of left and right radiators being supported on the vehicle body frame in front of the engine main body. Exhaust pipes connected to front portions of an engine main body with a down frame and a pair of left and right radiators being arranged side by side in a left-right direction wherein the exhaust pipes are located between at least one of the pair of left and right radiators and the down frame in a vehicle front view.
US09085222B1
The electric heavy duty vehicle with combination of power storage or energy the on board electric charging and propulsion; the present invention is alternative energy design for electrical vehicles replacing the need for gasoline or other traditional fossil fuel.
US09085218B2
An auxiliary power system and method distributes and controls excess electric power that is available from a trailer box refrigeration system. The trailer box refrigeration system may have either a generator for generating direct current (DC), or an alternator for generating alternating current (ac). The generator/alternator produces power to power refrigeration system loads and excess generated power may be distributed to auxiliary loads not associated with the refrigeration system.
US09085212B2
A suspension assembly having a frame hanger, a first control arm mounted between the frame hanger and an axle attachment member, a second control arm mounted to the frame hanger and to the axle attachment member, wherein the second arm extends from a centerline of the first control arm at an angle alpha such that the first control arm and the second control arm are not parallel to each other, wherein the centerline of the first control arm and the centerline of the second control arm extend to intersect at a point that is at a virtual center of rotation.
US09085190B2
A method and computing system are proposed for producing an authenticable security device with two sides. The verso side is covered with an adjustable luminescent emissive layer formed by invisible luminescent ink halftones and possibly a UV absorbing printed layer. The recto side is covered with transmissive non-luminescent ink halftones. The backlit colors resulting from the emissions of the luminescent layer or resulting from illumination by normal white light through the transmissive non-luminescent ink halftones are predicted by a backlighting model. This model enables computing the surface coverages of the luminescent and/or non-luminescent ink halftones in order to obtain a desired color either under excitation light (UV light) or under normal white light. This enable creating authenticable backlit images substantially similar to pre-stored reference images, either under normal white light, under excitation light, or under both the normal white light and the excitation light.
US09085186B2
A liquid ejecting apparatus which includes a moving body provided with a liquid ejecting head which ejects liquid from nozzles; a guide frame which guides the moving body in a moving direction; an urging member which urges the guide frame toward a side opposite to gravity direction; and a base frame which is provided with a first support unit which supports the guide frame, in which the first support unit regulates a displacement of the guide frame in the antigravity direction due to the urging member using abutment, and the guide frame is supported by the base frame in a state in which the guide frame can be displaced toward a gravity direction side with a gap between the base frame and the guide frame.
US09085178B2
A printing apparatus includes a print head that forms an image on a target printing surface of a printing medium by relatively moving with respect to the printing medium, an elastic wave radiation unit that radiates elastic waves, in air toward the target printing surface, a reception unit that receives the elastic waves that are radiated from the elastic wave radiation unit and reflected by the target printing surface, and a control unit which measures the time of arrival taken for elastic waves, and stops relative movement when the time of arrival is shorter than a defined time, in which the defined time is a time of arrival in which a distance from the print head to the printing medium and the distance from the elastic wave radiation unit to the printing medium to an allowable minimum distance between the print head and the printing medium.
US09085176B2
A method for printing on a moving print medium in a printing system is disclosed. The method includes providing a linehead defining one or more print zones. A plurality of transport rollers are provided, wherein at least one transport roller is disposed opposite the linehead, adjacent to the second side of the print medium, and aligned with one of the print zones. A vacuum assembly is disposed opposite the second side of the print medium and includes a vacuum manifold aligned with the aligned transport roller. The print medium is moved through the printing system and a vacuum force operates on the print medium such that at least a portion of the print medium is deflected thereby increasing a wrap angle of the moving print medium around the aligned transport roller. Liquid is jetted from the linehead onto the print medium to form a print.
US09085170B2
In a printing machine, it is enabled to prevent continuous paper from being broken when the continuous paper is initially fed through a path of its conveyance.The paper conveying apparatus is provided that the path of conveyance of continuous paper 1 is provided with a first, a second and a third feed roll unit 5, 6 and 7, having their respective feed rates which when continuous paper is printed on and machined are controlled to increase in the order of the feed roll units to generate a proper amount of tension imparted thereto and which when the continuous paper is initially fed through the path are controlled to decrease in the order of the feed roll units so as not to generate tension whereby the continuous paper is prevented from being broken in the course of initial paper threading in the printing machine.
US09085163B2
The method of this invention for discharging a shipping ink from a newly installed print head filled with that ink minimizes the amount of shipping ink that may remain in the print head after the ink discharging process is performed. The shipping ink discharging method according to this invention comprises: a print head; an ink tank; a first pump; a second pump; a switch valve; and a cleaning mechanism; wherein the switch valve is closed and the first pump is operated to discharge the shipping ink from the ink ejection nozzles and the cleaning mechanism is operated to clean the print head, after which the switch valve is opened and the second pump is operated to supply ink from the ink tank to the print head.
US09085147B2
A case member is formed into a molded article and includes a wall-shaped enclosure projecting to face a printing medium side and forming a predetermined space. A plurality of projections are formed at positions apart from each other on a top portion of the wall-shaped enclosure. A cover member is fixed to tops of the plurality of projections and is set in an end section of the wall-shaped enclosure. With the projections, the height setting can be finely adjusted by finely adjusting of a mold during resin molding. It is thus possible to maintain a desired height with high accuracy.
US09085142B2
There is provided a method of manufacturing a liquid ejection head that includes a supporting member having a major surface provided with a plurality of supply paths, and a recording element substrate having a bonding surface bonded to the major surface and provided with a plurality of supply ports arranged side by side in an arranging direction in which the supply paths are arranged side by side, the supply ports having smaller widths than the respective supply paths in the arranging direction. The method includes applying a bonding agent on the major surface around each of the supply paths, spreading the bonding agent to inner side surfaces of the supply ports by pressing boundary portions between the bonding surface and the supply ports into the bonding agent applied, and bonding the bonding surface to the major surface at a bonding position where the supply ports face the respective supply paths.
US09085141B2
A liquid ejection head and a printing apparatus can perform high-quality printing by suppressing the shrinkage stress of an adhesive joining a substrate and a flow path forming member and the deformation and peeling of the flow path forming member. A stress dispersing section is formed on the side surface of the substrate.
US09085137B2
An inkjet printer is configured to reduce the settling of magnetic particles in magnetic ink. The inkjet printer is configured to eject magnetic ink and black ink in areas where the corresponding image data only has black ink pixels. The printing of the magnetic ink in the black ink areas helps prevent the magnetic particles in the magnetic ink from settling.
US09085136B2
A liquid ejecting apparatus and a method for detecting a medium edge position are provided wherein the edge position of the medium can be comparatively more accurately detected even when the sensitivity of an optical sensor has changed due to fouling or the like.
US09085135B2
A semiconductor device for controlling discharge of a liquid includes a power supply terminal, a ground terminal, driving portions arranged along a straight line between the power supply terminal and the ground terminal to discharge a liquid, a power supply line extending along the straight line from the power supply terminal to supply a power supply voltage to the driving portions, and a ground line extending along the straight line from the ground terminal to supply a ground voltage to the driving portions. A width of the power supply line in a direction perpendicular to the straight line continuously or gradually decreases away from the power supply terminal, and a width of the ground line in the direction continuously or gradually decreases away from the ground terminal.
US09085132B2
Disclosed are a reverse gravure offset printing method and apparatus using a disposable cliche, which do not require cleaning of the cliche and do not require a large quantity of high-definition cliches because the cliche used in reverse gravure offset printing can be discarded after used once or several times and replaced with a new one, thereby achieving cost reduction.
US09085130B2
A rotary device for high-speed printing or coating of a web substrate is disclosed. The printing system provides a gravure roll rotatable about an axis at a surface velocity, ν, and a fluid channel having a pressure drop throughout the fluid channel due to friction, Pf, disposed therein. The fluid channel is disposed generally parallel to the axis at a distance, Rin, relative to the axis. The fluid channel provides fluid communication of a fluid having a fluid vapor pressure, Pv, and a fluid density, ρ, from a first position external to the gravure roll to a web substrate contacting surface of the gravure roll. The web substrate contacting surface is located at a distance, Rout, relative to the axis. Rin is determined from the relationship: R in R out > 1 - 2 ( P out - P v + P f ) ρ v 2 where Pout=static pressure of the fluid channel at the web substrate contacting surface.
US09085129B2
A relief print master is created by a printhead that jets droplets of a polymerisable liquid on a cylindrical sleeve. The droplets follow a spiral path on the cylindrical sleeve. In a multiple printhead unit, there are different spiral paths associated with the different constituting printheads. The distance between these spiral paths is not even in a prior art system. By rotating the printhead under a specific angle, the distance between these spiral paths becomes even. The invention can also be used for the creation of other types of print plates, such as for example offset print plates.
US09085120B2
Solid state nanopore devices for nanopore applications and methods of manufacture are disclosed herein. The method includes forming a membrane layer on an underlying substrate. The method further includes forming a hole in the membrane layer. The method further comprises plugging the hole with a sacrificial material. The method further includes forming a membrane over the sacrificial material. The method further includes removing the sacrificial material within the hole and portions of the underlying substrate. The method further includes drilling an opening in the membrane, aligned with the hole.
US09085114B2
A tire mold or a tire mold segment can include an air compression cavity, which connects to multiple surface connection slots having dimensions between 10 and 300 microns, which can be suitable for selective removal of air in the mold. The air compression cavity, can be close to the outside ambient, allowing the air escaping the interior of the mold to be compressed, which can assist in preventing the rubber material from leaving the mold pattern surface.
US09085105B2
A mold for foam molding which can sufficiently prevent burrs from being formed on a molded product, and a foam molding method using the mold are provided. A groove 6 into which a packing seal is to be fitted is formed in a mating surface 3a of a lower mold 3 so as to extend around a cavity 7. The groove 6 has a deep groove portion 6a which is deeply recessed from the mating surface 3a, and a shallow groove portion 6b which is located on the cavity 7 side with respect to the deep groove portion 6a and which continues to the deep groove portion 6a. A portion of the mating surface 3a that extends from its edge on the cavity 7 side down to the groove 6 has a width “a” of from 0.1 mm to 10 mm. A packing seal 5 has a base portion 5a which is inserted into the deep groove portion 6a, and an overhang portion 5b which continues to the base portion 5a and is engaged with the shallow groove portion 6b.
US09085099B2
A stretch blow molding machine and method are provided for forming a container. A preform is expanded to a first configuration in a blow mold of a stretch blow molding machine. A stretching rod element is introduced to the blow mold to expand the preform from the first configuration to a second configuration. The stretching rod element moves axially in the blow mold in a stretching direction. The plastic perform is temporarily coupled to the stretching rod element during at least a period of time of the expansion of the preform from the first configuration to the second configuration for influencing a behavior of the perform during the expansion.
US09085094B2
A folding top for vehicles has a cast-resin bead element provided in a connecting region between an outer cover surface element and at least one further cover element. The top is made by first inserting at least one section of the outer cover surface element into a casting mold and at least one section of a sacrificial profile into the casting mold. A head area of the profile is wider than a neck area thereof. Then a casting compound is introduced into the casting mold around the head area. After curing of the compound, the cover surface element is removed with bead element affixed thereto from the casting mold. The sacrificial profile is extracted from the bead element in order to provide an undercut seat in the bead element.
US09085085B2
The invention provides an articulating mechanism useful, for example, for remote manipulation of various surgical instruments and diagnostic tools within, or to, regions of the body. Movement of segments at the proximal end of the mechanism results in a corresponding, relative movement of segments at the distal end of the mechanism. The proximal and distal segments are connected by a set of cables in such a fashion that each proximal segment forms a discrete pair with a distal segment. This configuration allows each segment pair to move independently of one another and also permits the articulating mechanism to undergo complex movements and adopt complex configurations. The articulating mechanisms may also be combined in such a way to remotely mimic finger movements for manipulation of an object or body tissue.
US09085076B2
A portable power tool comprises an electric motor, actuator, or light-emitting hardware and a rechargeable power source connected to the electric motor, actuator, or light-emitting hardware, wherein the power source contains at least a surface-mediated cell (SMC). The power tools include, but are not limited to, impact driver, air compressor, alligator shear, angle grinder, band saw, belt sander, biscuit joiner, ceramic tile cutter tile saw, chainsaw, circular saw, concrete saw, cold saw, crusher, diamond blade, diamond tools, disc sander, drill, floor sander, grinding machine, heat gun, impact wrench, jackhammer, jointer, jigsaw, lathe, miter saw, nail gun, needle scaler, torque wrench, powder-actuated tools, power wrench, radial arm saw, random orbital sander, reciprocating saw, rotary reciprocating saw, rotary tool, sabre saw, sander, scroll saw, steel cut off saw, table saw, thickness planer, trimmer, wall chaser, wood router, or flashlight.
US09085071B2
A tool for extracting a pin inserted in a component bore extending into a pin receiving component, the tool comprising: a pin gripping element configurable between a released configuration in which the pin and the pin gripping element are movable relative to each other and a gripping configuration in which the pin gripping element grips the pin; a base element for abutting against the pin receiving component; and a gripping element mount mounting the pin gripping element to the base element, the gripping element mount being configurable between a first configuration and a second configuration, wherein, in the first configuration, the pin gripping element is substantially adjacent to the base element, and in the second configuration, the pin gripping element is further away from the base element than in the first configuration. An actuator selectively moves the gripping element mount between the first and second configurations.
US09085067B2
A spanner wrench and a method of rotating an object with the spanner wrench is provided. The spanner wrench is configured to engage and rotate the object, and the spanner wrench is supported in a manner that resists tilting and transverse movement of the spanner wrench as the spanner wrench is rotating the object.
US09085064B2
A system and method for dispensing abrasive particulate material into a stream of air or gas for introduction into a pipe for the purpose of cleaning the pipe and preparing the inner surface for coating or lining. The system comprises an air blower coupled to the pipe, and generates the stream of air or gas, and a three component feed assembly for dispensing the abrasive particulate material. The feed assembly operates at atmospheric pressure and is in fluid communication with each of the pipe and the air blower, and is used to meter the abrasive particulate material into the stream of gas for introduction into the pipe. The system further comprises a shut-off valve that is in fluid communication with the feed assembly, the air blower and the pipe and is cycled to isolate the feed assembly from the air blower during pipe drying and maintenance operations.
US09085053B2
The tip portion of a blade of a gas turbine is repaired in-situ in the gas turbine without removing the blade from the turbine rotor disk. To facilitate the in-situ repair of the tip portion of the turbine blades, one or more access holes may be provided in the turbine shroud or blade outer air seal circumscribing the plurality of turbine blades extending radially outward from the turbine rotor dick.
US09085045B2
Provided is a method and system for controlling a spike anneal process on a substrate, comprising selecting one or more objectives, one or more absorbance layers, a technique of modifying absorption of the selected one or more absorbance layers, one or more wavelengths used in a heating device. A substrate modified with the selected technique of modifying absorption is provided. The spike anneal process is performed on the substrate using the selected heating device and selected spike anneal process variables. One or more of the spike anneal process variables, the selected technique of the modifying absorption, the selected one or more wavelengths, and/or the selected heating device are adjusted in order to meet the one or more objectives of the spike anneal process.
US09085044B2
For the determination of the welding current to be used for the resistance welding of the overlap seam of container bodies, welding with a test body is carried out with a changing strength of welding current which in the test body produces a varying welding of the seam. The current strength varies from welding of this seam with a too high temperature to welding with a too low temperature. Along with this the welding current strength used in the welding is determined so that it is further determined at which point of the seam the welding has been accomplished and with what strength of welding current. By means of a mechanical and/or optical investigation of the welded seam it can then be easily determined where the seam has been correctly welded for the series production of container bodies from the same sheet material as the test bodies. When such a point or such a region of the seam is known the welding current used in the test welding can be taken as the welding current for serial production.
US09085043B2
A submerged arc welding system includes a robot having a first arm connected to a second arm, and at least one wire supply. A welding torch is connected to a first end of the second arm of the robot. A wire motor is mounted to a second end of the second arm of the robot. The wire motor moves wire from the wire supply along a wire path to the welding torch. The system further includes a flux supply and a flux delivery system configured to move flux from the flux supply along a flux path to the welding torch.
US09085041B2
A method and system to weld or join workpieces employing a high intensity energy source to create a weld puddle and at least one resistive filler wire which is heated to at or near its melting temperature and deposited into the weld puddle.
US09085034B2
A method for milling a blank in the production of a turbine blade which in the final state has at least one blade root for fastening to a carrier and also an adjoining blade body extending in the longitudinal direction includes clamping the blank on its root side in a mount and machining the blank with a milling cutter. Machining the blank includes moving the milling cutter in an advancing direction for roughing machining while superimposing a circular movement as per a trochoidal milling method.
US09085031B2
A thread whirling device for producing a thread on a workpiece on a numerically controlled turning machine by a thread whirling method, having a retention structure for fitting the thread whirling device to the turning machine, a whirling head which is retained on the retention structure, has an opening and carries one or more cutters which are arranged peripherally on the edge of the opening, having a first drive device which is configured to drive the whirling head in a rotational manner about a first rotation axis which extends through the opening. The thread whirling device further includes a second drive device which is configured to drive the whirling head in a rotational manner about a second rotation axis which extends transversely relative to the first rotation axis, in order to orientate an angle between the first rotation axis and the spindle axis of the turning machine work spindle.
US09085025B2
The invention comprises a means for providing customizable identification symbols to a metal container using a custom, portable tool for stamping the symbols onto the external surface of the container.
US09085024B2
A chain-like pressing device and a method of using same for press joining a tubular or hose-shaped workpiece with a fitting and/or a ferrule is provided. The device at least two pressing members interacting over the circumference in the radial direction. The pressing members can move relative to each other in the circumferential direction at their interacting surfaces that transmit the pressing force. The interacting surfaces enclose an angle of less than 180° therebetween. The pressing device includes a plurality of pressing members forming a first linkage for enclosing the workpiece, at least one of the pressing members transmits pressing force only by pressure or tension application through a further first pressing member.
US09085023B2
A swage tool includes a first die coupled to a portion of a first die block and a second die coupled to a portion of a second die block. A cylinder moves the second die toward the first die. The first die block rotates about a longitudinal axis of the first die block.
US09085021B1
Devices and methods for preventing migration of buoyant contaminants from subaqueous contaminated sediment while providing for venting of gas that migrates from the contaminated sediment are described.
US09085019B2
Superhydrophobic films and methods of making such films are disclosed. More particularly, superhydrophobic films having durable nanostructures with high contrast ratios and various methods of producing such films are disclosed.
US09085011B2
A driver circuit for electro-active polymer (EAP) device has a shared, voltage boost circuit that is coupled to drive a common terminal of first and second EAP devices to a given voltage. A first voltage boost circuit is coupled to drive a respective terminal of the first EAP device to an opposite polarity voltage, while a second voltage boost circuit is coupled to drive a respective terminal of the second EAP device to an opposite polarity voltage. Other embodiments are also described and claimed.
US09085008B2
A fluid dispensing device includes an electrostatic discharge protection system. Accumulation and discharge of electrostatic energy created by operation of the device is reduced or prevented by the electrostatic discharge protection system without an earth ground connection. The electrostatic discharge protection system may include a number of features, such as a static wick, non-conductive components that electrically isolate the spray tip of the device, nonconductive isolation barriers, nonconductive fluid reservoir and suction tube components, a nonconductive coating of a control valve component, and a nonconductive spring retainer of the control valve.
US09084998B2
A cone crusher includes a crushing chamber formed between inner and outer crushing shells, a drive shaft that gyrates the crushing head to crush material in the crushing chamber, and a feeding hopper for feeding material to the crushing chamber. A measurement device measures an amount of material present in the feeding hopper. A control system controls, based on the measured amount of material present in the feeding hopper, at least one crusher operating parameter which is chosen from i) an rpm of the drive shaft, and ii) a width of a discharge opening formed between the inner crushing shell and the outer crushing shell.
US09084987B2
The invention relates to a process to produce catalysts by powder injection molding and the catalysts thereof, wherein the catalysts are made by preparing a ceramic formulation with temperature controlled rheological properties comprising catalytic components, heating the powder formulation up to at least the fluid state transition temperature, shaping a sample by injecting the fluid powder formulation into an injection mold followed by cooling the injected powder formulation below the fluid state transition temperature, de-binding the shaped sample, and sintering the shaped sample to form a ceramic catalyst. Alternatively the ceramic structure may be formed initially followed by a coating of the ceramic structure by one or more catalytic compounds.
US09084986B2
A CO2 reforming catalyst may include at least one catalyst metal supported in a porous carrier. The at least one catalyst metal may include a transition metal (e.g., Ni, Co, Cr, Mn, Mo, Ag, Cu, Zn, and/or Pd). Each particle of the at least one catalyst metal may be bound with the porous carrier in a form of an alloy. The porous carrier may form a rod-shaped protruding portion around the catalyst metal particle.
US09084983B2
The present invention relates to an eggshell catalyst comprising an active metal selected from the group consisting of ruthenium, rhodium, palladium, platinum and mixtures thereof, applied to a support material comprising silicon dioxide, wherein the pore volume of the support material is 0.6 to 1.0 ml/g, determined by Hg porosimetry, the BET surface area is 280 to 500 m2/g, and at least 90% of the pores present have a diameter of 6 to 12 nm, to a process for preparing this eggshell catalyst, to a process for hydrogenating an organic compound which comprises at least one hydrogenatable group using the eggshell catalyst, and to the use of the eggshell catalyst for hydrogenating an organic compound.
US09084979B2
An apparatus (10) and a method (200) for the manufacture of nanoparticles. The apparatus and the method allows for the nucleation and growth of nanoparticles at independent temperatures. The independent temperatures allow for the growth of nanoparticles in a controlled environment avoiding spontaneous nucleation and allowing particle sizes to be controlled and facilitating the manufacture of particles of a substantially uniform size. Furthermore the apparatus (10) allows for the manufacture of core-shell nanoparticles and core-shell-shell nanoparticles.
US09084976B2
A spray-drying apparatus includes a drying chamber that has a first end, a second end, and at least one side wall extending between the first and second ends to define an interior of the drying chamber having a center axis. A nozzle can be positioned at the first end of the drying chamber and be configured to atomize liquid and spray the atomized liquid into the interior of the drying chamber at a maximum spray pattern angle relative to the center axis. A heating device can be provided to heat the liquid prior to introduction into the drying chamber.
US09084974B2
The present invention relates to a process for mixing a heterogeneous solution containing at least two different liquids and, optionally, at least one solid entity, so as to obtain a homogeneous solution, the process comprising the following steps: a) all or part of the heterogeneous solution is placed in at least one vessel having a longitudinal axis; b) the vessel is positioned on a support driven about a rotation axis, the longitudinal axis being inclined to the rotation axis; and c) the support is made to undergo a movement so as to subject the solution contained in the vessel to successive accelerations and decelerations of sinusoidal intensity, thereby stirring said heterogeneous solution, which becomes homogeneous. The invention also relates to a device for implementing the above process. A preferential application of the invention is in the field of medical diagnostics.
US09084972B2
A rennet injection system is provided for use with food processing or other equipment that uses rennet as a processing ingredient. The rennet injection system includes at least one injector that has multiple openings for delivering rennet to multiple rennet delivery locations that are spaced apart from each other within the food processing or other equipment. The injector may include a nozzle with a middle bore and angled bores on opposing sides of the middle bore that face away from a direction that the middle bore faces.
US09084964B1
An air quality control system (AQCS) 214 useful for treating flue gas FG, such as flue gas FG produced by a fossil fuel fired boiler 212 is described. The AQCS 214 is equipped with a dry scrubber 236 and a radial fabric filter 254 with a central chimney 216. The radial fabric filter 254 collects particulates and dried reacted reducing agent from flue gas FG drawn through the radial fabric filter 254 by an axial fan 288 arranged within the central chimney 216.
US09084952B2
A device for the treatment of water, in particular a filter device. The device has a cartridge which has a container for receiving treatment agents for water, particularly for receiving filter agents, and a connection head arranged on the container. In addition, a connection element is provided which has a recess for the connection head. At least one locking shaft is provided with which the connection head can be fixed in the connection element. The locking shaft is rotatably mounted and can be rotated from a locking position to an unlocking position and back again. A cartridge with a recess in the connection head is provided.
US09084949B2
A water treatment system is provided. The system includes a first container and a pump fluidly coupled to the first container. A filter is fluidly coupled to the pump opposite the first container. A valve having an inlet fluidly is coupled to the filter opposite the pump, the valve having a first outlet fluidly coupled to the first container and a second outlet. At least one UV germicidal light is fluidly coupled to the second outlet, wherein a fluid from the second outlet flows over at least a portion of the length of the at least one UV germicidal light. A second container is fluidly coupled to the second conduit. At least one electrical generator is configured to couple with a bicycle, the at least one electrical generator being electrically coupled to provide electrical power to the at least one UV germicidal bulb and the pump.
US09084947B2
Apparatus and methods for conveying a flow of oil-containing liquid into an oil separation skim tank, and a skim tank incorporating such apparatus and methods, are disclosed. One such apparatus includes at least one diffuser, the diffuser defining an intake opening configured to receive the flow of oil-containing liquid and an exhaust opening configured to convey the flow of oil-containing liquid into the skim tank. The diffuser is configured to cause the flow of oil-containing liquid to have a greater horizontal width at the exhaust opening than at the intake opening, while minimizing vertical divergence of the flow at the exhaust opening.
US09084945B2
A process for recovering hydrogen during hydroprocessing, where the process includes providing a pressure increasing device to a hydroprocessing unit, wherein the pressure increasing device utilizes a high pressure stream from a separator for increasing pressure; introducing a hydrogen containing stream to the pressure increasing device, thereby increasing the pressure of the hydrogen containing stream; and routing the hydrogen containing stream from the pressure increasing device to a vapor-liquid separator. The process also includes separating the hydrogen from the hydrogen containing stream in a hydrogen purification unit to produce a recovered hydrogen stream; and then preferably using the recovered hydrogen stream from the hydrogen purification unit within the hydroprocessing unit.
US09084942B2
A toy figure is disclosed herein, the toy figure having: an upper body portion; a lower body portion, the upper portion being rotatably secured to the lower portion; at least one appendage movably secured to the lower portion; and a drive mechanism coupling the at least one appendage to the upper portion, wherein movement of the at least one appendage causes rotation of the upper portion with respect to the lower portion.
US09084937B2
Systems and methods for an online predictive diagnostic and prognostic maintenance system are disclosed. The systems and methods may be configured for use with networked gaming machines. The systems and methods may operate in real time and may detect and analyze data representing various indicators of machine performance or a current or future decrease in machine performance. The data may represent or be used to predict machine performance and risk of failure and to identify necessary or recommended repair, maintenance or other performance issues. In another embodiment systems and methods are disclosed for automated analysis of data regarding machine operation and generation of rules related to predicting the future performance, repair and maintenance needs of machines.
US09084935B2
A cartridge, which is an attachment device, is mountable into an insertion slot in a game apparatus. At a side surface inside the insertion slot, a slide member is movable from a near side to a far side. The attachment device includes a housing and a hook. When the attachment device is inserted into the insertion slot, a predetermined portion of the housing abuts against the slide member, and the slide member is caused to move toward the far side of the insertion slot when the predetermined portion is inserted further inside while abutting against the slide member. The hook is inserted into a recessed portion generated at the side surface inside the insertion slot when the slide member moves toward the far side of the insertion slot, and then latches onto the inside wall.
US09084934B2
A game controller includes a plurality of LEDs formed on the rear of a case. The plurality of LEDs are arranged two-dimensionally in its layout area. The game controller has a plurality of PWM control units which are provided inside the case and control the lighting of the plurality of LEDs, respectively. The PWM control units control the lighting of the LEDs based on a control signal from a game apparatus. The game apparatus acquires a captured image of the game controller, and acquires the position of the game controller in the captured image based on the positions of the LEDs in the captured image.
US09084933B1
Method for physiologically modulating videogames and simulations includes utilizing input from a motion-sensing video game system and input from a physiological signal acquisition device. The inputs from the physiological signal sensors are utilized to change the response of a user's avatar to inputs from the motion-sensing sensors. The motion-sensing system comprises a 3D sensor system having full-body 3D motion capture of a user's body. This arrangement encourages health-enhancing physiological self-regulation skills or therapeutic amplification of healthful physiological characteristics. The system provides increased motivation for users to utilize biofeedback as may be desired for treatment of various conditions.
US09084931B2
A distributed computer system is provided for collecting player information. Further, a scoring system is provided that rates a player based on one or more elements of the collected information. Players may be rated with respect to a number of characteristics. Responsive to a determined rating or score, action may be taken by the distributed system with regard to the player. For instance, the player may be provided a complimentary offer, provided an award, and invitation to come to a gambling location, presented an advertisement, or other action may be performed involving the player. Further, the distributed computer system may permit a player to manage their frequent player accounts and receive complimentary offers based on a set of criteria specified by the player.
US09084929B2
A children's building block crashing game and a method of conducting the building block crashing game in which building block assembly structures are crashed upon collision. Players assemble personally designed or preconfigured building block sets which meet the game restrictions on size and thickness, and then crash them together by sliding the structures down a low friction mat through a protective plastic shield. The player with the last piece remaining in the tunnel wins the round.
US09084925B2
A method and integrated golf club apparatus for directly measuring physical parameters of the golf club head motional acceleration swing forces, golf club head face, golf ball impact forces, and subsequent calculations of other metrics useful to a golfer's understanding of the effectiveness of his or her golf swing and impact result in totality. The physical parameters that are directly measured include three dimensional motion force vectors of club head prior to, during and after impact and full impact pressure force profiles across the golf clubface with respect to time. The sensors are connected to electronics which condition, record and store the time varying sensors information electronically, then process and translate the information into one of several forms for delivery to a human interface function.
US09084919B2
A stability ball inflation and deflation system includes a stability ball with a bore, and a plug within the bore walls. An air-control module engaged within the axial channel of the plug selectively allows air to pass in one or both directions. The air-control module includes a one-way air valve, and a cap releasably sealable to the plug. An airway extending from the one-way valve provides fluid communication with the interior of the stability ball. An inflator adapted to engage the one-way air valve may be removably coupled to the air valve, and provide air passages to direct air from a pressurized air cartridge into the stability ball.
US09084910B1
A control arrangement of an exercise equipment comprising at least one apparatus for measuring the physiological data, a portable electronic unit, and an electric exercise apparatus. The apparatus for measuring the physiological data includes a data output unit. The portable electronic unit includes a data transmission unit having the input/output function. An exercise management APP-program is built in the portable electronic unit. The exercise apparatus includes an electronic control panel with a data transmission unit and a corresponding exercise management APP-program. Once the apparatus for measuring the physiological data gets the basic physiological data (such as weight or heart rate) of a certain person, these will be immediately transmitted to the portable electronic unit. Meanwhile, an extra exercise session for the certain person will be created by the exercise management APP-program built within the portable electronic unit according to the personal physiological parameters. Thereafter, the extra exercise session will be transmitted to the electronic control panel so that the electronic control panel can control the exercise apparatus to run the above-mentioned exercise session.
US09084904B2
A composition for external use capable of more efficiently deriving the effect of purine substances (and/or salts thereof) including (A) sugar; and (B) at least one member selected from the group consisting of purine substances and salts thereof.
US09084897B2
A tibial nerve stimulation therapy device configured to provide an electrical stimulation therapy to branches of the tibial nerve includes a plurality of stimulation electrodes, a stimulation circuit configured to generate electrical stimulation pulses, a sensing circuit configured to generate an output signal indicative of an electromyogram (EMG) signal generated by the patient, and a controller. The controller is configured to execute a plurality of unique stimulation therapies in accordance with unique stimulation therapy settings, analyze the output signals generated by the sensing circuit after each of the stimulation therapies, and designate final stimulation therapy settings based on the analyzed output signals. The stimulation therapy settings include an identification of a pair of the electrodes through which the electrical stimulation pulses are delivered during a stimulation therapy, and/or at least one parameter defining the electrical stimulation pulses generated by the stimulation circuit.
US09084888B2
A method of determining a model of a marker includes obtaining projection images, each of the projection images having an image of a marker that indicates a shape of the marker, determining binary images of the marker for respective ones of the projection images, and constructing a three-dimensional model of the marker using the binary images, the three-dimensional model comprising a set of voxels in a three-dimensional space that collectively indicates a three-dimensional shape of the marker, wherein the act of constructing the three-dimensional model is performed using a processing unit.
US09084880B2
A package in which a medical device is stored, the package comprising an outer shell providing a vapor barrier between an interior space inside the outer shell and an exterior environment, a medical device positioned in the interior space inside the outer shell, the medical device including a liquid-containing element that is subject to drying out as liquid from the liquid-containing element vaporizes and travels from the interior space to the external environment, a condition sensor comprising two metallic elements, each of the two metallic elements being composed of different metals, with each of the different metals selected so that the two metallic elements form an anode and a cathode of an electrochemical cell, each of the two metallic elements being in electrical contact with a conductive water-containing element, so that the water-containing element forms the electrolyte of the electrochemical cell, and an electrically conductive path extending from each of the metallic elements to a location wherein the electrochemical potential formed between the metallic elements can be measured to provide an indication of the degree to which the conductive water-containing element has dried out.
US09084873B2
Inflation devices and methods to inflate medical devices are disclosed. Certain embodiments enable the selective coupling of a plunger to a syringe body through manipulation of a handle. Other embodiments facilitate the generation of relatively high fluid pressures through inflation device designs that incorporate multiple plungers.
US09084869B2
A catheter assembly comprises a first elongate tubular member having a proximal end portion defining a proximal end, a distal end portion having an opening therein and defining a distal end, and at least one lumen defined between the proximal end and the distal end. A second elongate tubular member has a proximal end portion defining a proximal end, a distal end portion defining a distal end, and at least one lumen defined between the proximal end and the distal end. The second elongate tubular member is received within the at least one lumen of the first elongate tubular member, such that the distal end portion of the second elongate tubular member projects from the opening in the distal end portion of the first elongate tubular member. An elongate, shape-imparting element is receivable in the at least one lumen of at least one of the first elongate tubular member and the second elongate tubular member. The shape-imparting element imparts a non-rectilinear shape to the distal end portion, of at least one of the first elongate tubular member and the second elongate tubular member.
US09084867B2
A method of injection molding a catheter assembly, the method comprising providing a mold having an elongated cavity in the form of an external surface of the catheter assembly, providing a core pin in the longitudinal axis of the catheter assembly inside the cavity in the form of an inner lumen of the catheter assembly, where the core pin has a distal end that is fixed in place and a proximal free end, providing a first and a second molding member where each one of the first and the second molding members has a fixed end and a free end, in a radial direction of the elongated cavity, preparing the mold by arranging the free ends of the two molding members to support the core pin, injecting a liquid catheter material into the mold, letting the liquid material solidify.
US09084864B1
The present disclosure provides a universal breathing tube adaptor that can accept or otherwise accommodate a metered dose canister (MDC) having a variety of shapes, structures, sizes, and/or configurations. The present breathing tube adaptor includes a sidewall which defines a chamber. A conduit extends from the chamber through a floor of the device for discharging aerosolized medicament from the MDC. The sidewall includes opposing exposed edges which define a channel. The sidewall supports the MDC when it is invertingly inserted into the chamber. The channel permits structure of an MDC to extend radially outward through the channel and outside the chamber thereby enabling the valve stem of the MDC to engage the conduit.
US09084858B2
An intravenous (“IV”) liquid delivery system includes: an IV pump tubing set; a shuttle pump or membrane pump actuator operable with the IV pump tubing set; upstream and downstream valve actuators operable with the IV pump tubing set; the IV pump tubing set including an air removal device; an air detector configured to sense air in the IV pump tubing set; a control unit configured and arranged to (i) open the upstream valve actuator and close the downstream valve actuator to allow the pump actuator to draw liquid into a pump actuation portion of the IV pump tubing set, and (ii) close the upstream valve actuator and open the downstream valve actuator to allow the pump actuator to push liquid out of the pump actuation portion, the system configured to attempt to remove the air via the air removal device while operating the upstream and downstream valve actuators according to (i) and (ii).
US09084849B2
An apparatus includes a housing, a medicament container and a movable member. The medicament container is configured to move within the housing between a first position and a second position in response to a force produced by an energy storage member. A proximal end portion of the medicament container includes a flange and has a plunger disposed therein. A first shoulder of the movable member is configured to exert the force on the flange to move the medicament container from the first position to the second position. A portion of the first shoulder deforms when the medicament container is in the second position such that at least a portion of the force is exerted upon the plunger. A second shoulder of the movable member is configured to exert a retraction force on the flange to move the medicament container from the second position towards the first position.
US09084839B2
An adhesive for use on skin comprises acid-functionalized polyacrylate, one or more polyvinylpyrrolidones, and a low softening point resin.
US09084831B2
A precursor of a molecular probe for imaging of pancreatic islets is provided. The precursor includes a polypeptide represented by any one of the following formulae (1) to (12), or a polypeptide having a homology with the foregoing polypeptide: *-DLSKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (1) *-LSKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (2) *-SKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (3) *-KQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (4) *-DLSK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (5) *-LSK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (6) *-SK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (7) *-K*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (8) DLSK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (9) LSK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (10) SK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (11) K*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (12)
US09084828B2
The invention relates to (among other things) oligomer-PTK inhibitor conjugates and related compounds. A compound of the invention, when administered by any of a number of administration routes, exhibits advantages over PTK inhibitor compounds lacking a water-soluble, non-peptidic oligomer.
US09084825B2
The invention provides a conjugate comprising (i) a selectivity agent which binds specifically to one or more neurotransmitter transporters selected from the group consisting of a dopamine transporter (DAT), serotonin transporter (SERT) or a norepinephrine transporter (NET) and (ii) a nucleic acid capable of specifically binding to a target molecule which is expressed in the same cell as the neurotransmitter transporter wherein said target molecule is α-synuclein or the mRNA encoding α-synuclein. The conjugates of the present invention are useful for the delivery of the nucleic acid to a cell of interest and thus, for the treatment of diseases which require a down-regulation of the protein encoded by the target nucleic acid as well as for the delivery of imaging agents to the cells for diagnostic purposes.
US09084824B2
A new pharmaceutical formulation for retinoid-containing soft gelatin capsules is disclosed. The new formulation comprises a soft gelatin capsule filled with a fill mass comprising a retinoid as an active ingredient, a natural vegetable oil, a partially hydrogenated natural vegetable oil and medium chain triglycerides. Optionally, the new formulation also comprises a natural wax. In a particularly preferred embodiment, the soft gelatin capsule comprises pig gelatin in the capsule shell in combination with the above fill mass.
US09084807B2
Disclosed is a composition comprising ligustroflavone, rhoifolin and hyperin, which is prepared according to rational weight ratio: 40% to 80% ligustroflavone, 5% to 45% rhoifolin and 1% to 40% hyperin. The composition can be used as a neuraminidase inhibitor for preventing and treating influenza, and can be formulated into pharmaceutically acceptable dosage forms.
US09084798B2
A pharmaceutical composition for treating diabetes is provided in this invention. The composition contains a lanostane compound as a potent component. A suitable source of the lanostane compound is a Poria extract from metabolite, sclerotium, or fermentation product of Poria cocos (Schw) Wolf. The Poria extract contains 1-60% of the lanostane compounds by weight of the extract, and is devoid of secolanostane.
US09084787B2
The invention is directed to methods of promoting the healing of spinal cord injury. The invention is further directed to methods of minimizing the extent of scarring following spinal cord injury. Such methods utilize novel compositions, including but not limited to extraembryonic cytokine secreting cells (herein referred to as ECS cells), including, but not limited to, amnion-derived multipotent progenitor cells (herein referred to as AMP cells) and conditioned media derived therefrom (herein referred to as amnion-derived cellular cytokine solution or ACCS), each alone or in combination with each other and/or other agents.
US09084786B2
Methods are provided of treating cardiac hypertrophy in a mammalian subject comprising administering to the subject an anti-hypertrophic effective amount of an ion channel TR-PV1 inhibitor. The methods include treatment of a symptom of cardiac hypertrophy in the subject comprises cardiac remodeling, cardiac fibrosis, apoptosis, hypertension, or heart failure.
US09084776B2
The present invention provides isolated monoclonal antibodies, particularly human monoclonal antibodies, that specifically bind to PD-1 with high affinity. Nucleic acid molecules encoding the antibodies of the invention, expression vectors, host cells and methods for expressing the antibodies of the invention are also provided. Immunoconjugates, bispecific molecules and pharmaceutical compositions comprising the antibodies of the invention are also provided. The invention also provides methods for detecting PD-1, as well as methods for treating various diseases, including cancer and infectious diseases, using anti-PD-1 antibodies. The present invention further provides methods for using a combination immunotherapy, such as the combination of anti-CTLA-4 and anti-PD-1 antibodies, to treat hyperproliferative disease, such as cancer. The invention also provides methods for altering adverse events related to treatment with such antibodies individually.
US09084770B2
Provided herein are methods, compounds, and compositions for reducing expression of an IGF-IR mRNA and protein in an animal. Also provided herein are methods, compounds, and compositions that inhibit expression of IGF-IR in an animal. Such methods, compounds, and compositions are useful to treat, prevent, delay, or ameliorate the tumor or cancer, or a symptom thereof.
US09084768B2
The present invention pertains to a vaccine comprising in combination non-live antigens of Lawsonia intracellularis, of Mycoplasma hyopneumniae and Porcine circo virus, and a pharmaceutically acceptable carrier. The invention also pertains to a kit comprising a first container having contained therein non-live antigens of Lawsonia intracellularis, one or more other containers having contained therein Mycoplasma hyopneumoniae and Porcine circo virus antigens and instructions for mixing the antigens of Lawsonia intracellularis, Mycoplasma hyopneumoniae, and Porcine circo virus to formulate one combination vaccine suitable for systemic vaccination.
US09084767B2
Described herein are tissue grafts derived from the placenta. The grafts are composed of at least one layer of amnion tissue where the epithelium layer has been substantially removed in order to expose the basement layer to host cells. By removing the epithelium layer, cells from the host can more readily interact with the cell-adhesion bio-active factors located onto top and within of the basement membrane. Also described herein are methods for making and using the tissue grafts. The laminin structure of amnion tissue is nearly identical to that of native human tissue such as, for example, oral mucosa tissue. This includes high level of laminin-5, a cell adhesion bio-active factor show to bind gingival epithelia-cells, found throughout upper portions of the basement membrane.
US09084766B2
The invention provides naphthofuran compounds, polymorphs of naphthofuran compounds, naphthofuran compounds in particle form, purified compositions that contain one or more naphthofuran compounds, purified compositions that contain one or more naphthofuran compounds in particle form, methods of producing these naphthofuran compounds, polymorphs, purified compositions and/or particle forms, and methods of using these naphthofuran compounds, polymorphs, purified compositions and/or particle forms to treat subjects in need thereof.
US09084756B2
Provided are methods of delivering at least one pharmaceutical agent to the central nervous system (CNS) of a subject, methods of treating a neurological disorder or pain in a subject that include administering at least one pharmaceutical agent onto a SEM graft in the skull base of the subject. Also provided are methods of treating a neurological disorder or pain in a subject that include forming a SEM graft in the skull base of the subject and administering at least one pharmaceutical agent onto the SEM graft in the skull base of the subject. Also provided are methods of forming a SEM graft in the skull base of a subject, compositions for administration onto a SEM graft in the skull base or into an endonasal reservoir or endonasal reservoir device in a subject, and devices for administering such compositions onto a SEM graft in the skull base of a subject.
US09084750B2
The antifungal mixture is designed for fighting human diseases and animal diseases of fungal, bacterial or other origin and for violation of bio-films on heterogeneous materials used both in human and veterinary medicine and for elimination of microflora from various objects coming in contact with humans or animals. The antifungal mixture uses the active component of the fungal organism Pythium oligandrum in the mixture with inert components; the said antifungal mixture contains 0.001 to 25 weight portions of the fungal organism Pythium oligandrum and 75 to 99.999 weight portions of inert components. The activity of the fungal organism Pythium oligandrum in the mixture arises at the moment when this organism gets in touch with humidity.
US09084744B1
The present disclosure relates to compositions and methods for treating, preventing and improving the condition and aesthetic appearance of skin, particularly, treating, preventing, ameliorating, reducing and/or eliminating fine lines and/or wrinkles of skin, where the compositions include natural plant constituents which increase expression levels genes, collagen replacement and retention, and cell proliferation of epidermis and dermis associated with the dermatological signs of aging. The compositions of the invention are topically applied to the skin, or are delivered by directed means to a site in need thereof, once daily in an amount effective in improving the condition and aesthetic appearance of skin.
US09084743B2
Provided herein are stable co-formulations of immunoglobulin and hyaluronidase that are stable to storage in liquid form at room temperature for at least 6 months and at standard refrigerator temperatures for 1-2 years. Such co-formulations can be used in methods of treating IG-treatable diseases or conditions by subcutaneous administration.
US09084742B2
The combination of 3-phenylsulfonyl-8-piperazinyl-1yl-quinoline or a pharmaceutically acceptable salt thereof with a second therapeutic agent, wherein the second therapeutic agent is selected from: (a) a therapeutic agent known to modify cholinergic transmission such as M1 muscarinic receptor agonists or allosteric modulators, M2 muscarinic antagonists, acetylcholinesterase inhibitors, nicotinic receptor agonists or allosteric modulators, 5-HT4 receptor partial agonists or 5HT1A receptor antagonists and NMDA receptor antagonists or modulators, glutamate antagonists, GABA-ergic antagonists, H3 antagonists, putative metabolic/mitochondrial modulators, or disease modifying agents such as β or γ-secretase inhibitors, Tau-targeted therapeutics, β-amyloid aggregation inhibitors and β-amyloid immunotherapies; (b) an antidepressant such as a tricyclic, a MAOI (Monoamine oxidase inhibitor) a SSRI (Selective Serotonin Reuptake Inhibitor), a SNRI (Serotonin and Noradrenaline Reuptake Inhibitor) or a NaSSA (noradrenergeric and specific serotonergic antidepressant); (c) an atypical antipsychotic, for example olanzapine, clozapine, prisperidone, quentiapine, aripriprazole or paliperiden; or (d) a therapeutic agent suitable for use in Attention Deficit Disorders/Hyperactivity Syndrome, e.g. methylphenidate (Ritalin) or dexamfetamine (Dexedrine), and also the use of 3-phenylsulfonyl-8-piperazinyl-1yl-quinoline or a pharmaceutically acceptable salt thereof for the treatment of: a) psychiatric disorders with prominent cognitive deficits e.g. chronic PTSD (Post traumatic stress disorder); b) non-degenerative disorders with prominent cognitive deficits e.g. MS (multiple Sclerosis), post-chemotherapy, post-CABG (Coronary artery bypass graft), post-stroke; and/or c) paediatric disorders e.g. autism, mental retardation and learning disabilities.
US09084732B2
The present invention relates to a cosmetic formulation including a cosmetically acceptable medium and at least one silver-colored pigment, the silver-colored pigment including a nonmetallic platelet-shaped substrate and at least one ilmenite-containing coating.
US09084730B2
The present invention relates to a solid pharmaceutical composition comprising a solid dispersion containing at least one active principle and a pharmaceutically acceptable polymer matrix, a characterized in that said pharmaceutically acceptable polymer matrix comprises a blend of (i) polydextrose, in the form of a continuous polydextrose phase, in order to promote the disintegration of the composition in an aqueous medium, and (ii) at least one polymer other than polydextrose, in the form of a continuous phase of this polymer, whereby the polydextrose is in a concentration of at least 20 wt % and the at least one polymer other than polydextrose is in a concentration of at least 20 wt % in relation to the total weight of said pharmaceutically acceptable polymer matrix.
US09084724B2
The present invention provides water-in-oil type emulsion sunscreen cosmetics that achieve an excellent UV blocking effect, and have excellent effects in the prevention and inhibition of discoloration (discoloration to red). The water-in-oil emulsion sunscreen cosmetic according to the present invention is characterized by comprising: (a) octocrylene; (b) hydrophobized zinc oxide; (c) cationic surfactant; and (d) silica.
US09084720B2
The present invention provides intravenous compositions of trehalose for the treatment of signs and symptoms of oculopharyngeal muscular dystrophy (OPMD).
US09084717B2
This invention describes a partially absorbable, fiber-reinforced composite in the form of a ring, or a suture-like thread, with modified terminals for use as a controlled delivery system of at least one bioactive agent, wherein said composite comprising an absorbable fiber construct capable of providing time-dependent mechanical properties of a biostable elastomeric matrix containing an absorbable microparticulate ion-exchanger to modulate the release of the bioactive agent(s) for a desired period(s) of time at a specific biological site; this can be a vaginal canal, peritoneal cavity, scrotum, prostate gland, an ear loop or subcutaneous tissue. Such drug delivery systems can be used for the local administration of at least one bioactive agent, including those used as contraceptive, antimicrobial, anti-inflammatory and/or antiviral agents as well as for cancer treatment.
US09084698B2
A diaper has an outer sheet and a crotch member which includes a pair of skin-contactable sheets spaced from each other in a transverse direction. Inner side edges of the respective skin-contactable sheets cooperate with respective second ends of front and rear waist members to define an opening. A plurality of crotch elastic members is attached to the inner side edges. Under the effect of these crotch elastic members, a length dimension of the skin-contactable sheets is substantially reduced. The inner side edges of the skin-contactable sheets are spaced from the outer sheet in a thickness direction to form a space between the skin-contactable sheets and the outer sheet. A liquid-absorbent structure is provided in the space and includes a fold formed by folding the structure along a folding line. A top of the fold is bonded to the inner side edges of the respective skin-contactable sheets.
US09084695B2
A pressure-sensitive adhesive tape package is provided. The pressure-sensitive adhesive tape package accommodates an adhesive tape having a support and an adhesive agent layer provided on one surface of the support, the adhesive tape being bent into a first portion and a second portion such that the adhesive agent layer faces outward. Moreover, the pressure-sensitive adhesive tape package can include a first release sheet releasably attached to the adhesive agent layer of the first portion of the adhesive tape, and a second release sheet releasably attached to the adhesive agent layer of the second portion of the adhesive tape to seal the adhesive tape with the first release sheet between the first and second release sheets. In this configuration, the conventionally existing package can be eliminated. Moreover, when the second release sheet is removed from the adhesive agent layer of the second portion of the adhesive tape, half of the adhesive agent layer is exposed.
US09084692B2
Stent delivery systems, clip members for use with stent delivery systems, and methods for making and using the same are disclosed. An example stent delivery system may include an inner shaft having a distal region. A stent may be disposed about the distal region. A deployment sheath may be slidably disposed about the inner shaft. A handle may be coupled to the inner shaft. The handle may include a clip member having a first holding portion and a second holding portion. The inner shaft may extend through the first holding portion and the second holding portion. A holding cuff may be thermally bonded to the inner shaft. The holding cuff may be positioned between the first holding portion and the second holding portion.
US09084685B2
A femoral prosthesis system is provided which includes femoral prosthesis and an instrument for inserting/extracting the femoral prosthesis. The femoral prosthesis includes a stem and a neck portion. The stem includes a proximal end portion which defines a proximal stem axis. The neck portion is located proximally of the proximal end portion. The neck portion includes a proximal surface and an insertion/extraction cavity which extends distally from the proximal surface. The insertion/extraction cavity is configured to couple with the insertion/extraction instrument. The insertion/extraction cavity defines an insertion/extraction cavity axis which, when projected onto a coronal plane including the proximal stem axis, is not parallel with the proximal stem axis. The insertion/extraction instrument includes a distal end portion configured to couple with the insertion/extraction cavity.
US09084680B2
A prosthesis to replace a portion of the anatomy, such as the humerus, can include a first shell. A second prosthesis can be positioned relative to the shell to provide the bearing surface to articulate with a glenoid prosthesis or glenoid. The second prosthesis can include a connection portion to engage a connection portion in the shell.
US09084666B2
A treatment device for the surgical correction of hyperopia in the eye comprising a laser device controlled by a control device. The laser device separating corneal tissue by applying laser radiation. The control device controls the laser device for emitting the laser radiation into the cornea such that a lenticule-shaped volume is isolated. Removal thereof effects the desired correction. The control device (12) predefines the volume such that a posterior surface and an anterior surface are connected via an edge surface that has a width in projection along the visual axis that is wider than the one which a straight line in the same projection, that is perpendicular at the edge of the posterior or the anterior surface would have relative to the associated surface and connects the anterior surface to the posterior surface or to the perceived extension thereof.
US09084665B2
A hand-held probe device capable of providing electro-stimulation and thermo-stimulation to a patient is described herein. While the probe device can include any suitable component, in some instances, it includes a probe head made with an electrically and thermally-conductive material. In some instances, the probe device also includes a temperature control mechanism that is configured to raise and lower a temperature of the probe head. The probe head is also connectable to an electro-stimulation unit (such as a transcutaneous electrical nerve stimulation unit) such that the probe head is able to provide electro-stimulation simultaneously with thermo-stimulation. Although the temperature control mechanism can include any suitable component, in some instances, it includes a thermoelectric device, such as a Peltier circuit. Other implementations are also described.
US09084664B2
Improved methods and apparatuses for treatment of incontinence or pelvic organ prolapse are provided. A neo ligament for increasing the supportive function of the tissues supporting the urethra, bladder neck, or rectum is disclosed. Methods of using such a neoligament to treat incontinence are disclosed. Additionally, a self tensioning elastic tissue bolster for support of the tissues that support the urethra, rectum, and bladder neck are disclosed. A method of treating incontinence by injecting proliferative agents into supportive structures is disclosed. Methods and apparatus for transvaginal and transperineal pelvic floor bolster treatment of incontinence and bladder pillar systems are also disclosed.
US09084660B2
An inhaler for the propellant-free nebulization of a medicament preparation produces a low speed aerosol. The inhaler is combined with an add-on device for intermediate storage of the aerosol produced. The inhaler has a tensioning device for the one-handed tensioning of a drive spring and release thereof. The inhaler is provided with a dispensing device for large animals.
US09084656B2
A dental aspiration device includes an inside housing having a proximal portion and a distal portion with an interior surface; an outside housing having a proximal portion and a distal portion with an interior surface; at least one of the interior surfaces of the inside housing and the outside housing including vacuum channels; a hinge connection mechanism hingeably connecting the proximal portions of the inside housing and the outside housing; and a locking mechanism for removably attaching the distal portions of the inside housing and the outside housing to each other.
US09084640B2
Disclosed are an apparatus for an interspinous fixation and/or distraction of vertebrae and a methodology for minimally invasive implantation of the apparatus in the spine of a patient. The apparatus corresponds to a pair of teardrop shaped lateral wing elements spaced apart by a central core element that may be selectively sized during the implantation process. The wings and central core are held together by a single threaded bolt and locking nut configuration resulting in a simple structure that may be easily implanted with minimal patient discomfort.
US09084639B2
There is provided a spinal implant device for placement between adjacent spinous processes and a pair of opposing facet joints. The spinal implant device includes a fusion cage, first and second fixation plates and a connector for connecting the cage to the plates. The fusion cage includes a superficial face, a deep face, superior and inferior saddle portions, and opposing cage ends. Each cage end defining a facet fusion surface sized and configured to respectively contact the opposing facet joints. The first and second fixation plate are sized and configured to extend along and in contact with the adjacent spinous processes. A method of implanting the device is provided. In another embodiment the device includes the fusion cage.
US09084637B2
An intervertebral implant comprising an intervertebral spacer and two fastener ties is disclosed. The intervertebral spacer may be formed having a body extending in a longitudinal direction. The intervertebral spacer may further include a first insertion face, a second face, and two recesses disposed at the ends of the body. The recesses may each be defined by a first extension, a second extension, and an end wall. Each of the two fastener ties may be secured to the first extension at a first end and a second end may be fastenable to the second face. The ties may pass around a spinous process in part and hold the spinous process within a recess. The first extension of the body may have a height relative to the bottom wall of the recess that is no greater than the height of the second extension.
US09084635B2
A number of spinal stabilization devices are disclosed for aligning and fixing vertebrae during surgery, e.g. to facilitate accurate placement of pedicle screws. One stabilization device includes a pair of spiked rails biased to clamp shut and thereby passively engage a number of vertebrae. Another stabilization device includes a tie-rod that connects two or more fiducial markers, each of which is connected to a vertebra, to stabilize the vertebrae including and between each vertebra to which the markers are attached.
US09084625B2
A battery assembly for use in a number of battery-powered, cordless ultrasonic surgical instruments with handles having a battery chamber and coupled to different ultrasonic waveguide types, comprises a housing having an exterior shape formed to removably connect with the battery chamber of the handles. The housing has at least one energy storage cell operable to power an ultrasonic-signal-generation assembly of the surgical instruments. The ultrasonic-signal-generation assembly is operable to dynamically produce a resonant wave along an ultrasonic waveguide. A battery/handle interface has a plurality of connectors shaped to mate with a plurality of corresponding connectors within the battery chamber of the handles. A voltage-control circuit communicatively couples with and provides power to the ultrasonic-signal-generation assembly, detects which one of the ultrasonic waveguide types is coupled to the handle connected to the housing, and provides an output in response to the detected waveguide type.
US09084624B2
A surgical instrument is provided, including: at least one articulatable arm having a distal end, a proximal end, and at least one joint region disposed between the distal and proximal ends; an optical fiber bend sensor provided in the at least one joint region of the at least one articulatable arm; a detection system coupled to the optical fiber bend sensor, said detection system comprising a light source and a light detector for detecting light reflected by or transmitted through the optical fiber bend sensor to determine a position of at least one joint region of the at least one articulatable arm based on the detected light reflected by or transmitted through the optical fiber bend sensor; and a control system comprising a servo controller for effectuating movement of the arm.
US09084616B2
Methods for treating an annulus fibrosis having a defect include inserting a flexible device into the defect. The flexible device is advanced distally beyond an outer layer of the annulus fibrosus. The flexible device is then expanded such that a width of the flexible device is larger than the defect, where the flexible device prevents escape of nucleus pulposus through the defect. The flexible device may have at least two appendages made from a shape-memory metal. Alternatively, the flexible device may have a U-shaped structure that includes a central portion and two legs. The flexible device may also be anchored to the annulus fibrosis and/or the vertebrae.
US09084615B2
Various exemplary methods and devices are provided for removing abnormalities from bone. In general, the methods and devices can be used to allow excess bone to be scraped from a bone surface. In an exemplary embodiment, a scraper tool is provided that includes an elongate shaft having a plurality of blades movably disposed therein. The blades can be configured to move as a unit between a retracted configuration, in which the blades can be entirely disposed within the elongate shaft, and an advanced configuration, in which at least a portion of the blades can extend distally from the elongate shaft and/or flare away from one another. A distal portion of each of the blades can have a radius of curvature corresponding to a radius of curvature of the bone to be scraped.
US09084605B2
Minimally invasive endoscopic and laparoscopic devices and methods for inverting and closing a diverticulum. Devices can include a closing component such as a loop, a clip, or a suture that can allow the diverticulum to be removed or to slough off after necrosis.
US09084601B2
A detachable motor-powered surgical instrument. The instrument may include a housing that includes at least one engagement member for removably attaching the housing to an actuator arrangement. A motor is supported within the housing for supplying actuation motions to various portions of a surgical end effector coupled to the housing. The housing may include a contact arrangement that is configured to permit power to be supplied to the motor only when the housing is operably attached to the actuator arrangement.
US09084591B2
The retractor system for use in spinal surgery and other types of surgical procedures that is a simple and efficient solution for minimally invasive access to thoracolumbar spine is disclosed. The fully customizable design allows the surgeon to independently angle the retractor blades and expand the retractor in both cephalad-caudal and medial-lateral directions. With an offering of a range of blade lengths, access can be tailored to the patient's anatomy. The retractor system provides versatility and control ensuring minimal tissue trauma.
US09084588B2
A surgical retrieval apparatus for receipt of multiple tissue specimens includes a collection bag, a support ring, and a flip ring. The collection bag includes first and second packets each having an outer portion and an inner portion. The first and second packets define first and second adjacent chambers, respectively, that are each configured for receipt of a tissue specimen therein. The first and second packets are coupled to both the support ring and the flip ring. The flip ring is pivotably coupled to the support ring and is rotatable relative to the support ring between a first position, wherein the first chamber is accessible for depositing a tissue specimen therein and a second position, wherein the second chamber is accessible for depositing a tissue specimen therein.
US09084586B2
In order to so improve a surgical drive unit of a surgical instrument, comprising a motor with at least two motor windings, and a memory device for storing data characterizing the drive unit and/or the motor, that the reliability of drive units, instruments and drive systems of the kind described at the outset is enhanced, it is proposed that the drive unit comprise a first transmitting and receiving device, which is connected to the memory device, and a second transmitting and receiving device, which is connected to at least two connection contacts of the motor, and that the first and second transmitting and receiving devices be configured and interact in such a way that data are transferable between them in a contactless manner.An improved surgical instrument and a further developed surgical drive system are also proposed.
US09084579B2
A method and a system for using tomosynthesis projection images of a patient's breast to reconstruct slice tomosynthesis images such that anatomical structures that appear superimposed in a mammogram are at conforming locations in the reconstructed images.
US09084576B2
A Doppler gate is automatically positioned in spectral Doppler ultrasound imaging. Samples acquired for multiple PW Doppler gates are used for B-mode and/or F-mode detection over time without interleaving transmissions for the PW Doppler. The B-mode and/or F-mode information are used to track gate placement. Alternatively or additionally, characteristics spectra from different gate locations are used to select a gate location. Either tracking may be used to change the locations sampled and/or beam characteristics, such as centering the locations and beam focus on the selected gate location.
US09084573B2
Minor traumatic brain injury is detected by operating (a) an image generator for presenting a visual stimulus having a predetermined movement across a visual field of a subject and (b) a sensor device for monitoring fast eye movement of the subject while the subject views the stimulus. The sensor device generates a signal encoding the subject's eye position. A computer or microprocessor operatively connected to the sensor device is configured for determining a parametric value for the fast eye velocity component.
US09084571B2
Unique characteristic sounds produced as urine impacts the surface of the water are used to monitor men's urinary flow patterns and their dynamics. By detecting the intensity at selected acoustic frequencies, it is possible to accurately and precisely measure the urine flow rate. Techniques for analyzing urine flow and its dynamics employ sound levels that are detected with digital filters at two or more distinct frequency regions or channels of the sound spectrum. One frequency region that is designated the measurement channel is where the sound measurement intensity strongly depends on urine flow levels. Another frequency region that is designated the reference channel is where the sound measurement intensity is not dependent on urine flow levels. By using a combination of measurements from the measurement channel and the reference channel, the urine flow monitoring apparatus compensates for variations in operating conditions and other factors during use.
US09084566B2
The invention provides methods and systems for evaluating a fluid transfer event between a parenteral fluid delivery and a patient. The evaluation of the fluid transfer event can be prospective real-time and/or historic, as desired, and take a variety of different formats.
US09084565B2
The invention relates to rehabilitation systems and methods for providing therapy to individuals who have suffered a stroke or other neurological insult. A rehabilitation system may comprise a depth sensing camera positioned to view a workspace into which a patient's hands may be located, a display system viewable by the patient, and an electronic computer executing a stored program to display a representation of a virtual space holding at least one virtual object, display a representation of at least one hand of the patient, and monitor a virtual manipulation of the virtual object by the patient's hand. Other embodiments may include virtual reality goggles, head motion tracking, various exercises and of varying difficulty, tracking metrics and recording for subsequent playback.
US09084564B2
A system for determining the surface shape of the cornea of an eye by analyzing the reflection of a spatially distributed ring pattern. The system includes an element for generating a ring pattern, an illuminating unit, an image capturing unit, and a control and analyzing unit. The element for generating rings is a fresneled axicon with annular structures of different radii. Furthermore, an optical element for illuminating the entire surface of the fresneled axicon with plane waves and an optical element for separating the illuminating and detecting beam path are arranged between the illuminating unit and the fresneled axicon. Furthermore, the image capturing unit consisting of an imaging system and an image sensor is designed for a telecentric distance-independent image detection.
US09084557B2
An endoscope light source apparatus includes a turret provided with a first optical filter and a second optical filter for transmitting an illuminating light, an instruction section in which an operation instruction of the turret is inputted, a drive section that drives the turret, a first detector that detects a position of the turret, a first detected portion for identifying a position of the first optical filter, a second detected portion for identifying a position of the second optical filter, a second detector that optically detects a position of the first or the second detected portion, and a turret control section that outputs a drive signal to the drive section to move the turret until the first or the second detected portion is detected by the second detector and stop the turret in response to the first or the second detected portion being detected.
US09084556B2
An apparatus and method for indicating locus of an ultrasonic probe configured to transmit and receive ultrasonic waves toward a part of a subject wherein a position or movement of the ultrasonic probe is detected, and a locus of the ultrasonic probe on an image of the part of the subject is indicated according to the detected position or movement.
US09084555B2
A method for determining a vascularity of an object located in a body is proposed. A multidimensional volume image of a target area of the body including the object is acquired. The object is segmented in the volume image. An expanded volume of the object is calculated by expanding structure edges of a volume of the object in the volume image with a predetermined size. The volume of the object is subtracted from the expanded volume of the object for determining an immediate vicinity of the object. A further object in the volume image having a determined minimum volume in the immediate vicinity of the object is segmented. A number of voxels of the further object is compared with a total number of voxels in the immediate vicinity of the object for determining the vascularity of the object.
US09084548B2
Systems and techniques are disclosed for determining the onset and offset of a ventricular fibrillation event and for distinguishing ventricular fibrillation from noise. In some examples, an electrocardiogram (ECG) signal is obtained; a transform is applied to the ECG signal to obtain an analytical pair, the analytical pair including the ECG signal and the transformed ECG signal; a speed-amplitude is determined from the analytical pair; and an onset of a ventricular fibrillation event is identified based at least one of a value of a cost function of the speed-amplitude over a window and a quantity of occurrences the speed-amplitude crosses a threshold over the window.
US09084547B2
A system and method for monitoring the status of a battery in an in-vivo imaging device, prior to use of the in-vivo imaging device. The device may include a frame counter for counting the number of frames captured and may include monitoring the voltage of the battery. A warning signal is generated if it is determined that the battery is faulty prior to use. The warning signal can be generated by the device and/or by a receiver which receives data from the in-vivo imaging device and/or a by workstation which receives the data from the receiver.
US09084546B2
Bioelectrodes having enhanced biocompatible and biomimetic features are provided. Methods of making and using the bioelectrodes are further provided. A biologically integrated bioelectrode device and method for detecting electronic signals using a bioelectrode comprising a first electrically conductive substrate and a biological component. The bioelectrode also comprises a conductive polymer electrically coupling the first electrically conductive substrate and the biological component to define a bioelectrode. The bioelectrode can transmit or receive an electrical signal between the electrically conductive substrate and the biological component and conductive polymer.
US09084545B2
An external medical device can include a housing and a processor within the housing. The processor can be configured to receive an input signal for a patient receiving chest compressions from a mechanical chest compression device. The processor can also be configured to select at least one filter mechanism, the mechanical chest compression device having a chest compression frequency f. The processor can be further configured to apply the at least one filter mechanism to the signal to at least substantially remove chest compression artifacts from the signal, wherein the chest compression artifacts correspond to the chest compressions being delivered to the patient by the mechanical chest compression device, and wherein the at least one filter mechanism substantially rejects content in the frequency f plus content in at least one more frequency that is a higher harmonic to the frequency f.
US09084544B2
A device for identifying appropriate nerve stimulation points on a patient is described, for use with an electrical stimulation device. In a first embodiment, the device includes electrodes located on a flexible substrate, a conductive gel layer overlying the electrodes, and a partially conductive removable cover overlying the gel layer. The device may be operated initially with the cover in place to allow reduced stimulation to identify a suitable nerve stimulation point. The cover may then be removed, and the device operated at the identified point. The cover may include perforations allowing the gel to contact the patient; or may be a sacrificial gel layer.
US09084541B2
According to one embodiment, an input unit repeatedly inputs a trigger signal originating from a specific cardiac phase from an electrocardiograph. An RR period determination unit determines whether the period between the input time point of the latest trigger signal, of repeatedly input trigger signals, and the input time point of an immediately previously input trigger signal is equal to or more than the preset first threshold, for each input of the latest trigger signal. A scan control unit terminates the generation of X-rays, if it is determined that the period is equal to or more than the first threshold.
US09084538B2
A system comprising a biometric monitoring device including a housing including a platform to receive at least one foot of the user, a body weight sensor to generate body weight data, processing circuitry to calculate user weight data which corresponds to the user's weight, using the body weight data, and communication circuitry to: (a) receive user identification data which identifies the user or a portable activity monitoring device, and (b) transmit the user weight data to data storage associated with the user identification data. The system further includes the portable activity monitoring device including a housing having a physical size and shape that is adapted to couple to the user's body, a sensor to generate sensor data, and communication circuitry to receive physiologic data which is based on the user weight data, and processing circuitry to calculate activity data using the sensor data and physiologic data.
US09084532B2
A motor drive apparatus mounted with an imaging probe having a transmitting and receiving unit which carries out signal transmission and reception continuously, comprises: a scanner unit; a pull-back unit; and an operation unit, wherein on the side surface of the scanner unit, there are formed, at positions where facing each other, a convex portion formed for a predetermined length along the straight-ahead direction of the scanner unit, and a concave portion having an upper end surface which forms an identical surface as a lower end surface of the convex portion.
US09084526B2
An automatic warewashing machine includes a washing chamber, a hinged door configured to close the washing chamber, and a force-locking latching mechanism configured to hold the door in a closed position and release the door in response to a pulling force. The force-locking latching mechanism is disposed on the washing chamber or on a body enclosing the washing chamber. A door opening system is also included and has a push-open unit configured to automatically open the door to at least an ajar position. The push-open unit includes a motor-driven push-type opening bar.
US09084521B1
The surface cleaning assembly for scrubbing a surface in a concealed location includes a handle that may be gripped by a user. A shaft is coupled to the handle. The shaft may be positioned proximate the surface. A bristle is coupled to the shaft. The bristle may scrub the surface.
US09084515B1
The Ten Toe Rejuvenator (TTR) is a 24.4 inch long ABS injection molded plastic with a front and rear bracket. A one inch wide band of fleece material is wrapped around the two brackets in a figure eight fashion. This design is to allow the user to hold one end of the TTR, place the fleece around a toe and wash and dry it completely or to apply medication. User may stand or sit while using the TTR.
US09084501B2
The Device to Assist Paraplegics with Getting Dressed is designed to lift a person that has a spinal cord injury or minimal use of their legs above the seat of a wheel chair, or a toilet seat, allowing easy slipping on or off of the pants. The device may be wall mounted wall adjacent to a seating fixture. The device may be mounted on a “free standing” frame, which may have wheels to make it easy to move around and may easily fold up for storage. To use the device a person will, with their arms out to their sides horizontally, put the armpit rest under their arm pit area. On reaching down towards the pants, the armpit rest will turn from horizontal to a vertical position, lifting them up enough to slip the pants on or off.
US09084499B2
A butter dispenser has a dispensing mechanism for dispensing a stick of butter from a housing or container whereby the dispensing mechanism may be separate from or integrated with the housing for containing the butter. The butter dispenser further provides for a dispensing mechanism that includes an automatically retractable dispensing mechanism for reloading the butter without requiring manual retraction of the dispensing mechanism to its fully retracted state.
US09084492B2
A portable kneeling apparatus for providing a selectively deployable fixed structure on which to kneel on comfortably. The portable kneeling apparatus comprises a rectangular body having a padded top surface and a solid bottom surface, two foldable fork legs disposed on opposing ends of the bottom surface of the rectangular body, and handle attached to one end of the top surface which turns both down and away from the portable kneeling apparatus. In this manner, the portable kneeling apparatus allows for the selective deployment of a padded surface secured to the ground by way of two fork legs which, when not deployed, is forms merely a substantially flat rectangular board structure which can be carried by most users with one arm.
US09084484B2
A shelving system having tubular frame members and plastic shelves, the shelves having frame receiving regions for receiving ends of the frame members. The shelves and frame members are connectable by insertion of the frame members into the frame receiving regions to form an openly configured, assembled shelving unit in which the shelves are connected to one another in vertically spaced relationship by the frame members. The shelving system has at least one closure member. The assembled shelving system and the at least one closure member both have an integrally molded connector structure. The integrally molded connector structures enable the at least one molded plastic closure member to be connected to the assembled shelving unit after the shelving unit has been assembled.
US09084473B2
A toothbrush can include a handle and a head. At least one bristle can be attached to the head. The toothbrush can also have an illumination member, an illumination circuit and an activation device. A pliant base on the handle can be used to activate the activation device to initiate the illumination circuit.
US09084465B2
Tools and methods are provided for removing biological units from a body surface utilizing a removal tool. The tools may incorporate retention members and mechanisms configured to impede movement of the biological unit in the direction of a distal end of the tool and to improve retention of the biological unit in the tool. Some of the retention members are stationary and some are movable within the lumen of the biological unit removal tools. The distal tips of the tools are desirably configured to reduce the chance of transection of a biological unit, such as by including both cutting segments and blunt relief segments. A number of dual concentric tube embodiments permit a division of removal functions. Distal fluid or gas delivery may be used to help separating biological units from surrounding tissue.
US09084464B2
The invention relates to a case (1), in particular a presentation case, comprising a housing (2), a carrying handle (3), and a part (4) that can be lifted up to open the case (1), wherein the case (1) comprises compartment dividers (9) parallel in particular to a base (6), said compartment dividers forming a plurality of compartments (8) for accommodating objects, and the part (4) that can be lifted up is formed on an access side of the compartments (8). In order to create a space-saving, light transport unit for accommodating as many objects as possible in the most compact and efficient manner possible, wherein quick access to individual objects from the compartments can be realized, the compartments can be extended in height (h-H).
US09084456B1
A mechanism and configuration by which one element of a jewelry piece depends from another by means of a concealed internal hook in the upper one and a loop on the lower one, with placement and orientation of said hook and loop such that the perimeters of the two elements are close when the components are connected, thus concealing said connection, and with said hooks and loops so oriented that all components tend to fall upon the long axis of the assembly, with repetition in accordance with the tastes of the user.
US09084455B2
A new and useful system, method and system components are provided, for helping a person to survive in certain situations at different scenarios when find him/herself trapped on it, while performing outdoor activities, in a manner that is efficient and effective, and in a manner that is designed in a compact and a low profile design, in a manner that is lightweight, comfortable and easy to wear it, in a manner that is handy and helpful. It has been designed to help a person to improve his/her skills and/or increase his/her opportunity of survive while trapped in a difficult situation.
US09084449B2
An article of footwear incorporates a textile upper. The upper comprises a knitted component. The knitted component may be warp knitted. The knitted component has an outer side and an inner side that can have different knit configurations. The knitted component can also incorporate portions of a single layer construction and portions of a double layer construction. The double layer construction forms pockets on portions of the knitted component. Inserts can be placed into the pockets to provide support, stability, or other desired properties to the portions of the knitted component.
US09084447B2
Laminates are described having a durable outer film surface for use in making lightweight liquidproof articles, including articles of apparel, such as outerwear garments. A method of making the laminate and a lightweight outerwear garment having an abrasion resistant exterior film surface is described.
US09084439B2
The invention provides a smokeless tobacco product comprising a tobacco extract. In some embodiments, the smokeless tobacco product is translucent. The invention further provides methods for making and using the smokeless tobacco product. In certain embodiments, the smokeless tobacco product comprises isomalt, maltitol syrup, and a translucent tobacco extract prepared by ultrafiltration.
US09084438B2
Methods of processing tobacco for the production of an oral tobacco product. According to one embodiment the method comprises providing a base blend of tobacco, delivering a pre-determined quantity of said base blend of tobacco to an individual consumer-portion container and introducing an additive to the tobacco directly in the container. Apparatuses for such methods are also provided.
US09084432B2
Disclosed are methods for administering hop acids to alter the microbial population of the gastrointestinal tract of animals and to inhibit the growth of pathogenic organisms in the gastrointestinal tracts of animals. Also disclosed are methods of increasing weight gain, feed efficiency, milk production in mammals, and egg and meat production in poultry by administering hop acids. Also disclosed are animal feeds containing hops and hop acids.
US09084431B2
A process for preparing a dry substantially pure and/or technical carnitine powder or granulate, from a substantially unpurified starting material containing a carnitine compound.
US09084421B2
The present invention relates to compositions of peracids, such as peroxycarboxylic acids, having reduced odor compared to conventional peracid compositions. The invention further relates to methods employing such compositions, and methods of making these compositions. Typically, the reduced-odor antimicrobial compositions include an alcohol for the esterification reaction to remove short- to mid-chain length malodorous carboxylic acids.
US09084410B2
A grooming tool or hair grasping device suitable for effectively and efficiently removing unwanted hair from an animal's coat. The device includes a handle portion extending along a handle axis and having a first end including a stripping surface. The stripping surface is substantially tapered in a direction transverse to the handle axis and may include a roughened surface.
US09084400B1
A novel soybean variety, designated XB49L12 is provided. Also provided are the seeds of soybean variety XB49L12, cells from soybean variety XB49L12, plants of soybean XB49L12, and plant parts of soybean variety XB49L12. Methods provided include producing a soybean plant by crossing soybean variety XB49L12 with another soybean plant, methods for introgressing a transgenic trait, a mutant trait, and/or a native trait into soybean variety XB49L12, methods for producing other soybean varieties or plant parts derived from soybean variety XB49L12, and methods of characterizing soybean variety XB49L12. Soybean seed, cells, plants, germplasm, breeding lines, varieties, and plant parts produced by these methods and/or derived from soybean variety XB49L12 are further provided.
US09084397B2
An environmental controlling system to better preserve cut flowers and other flora in vase water. The system uses thermoelectric modules, heat exchangers, fans, power supply, and a thermal conductor to cool and/or heat the water in a flower vase as required. By cooling the water, formation of algae and formation of a callus on the cut stem is reduced. In addition, keeping the stems in water of optimal temperature controls production of ethylene and other phytohormones. These effects prevent premature wilting, leaf abscission, flower senescence, and reduces the care required to maximize the life of cut flowers and other flora. In the event of cold ambient conditions that might cause freezing, the flow of heat can optionally be reversed, warming the water in the vase to avoid freezing the stems and/or maintain optimum temperature and other conditions for a specific variety of flora.
US09084390B2
An agricultural machine for working soil or for sowing seeds, including a trailed chassis and work elements distributed on a longitudinal bar in plural sections, the longitudinal bar including at least two primary beams extending substantially transversely to a direction of advance in a work configuration. A secondary beam is connected to each primary beam by two connection devices, the secondary beams support the work elements, and each secondary beam rests on the soil by two support wheels and is configured to move freely during work to follow a profile of the terrain.
US09089084B2
A method to control an optical transceiver, in particular, to drive an LD installed within the optical transceiver is described. The LD in the bias current thereof is determined by the automatic power control (APC) loop to keep an average of the optical output power. The modulation current is determined by a feedback loop to keep the extinction ratio (ER) in a preset range. The initial condition of the modulation current for the feedback loop is set by T-Im characteristic. The T-Im characteristic is first derived based on data measured in a status of the LD not installed in the transceiver. The T-Im characteristic is revised timely by the modulation current practically obtained for the optical transceiver.
US09089079B2
A gas cooling system for an electronic display is disclosed herein. A closed loop of circulating gas is preferably positioned to surround the electronic display. An open loop of cooling air preferably travels along the rear surface of the electronic display. In an exemplary embodiment the cooling air does not mix with the circulating gas. Heat may be transferred from the circulating gas to the cooling air in order to cool the display.
US09089078B2
A method of cooling a computer server that includes a plurality of server modules, and is positioned in an enclosed room, includes transferring heat generated by a server module of the plurality of server modules to a hot plate of a liquid cooling system. The liquid cooling system may be positioned within the server module, and the hot plate may have a surface exposed to the enclosed room. The method may also include positioning a cold plate of a room-level cooling system in thermal contact with the hot plate. The method may also include directing a cooling medium through the room-level cooling system to transfer heat from the hot plate to a cooling unit positioned outside the room.
US09089074B2
According to embodiments of the invention, a heat sink structure may be provided. The heat sink structure may include a first surface adapted to connect to an electronic component. The heat sink structure may also include a second surface adapted to provide heat transfer. The heat sink structure may also include a coating of radio-frequency absorbing material covering at least a portion of the second surface.
US09089067B2
Modular automation system and method are disclosed. A central automation device can be constructed and upgraded using one of a plurality of selectable and variously upgradable baseboards. The automation device can be upgraded using one of a plurality of central units which have uniform external dimensions yet differing data processing power and data storage capacities. At least one input/output expansion device can be directly coupled onto the central unit. Each of the selectable baseboards has a field bus connection interface for a standard field bus connection to a decentral input/output unit.
US09089061B2
The present invention provides a conductive film that includes a substrate, a first matrix layer, a first conductive layer, a second matrix layer, a second conductive layer, a light-shielding layer, a first lead electrode and a second lead electrode. A first grid groove and a second grid groove are formed in the first matrix layer and the second matrix layer, respectively, and the first grid groove and the second grid groove are filled with conductive materials, to form the first conductive layer and the second conductive layer, respectively. Accordingly, the first matrix layer and the second matrix layer may provide protection for the first conductive layer and the second conductive layer, and thus can improve the production yield. Furthermore, the present invention also provides a method for making the conductive film and a touch screen including the conductive film.
US09089058B2
A stackable electronic device with latching bumper includes a housing, an electrical connector, a latching mechanism having a linking module, a latching module and a button. The housing has a bottom board, a side board formed with a button hole, and a bumper disposed on the bottom board formed with a latching hole. The linking module is disposed on an inner side of the side board, and has a first end extended into the button hole and a second end extended into the bumper. The latching module is movably disposed in the bumper between a locking position and an unlocking position. The second end is connected to the latching module. The button can be pressed for driving the first end to move the second end corresponding to the locking position and the unlocking position. The present disclosure also provides a stackable electronic device system.
US09089050B2
The present invention provides a flexible circuit board with a heat dissipation layer on which bending processing can be carried out easily, while achieving its slimming down, and which can maintain the flatness of the heat dissipation layer. The flexible circuit board, at least, has a wiring layer 3a adapted to be electrically connected to a circuit element, an insulating layer 2, and a heat dissipation layer 3b, and which is characterized in that said wiring layer 3a is formed of a copper foil which has a tensile strength of 250 MPa or less and a thickness of 50 μm or less, and said heat dissipation layer is formed of a copper foil which has a tensile strength of 400 MPa or more and a thickness of 70 μm or more.
US09089046B2
An electronic module includes a circuit board, a plurality of electronic components, a plurality of molding layers, at least one first conductive layer, at least one insulating filler, and one second conductive layer. The circuit board has a first plane and at least one grounding pad on the first plane. The electronic components are mounted on the first plane and electrically connected with the circuit board. The molding layers cover the electronic components and the first plane. The trench appears between two adjacent molding layers. The grounding pad is positioned at the bottom of the trench. The first conductive layer covers the sidewall of the trench and the grounding pad. The grounding pad electrically connected with the first conductive layer. The insulating filler is positioned in the trench. The second conductive layer covers the molding layers and the insulating filler, and electrically connects with the first conductive layer.
US09089043B2
A first substantially annular conductive material has a first central opening, the first central opening is sufficient to substantially surround a fastener and maintain an electrical connection between the printed circuit board and the chassis. A second substantially annular conductive material is concentric with the first conductive material and the second conductive material hays a second central opening which is sufficient to substantially surround the fastener and maintain the electric connection between the printed circuit board and the chassis. A substantially annular impedance material is between and adjacent to the first conductive material and the second conductive material, the impedance material is sufficient to attenuate the electromagnetic interference from the system.
US09089026B2
The present disclosure relates to dimming circuit and method for LEDs. The dimming circuit obtains a DC voltage from an external AC power supply by using a TRIAC, an electronic transformer, and a rectifier bridge sequentially. The dimming circuit comprises a first power stage circuit, a second power stage, a first control circuit, and a second control circuit. The first power stage circuit has an input terminal configured to receive the DC voltage. The second power stage has an input terminal coupled to an output terminal of the first power stage and an output terminal coupled to an LED load. The first control circuit is configured to generate a first control signal in accordance with a first output voltage generated at the output terminal of the first power stage circuit, a first reference voltage and an upper threshold voltage to maintain an average value of the first output voltage to be consistent with the first reference voltage. The second control circuit is configured to generate a dimming signal in accordance with a first current and the first output voltage to control an operation of the second power stage circuit to maintain an output current of the second power stage circuit to be consistent with an expected driving current represented by the dimming signal. The first current is no less than a holding current of the electronic transformer. An input current of the first power stage circuit is maintained to be consistent with the first current by the first control signal when the first output voltage is in a continuously increasing state and is lower than the upper threshold voltage. The first output voltage decreases continuously and the input current is maintained to be consistent with a second current after the first output voltage reaches the upper threshold voltage.
US09089025B2
A system for communicating with a host using control signals over a 1-wire interface is disclosed. The system includes a driver coupled to the host by the 1-wire interface. Control signals are transmitted from the host to the driver for decoding by the driver controller. The control signals are pulse width modulation format signals which are interpreted by the driver as binary encoded command mode signals or analog encoded command mode signals, depending upon when the signals are received in relation to a preamble pulse and a post-amble pulse.
US09089021B2
The present invention relates to a controller of an AC-DC converter, which controls an LED lighting using electricity of AC 100V to 250V which is used in a building or home, and more particularly, to a controller of an AC-DC converter for LED lighting, which is capable of effectively controlling brightness of an LED lighting.
US09089016B2
In embodiments of the present invention improved capabilities are described for autonomous shifting of at least a portion of a lighting load off an energy distribution grid, comprising electrically connecting a lighting device to the energy distribution grid; causing the lighting device to interpret information obtained from an information source proximate the lighting device; and causing the lighting device to select from at least two different power sources based on the interpretation, where selecting may include a sharing of the load between the two different power sources, and where one power source may be the energy distribution grid.
US09089012B2
Current is regulated in an LED lamp by sensing, in a manner electrically isolated from a primary side of a transformer, an LED current in an LED; creating a digital control signal based on the LED current; transmitting the digital control signal from the secondary side of the LED circuit to the primary side; and controlling power delivered to the primary side based at least in part on the transmitted digital control signal.
US09089010B2
A safety overheat protection circuit for flexible heater wire used in heating pads and electric blankets. The heater wire includes a low melt temperature fuse-able layer and a conductive core. A polymetric positive temperature coefficient (PPTC) device is used in series with the heater wire in a configuration so that a hot spot anywhere along the length of the wire will cause the fuse-able layer to melt and the heater wire to short to the conductive core, increasing the current and causing the PPTC device to change to a high impedance state significantly removing power to the heater wire. In addition, dual circuits having the same operating target temperature are presented as a safe method of temperature control.
US09089008B2
A heater includes a heating element, a first electrode, a second electrode and a temperature controller. The heating element includes carbon nanotube layer and a binder. The carbon nanotube layer defines a number of wrinkles. The temperature controller is electrically connected to the heating element by the first electrode or the second electrode. The temperature controller is capable of controlling a temperature of the heating element by controlling a voltage and electric current applied to the heating element.
US09089007B2
Methods and substrate processing systems are provided for controlling substrate heating efficiency and generating a desired temperature profile on the surface of a substrate when the substrate is disposed on a substrate support surface of a substrate support assembly. The substrate support assembly is provided with minimum software control and hardware requirement and includes a heating element comprised of multiple heating elements sections. The heating element is connected to a power source for adjusting the temperature outputs of the multiple heating element sections and providing adjustable multi-heating zones and desired temperature distribution over the substrate support surface of the substrate support assembly within a process chamber.
US09088992B2
A method and an apparatus for controlling in-device coexistence interference (IDC) in a wireless communication system are provided. The present invention comprises transmitting IDC indication information including an unusable frequency band that is a frequency band in which performing communication is difficult because of IDC interference to a evolved NodeB (eNB), receiving Radio Resource Control (RRC) connection reconfiguration including IDC Discontinous Reception (DRX) configuration reconfiguring DRX relating the unusable frequency band based on the IDC indication information from the eNB and performing autonomously denial of Industrial Scientific Medical (ISM) transmission in the unusable frequency band by reconfiguring DRX based on the IDC DRX configuration.
US09088988B1
Systems, methods, and software for providing wireless backhaul to relay nodes associated with a wireless access node are provided herein. In one example, a method of operating a wireless access node is provided. The method includes transmitting a first beamformed backhaul link to a first relay node and a second beamformed backhaul link to a second relay node by at least allocating a first quantity of resource blocks of a carrier frequency to the first beamformed backhaul link and a second quantity of the resource blocks of the carrier frequency to the second beamformed backhaul link. When traffic load information exceeds a load threshold for the first relay node, then the method includes increasing a bandwidth of the first beamformed backhaul link for the first relay node by at least allocating a different amount of the resource blocks to the first beamformed backhaul link.
US09088982B2
Access to an access point is restricted to a plurality of client devices having wireless connections with the access point. The wireless connections conform to a wireless networking protocol. A first data transmission rate is the lowest data transmission rate defined by the wireless networking protocol. It is determined that a second data transmission rate is used between a first client device of the plurality of client devices and the access point. The second data transmission rate is the lowest data transmission rate used by the plurality of client devices. The second data transmission rate is greater than the first data transmission rate. Responsive to said determining that the second data transmission rate is the lowest data transmission rate used by the plurality of client devices, a beacon frame data transmission rate is set to the second data transmission rate.
US09088976B2
A radio resource request in a radio access network (RAN) may be handled differently depending whether provision of the requested radio resource has been specified as optional (discretionary) or not optional (not discretionary). In the former case, the radio resource request may be discarded, rejected or delayed. In the latter case, the radio resource request may be accepted. In one embodiment, a running timer at a UE may indicate that a radio resource optionally to be provided was not provided by a RAN. When a subsequent request for the radio resource is accepted, the timer may be cleared. One or more UE applications may accordingly selectively subject user-plane data to be exchanged via the RAN, to a back-off delay scheme, to promoting acceptable responsiveness at UE applications that are, e.g. being actively used by a user. Radio resource requests may including RRC Connection Request and Cell Update messages.
US09088975B2
An approach is provided for coordinating protocol adaptation layer (PAL) performance. The approach involves causing, at least in part, a schedule request message to be sent from a first PAL to a second PAL. The approach also involves causing, at least in part, a schedule response message to be sent from the second PAL to the first PAL. The approach further involves processing the schedule response message to cause, at least in part, a negotiated coordinated schedule between the first PAL and the second PAL.
US09088966B2
A network device is configured to receive, from a user device that is not subscribed to a network associated with the network device, a connection request identifying a particular service, of one or more services, to provide to the user device. The system may further identify a packet data network (PDN) to establish based on the particular service; identify one or more parameters, associated with the PDN and identifying a data flow, associated with the particular service, that can be provided to the user device; and establish the PDN based on the one or more PDN parameters. The PDN may permit only the data flow, associated with the particular service, to be transmitted to the user device. The system may further provide the data flow, associated with the particular service, to the user device via the PDN.
US09088964B2
A method for providing wireless online access comprises: establishing a wireless access signal space wherein a wireless communications link is established between a secondary wireless unit and at least one primary wireless unit, thereby providing a corresponding secondary subscriber with online access by data packet transmission between the primary wireless unit and the secondary wireless unit; and receiving, from an online access provider, a credited revenue amount in return for providing online access for the secondary subscriber.
US09088963B2
Approaches for resource efficient multicast communications in mobile satellite systems are provided. A wireless gateway is configured to encapsulate multicast signaling messages received from participating remote terminals. The encapsulation is compatible with the core network of the system, whereby the signaling is passed through the core network undetected. The signaling is received by a multicast gateway, and provides necessary IP and port addressing information for the multicast gateway to encapsulate the multicast session data in a manner compatible with the core network. Upon receiving multicast session data from a multicast server, the multicast gateway replicates and encapsulates each data packet with IP and port addressing for each participating remote terminal, which is also passed through the core network undetected. The wireless gateway receives the replicated data packets, and based on the encapsulation information, transmits each data packet via a broadcast transmission to each cell wherein participating terminals are located.
US09088962B2
A wireless access point (WAP) including: a station set identifier and a subnet controller. The station set identifier is configured to identify at least one set of at least two station nodes among the plurality of station nodes and complementary communication options for each station in the at least one set which facilitate concurrent communications between the WAP and the stations in the set. The subnet controller is configured both to generate subnets equal in number to a number of stations in at least one set, and for each subnet an associated beacon channel discrete from the beacon channels of other subnets, together with any required aggregate channels matching each station's identified communication option and an associated medium access control, and further to control transmission of data from the WAP to the at least two station nodes concurrently on the associated subnets.
US09088960B2
A network architecture uses an Application Server Autonomous Access (ASAA) server which allows paging and call routing across different types of wireless and wireline access networks. The ASAA server provides connectivity between an external voice or data network and a wireless transmit/receive unit (WTRU). The external voice or data network may be a public switched telephone network (PSTN) or a public data network (PDN), so that the connectivity between the external network and the WTRU is provided through the access networks using data from the ASAA server.
US09088957B2
Disclosed are devices and methods for provisioning of voice and other CS-domain services. A first server (22) comprises a call reception block (221) configured to receive an incoming voice call, from a first user equipment; a transmitting block (222) configured to send, in response to the reception of the incoming voice call, a paging request to a second server; a service request reception block (223) configured to receive, from the second server, an SGs service request message, and; a trigger block (224) configured to use the SGs service request message as a trigger to send an indication of user alerting to the first user equipment when the SGs service request message indicates that a second user equipment was in Connected mode.
US09088953B2
A wireless device has a plurality of radio systems. The current priority of each of the radio systems is determined. An upper bound for the transmit power of each of the radio systems is set in dependence on at least the current priorities of the radio systems and a current maximum permitted transmit power of the wireless device. The upper bounds for the transmit power of each of the radio systems are variable over time and are set such that the sum of the upper bounds does not exceed the current maximum permitted transmit power of the wireless device. For each of the radio systems, the transmit power of that radio system is limited such that the respective upper bound for the transmit power for that radio system is not exceeded.
US09088948B2
Various techniques for reducing power in a wireless network device are disclosed. In some embodiments, software routines within the device are modified to minimize the time during which the analog circuitry in a radio is powered. In some embodiments, the techniques make use of knowledge of implied delays associated with a particular network protocol. For example, in a CSMA network, there is a defined minimum period before the device can attempt to gain access to the media. The radio may be powered off during this defined period. In other embodiments, modifications to a protocol are disclosed which allow additional power savings.
US09088947B2
The present application discloses a method for a terminal to transmit a signal in a wireless communication system. In more detail, the method includes transmitting uplink data to a base station at a data transmission period. The data transmission period includes at least one power-reduction period divided into an activation period and a deactivation period, wherein the uplink data are transmitted to the base station in the activation period.
US09088943B1
A technique for deriving timing information across wireless base stations is disclosed. After initializing values for base station time-offset parameters, a server acquires reference coordinates of a wireless terminal, which are provided from an independent source, and also acquires values for one or more time-of-occurrences of events associated with signals that travel between the wireless terminal and the base stations. The server generates predicted coordinates of the wireless terminal, based in part on the current time-offset values, by using trilateration. The server then generates updated time-offset values, based on a method of least squares, in which each residual is a difference between the reference and predicted coordinates of each wireless terminal location, for one or more wireless terminals. The server modifies the time-offset values so as to minimize the least-squares function.
US09088939B2
Systems and methodologies are described that facilitate mapping multiple evolved packet system (EPS) bearers to a single relay eNB radio bearer. In particular, an upstream eNB can select a radio bearer of a downstream eNB for association to an EPS bearer; the selection can be based on a best effort match or substantially any logic. The upstream eNB can store an association between the radio bearer and EPS bearer for subsequent downstream packet routing. The upstream eNB can also provide an indication of the selected radio bearer to the downstream relay eNB to facilitate upstream packet routing therefrom. The upstream eNB can alternatively select the radio bearer of the downstream eNB for association to the EPS bearer based on a quality of service (QoS) class identifier (QCI) of the EPS bearer.
US09088938B2
Two access gateways are informed about each other's presence and identity, in order to establish a data path between them, thereby shortening the overall data path of data packets exchanged between two mobile nodes (MN), that are located in different networks. In particular, each access gateway is provided with the other gateway's address and additionally with the other MN's address for forwarding by the access gateway those data packets destined to the other MN to the other access gateway. A combination of Session Initiation Protocol messages (Invite and Ringing) and route optimization messages are used, so as to confer the information on the gateway's ID and MN's address to the gateways.
US09088935B2
A data communication device implemented in a portable terminal which the terminal includes at least two communication units for establishing a connection to an Internet communication network, wherein, the connections of the communication units to the respective network are made to determine the respective communication speeds; comparing and analyzing the respective measured communication speeds of the communication units; and selecting a communication unit having a higher or the highest communication speed to access the Internet to provide data communication.
US09088933B2
A wireless communications system transmits a first message including an anonymous discovery pilot identification code to a first terminal, receives a second message from a second terminal and determines whether the second message identifies the discovery pilot identification code. The system may transmit a third message identifying the first terminal to the second terminal responsive to the second message identifying the discovery pilot identification code. Transmission of the first message may be preceded by receiving a request message from the first terminal requesting permission to transmit a discovery pilot signal.
US09088927B2
A radio communication terminal including: a processor configured to communicate, when a reception quality of a radio signal of the base station is lower than a threshold value and when a first group identification information identifying a base station group to which the base station belongs is not received from the base station, to each of neighbor base stations sequentially in an intermittent reception period, to specify a specified neighbor base station of the neighbor base stations, the specified neighbor base station belonging to the base station group, based on whether a second group identification information is received from each of the neighbor base stations or not and based on the first group identification and the second group identification are same or not, to select the specified base station preferentially to which the terminal is to hand over, among the neighbor base stations.
US09088924B2
A method of implicit signaling to support In-Device coexistence interference avoidance is provided. A UE sends an IDC interference indication to an eNB. The indication indicates that a serving frequency becomes unusable due to a coexistence interference problem. The indication does not explicitly indicate a frequency index or a frequency location of the unusable serving frequency. The eNB determines the serving frequency as unusable in an implicit manner. The eNB also determines an implied unusable frequency region based on the received IDC indication. The implied unusable frequency region is between the serving frequency and the ISM band. In one advantageous aspect, the eNB configures a condition for the UE, such that the UE is refrained from sending IDC interference indications unless the condition is satisfied.
US09088922B2
The present invention comprises an apparatus and method supporting handover of mobile relay nodes, “RNs” (56), in a wireless communication network (60), in a manner that advantageously differentiates handling of control- and user-plane connections of the wireless communication devices (58) supported by the RN (56). Rather than conventionally anchoring the control-plane connections of relay-connected UEs (58) at the donor radio base station (54-1) supporting the RN (56), the donor radio base station (54-1) includes or is communicatively linked to an anchor node (100) that, from the perspective of the involved control plane entity or entities (70) in a supporting Core Network, “CN” (68), anchors those connections. The anchor node (100) facilitates handover between donor radio base stations (54-1, 54-2) such that the control-plane connections are retained at the anchor node (100) while the user-plane connections are switched to the target radio base station (54-2) receiving the RN (56) in handover.
US09088907B2
A wireless access point array having a plurality of access point radios, a monitor radio and an array controller. The array controller includes processes, methods and functions for verifying the operation of the access point radios. The access point radios may be verified by attempting to establish a data connection between the monitor radio and each of the access point radios.
US09088903B2
A system and methods for dynamic routing under extreme cognitive jamming environments are presented. Jammer signals emitted by a network protocol-aware cognitive jammer are scanned for at a router node in an ad-hoc wireless network, and jammer behaviors are detected based on signal characteristics of the jammer signals. A network dynamic pattern caused by the network protocol-aware cognitive jammer is classified based on the detected jammer behaviors observed over a period of time, and dynamic routing strategies of the first router node are adapted to achieve robust data delivery based on the network behavioral pattern. Data packets sent by the router node are routed to avoid nodes and routes that are affected by the jammer signals.
US09088895B2
An envoy device for performing transactions with a further device in proximity to the envoy device, the envoy device comprising: a first communication device configured to communicate with the further device that is located within a predetermined distance of the envoy device using a local short range communication link; at least one further communication device configured to communicate with the further device using at least one longer range communication link. The envoy device is configured to respond to detecting the further device within the predetermined distance of the envoy device to: establish communication with the further device using the local short range communication link; receive information from the further device regarding any further communication links that the further device has access to; transmit to the further device information regarding the at least one longer range communication link; and to commence a transaction with the further device using the local short range communication link.
US09088890B2
A method and apparatus is capable of encrypting short data in a wireless communication system When a terminal generates a short data burst in idle mode, the apparatus generates a Traffic Encryption Key (TEK) using a Cipher-based Message Authentication Code (CMAC)-TEK prekey derived from an Authorization Key (AK) related to Security Association (SA) between the terminal and a Base Station (BS). A nonce is constructed with a Packet Number (PN) identical to an uplink CMAC PN (CMAC-PN_U) transmitted together with a Ranging Request (RNG-REQ) message carrying the short data burst The short data burst is encrypted using the TEK and the nonce. A Medium Access Control (MAC) Protocol Data Unit (PDU) is generated by attaching a MAC header and a CMAC digest for integrity protection to the RNG-REQ message carrying the encrypted short data burst. The MAC PDU is transmitted to the BS.
US09088889B2
A method and system for managing awareness information relating to a mobile device's visibility with respect to other buddy devices, the system comprising; the mobile device, a mobile application listing one or more buddies, an application listener which tracks the one or more buddies zoom operations and radar zoom factors, and a server, the server comprising an encounter manager, an approach manager and a notification marshalling system.
US09088888B2
Data are communicated in a wireless network, between a transmitter and a receiver. The transmitter estimates a first channel response between the receiver and the transmitter, and generates a first key based on the first channel response. The data are encoded at the transmitter using a rate-adaptive code to produce encoded data, and scrambled using the first key before broadcasting. Subsequently, the receiver can estimate a second channel response to generate a second key to be used to descramble the broadcast data.
US09088886B1
A method of operating a data processing system to infer demographic information for a user of a wireless communication device comprises processing a plurality of call detail records (CDRs) to generate a plurality of call graphs having different time slices based on time ranges when data in the CDRs was collected, wherein the call graphs comprise nodes that represent individual callers and edges between the nodes that represent bi-directional communication between the individual callers. The method further comprises identifying neighbors of the user that have a high likelihood of sharing a common demographic attribute with the user based on communication features and structural features among the neighbors on one of the call graphs. The method further comprises identifying a most similar neighbor among the neighbors of the user that has a highest likelihood of sharing the common demographic attribute with the user.
US09088884B2
A method for assigning a Voice Control Continuity (VCC) server to a User Equipment (UE) in a telecommunications network includes receiving an indication that the UE is registering with the network or attempting to make or receive an IMS communication session. A telephony network routing identifier and a VCC point code are assigned to the UE. The telephony network routing identifier is sent to the UE through the network and the VCC point code for the UE is sent through the network to the HLR to update the UE's profile data in the HLR.
US09088882B2
A method and system may include receiving an incoming call from a caller at a mobile device. The call information including one or more of a priority level and a group based on the call; may be received. A call handling rule to apply may be determined based on the call information. It may be determined whether to automatically override the call handling rule based on the call information and an implicit override parameter. Notification may be provided based on the override determination.
US09088880B2
A femtocell base station (FAP) converts, when information concerning a SMS is received from UE (User Equipment), the received information concerning the SMS into a SIP (Session Initiation Protocol) message including the received information concerning the SMS and transmits the converted SIP message to the core network side. The femtocell base station converts, when a SIP message including information concerning the SMS is received from the core network side, the information concerning the SMS included in the received SIP message into a message that can be recognized by the UE and transmits the converted information concerning the SMS to the UE.
US09088878B2
A technique for use in communicating data messages to a mobile device with use of a host service in a communication system is described. The host service connects with a service node for establishing and maintaining an IP connection between the host service and the service node. The host service receives a data message for the mobile device, and determines whether the mobile device is logged on. In response to determining that the mobile device is logged on, the host service sends the data message to the mobile device without aid of the service node. Otherwise, the host service creates an enable message which identifies the mobile device and includes a subset of the data message, and sends it to the service node over the IP connection for subsequent forwarding to the mobile device in a wireless network.
US09088866B2
An architecture, system and method of use sends location based multimedia to participants of a geo-tour or other application using geo-boundaries and/or other location information. The method includes detecting when a user has crossed within a geo-boundary. The method further includes determining a content type to be sent to a mobile device based on preferences provided by the user. Additionally, the method includes sending user location specific content of the determined content type to the mobile device when the user has crossed within the geo-boundary.
US09088858B2
A depth processing system can employ stereo speakers to achieve immersive effects. The depth processing system can advantageously manipulate phase and/or amplitude information to render audio along a listener's median plane, thereby rendering audio along varying depths. In one embodiment, the depth processing system analyzes left and right stereo input signals to infer depth, which may change over time. The depth processing system can then vary the phase and/or amplitude decorrelation between the audio signals over time to enhance the sense of depth already present in the audio signals, thereby creating an immersive depth effect.
US09088854B2
According to an embodiment, a control filter coefficient is calculated in such a manner that a second spatial average of one or more complex sound pressure ratios at one or more target binaural positions when a first loudspeaker and a second loudspeaker emit a second acoustic signal and a first acoustic signal is approximated to a first spatial average of one or more complex sound pressure ratios at the one or more target binaural positions when a target virtual acoustic source emits the first acoustic signal.
US09088852B2
Examples of modular hearing devices and tools for disengaging a battery module from a main module of the canal hearing device are described. The disengagement tool may be used to switch the modular hearing device to the power OFF condition, or to completely remove the battery module therefrom. According to examples described, the disengagement tool comprises a receptacle cavity shaped to accommodate the lateral end of the modular hearing device, the cavity including features arranged to actuate a handle of the battery module for automatically disengaging the battery module upon insertion of the canal hearing device into the receptacle cavity. Other examples describe features for holding the battery module with the main module in either the ON or OFF positions.
US09088851B2
A thermoacoustic device array includes a substrate and a plurality of thermoacoustic device units located on a surface of the substrate. The substrate defines a number of recesses on the surface, and the recesses are spaced from and parallel with each other. Each thermoacoustic device unit includes a sound wave generator, a first electrode and a second electrode. The first electrode and the second electrode are spaced from each other and electrically connected to the sound wave generator. The sound wave generator is located on the surface and suspended over the recesses. At least one of the recesses is located between the first electrode and the second electrode, and one portion of the sound wave generator that is between the first electrode and the second electrode is suspended over the at least one of the recesses.
US09088845B2
A microphone mount for a music stand is provided. The microphone mount may include a clamping portion. The clamping portion may be used to releasably secure to a music stand shelf. A gooseneck may releasably connect with the microphone mount. The gooseneck may include a microphone clip which releasably secures a microphone. Therefore, a user may sing into a microphone and read music at the same time using the present invention.
US09088841B2
A signal processor including an equalizer responsive to an input signal and to a parameter signal, said equalizer configured to provide an output signal to an electro-acoustical transducer for compensating a frequency response of said electro-acoustical transducer; a transducer element for monitoring at least a physical parameter of said electro-acoustical transducer, said transducer element configured to provide a transducer signal, a processor block responsive to said transducer signal, configured to provide said parameter signal.
US09088836B2
A system of remote diagnostics comprising a guidance device having a guidance device identifier, the guidance device further including a communication module for communicating a service request message, the service request message including the guidance device identifier; and a diagnostics module able to communicate with the communication module of the guidance device and configured to receive the service request message of the communication module of the guidance device, the diagnostics module maintaining a data store associating the guidance device identifier with a service provider entity; wherein, the diagnostics module is configured to facilitate communication between the service provider entity and the communication module of the guidance device in response to receipt of the service request message from the communication device of the guidance device and based upon the association of the guidance device identifier with the service provider entity.
US09088815B2
A message injection apparatus including a memory, a processor, a connection unit communicatively coupled to a communication device, and an application operating in the memory that is configured to receive audio signals from the communication device and to transmit at least one audio signal to the communication unit based on an operational mode.
US09088809B2
A computer-implemented method includes receiving information expressing a user's interest in one or more media programs, obtaining information indicative of popularity for a plurality of media programs responsive to the received information by individuals other than the user, and transmitting one or more recommendations of media programs for display to the user, from the plurality of media programs that relate to the received information.
US09088807B2
A data communication architecture delivers a wide variety of content, including audio and video content, to consumers. The architecture employs channel bonding to deliver more bandwidth than any single communication channel can carry. The architecture includes intermediate network devices that may receive content and send content using different groups of communication channels. The network device may process content received across a first set of communication channels for transmission across a second set of communication channels different from the first set. Such processing may preserve a program order of the content during delivery to a destination device.
US09088797B2
A video processing apparatus with residue prediction includes a motion estimation/compensation unit to determine a matching block of a reference video frame, obtain a motion vector of a current block of a current video frame that is related to the matching block, and acquire neighboring reconstructed pixels adjacent to the current block and corresponding pixels adjacent to the matching block with the motion vector alignment. Additionally, a pseudo-residue generating unit is included and constructs pseudo residues according to the neighboring reconstructed pixels and the corresponding pixels, an arithmetic unit is included and generates first-order residues by subtracting the matching block from the current block, and a residue-predicting unit is included and derives second-order residues and corresponding information according to the pseudo residues and the first-order residues. Moreover, a post-processing unit is included and derives a reconstructed current block according to the second-order residues and its corresponding information.
US09088783B2
A picture encoding method of the present invention is a picture encoding method of predictively encoding an input picture with reference to pictures stored in a picture buffer, decoding the encoded input picture, judging whether or not the decoded picture is a picture for reference and whether or not the decoded picture is a picture for output which needs to be stored until its display time, and storing, in the picture buffer, the picture for reference and the picture for output based on the determination result.
US09088775B2
The present invention relates to a recording device, a recording method, a playback device, a playback method, a recording medium, and a program that enable a recording medium, such as a BD, storing a stream of base image and a stream of extended image obtained by encoding video data of a plurality of viewpoints using a predetermined encoding method to be played in a device incompatible with playback of video data of a plurality of viewpoints. In an Access Unit storing Base view video, encoding of an MVC header is prohibited. As for a view component stored in an Access Unit without an MVC header, definition is made so that view_id thereof is recognized as 0. The present invention can be applied to a playback device compatible with the BD-ROM standard.
US09088771B2
A mobile terminal as disclosed and broadly embodied herein may include a 3D display configured to display an object that includes a first and second images and a controller configured to change a magnification of the object that includes a first scaled image and a second scaled image and to correct a binocular disparity between the first and second scaled images. The controller may be configured to determine a binocular disparity between the first and second scaled images, determine whether the binocular disparity is within a prescribed range of disparity, reposition at least one of the first or second magnified images based on the determined binocular disparity, and control the display to display the corrected first and second scaled images.
US09088766B2
The marking of a video stream to impart a unique identifier commences by first identifying portions within the video stream readily susceptible to change in a visually imperceptible manner. Thereafter, a combination of visually imperceptible changes is applied to the identified portions at random intervals for randomly varying intervals to mark the video stream. Each change in the stream correlates a particular bit sequence so that a combination of different changes yields a string of bit sequences that can particularly identify the stream.
US09088754B2
An image processing device identifies first pixels representing an object and second pixels representing a background in a target image; sets, in the target image, a target range of pixels in which at least one first pixel and at least one second pixel are included; changes, to a second pixel, a first pixel that is included in the target range and is adjacent to the second pixel, thereby classifying the plurality of first pixels into at least one changed first pixel and remaining first pixels, the changed first pixel being a first pixel that has been changed to a second pixel, the remaining first pixel being a first pixel that has been unchanged; and determines a characteristic quantity by using pixel values of the remaining first pixels, the characteristic quantity relating to a number of colors in the object.
US09088747B2
To provide a video display system for allowing a user to look at and listen to video and sound on various means. A video display system has a video display device and a portable video display device, connected to each other for communication. The video display device produces own device video data and own device sound data to be displayed and reproduced, respectively, on the video display device; displays the own device video data and reproduces the own device sound data; encodes these data into a data format which the portable video display device is able to handle, to thereby produce other device video data and other device sound data; and sends to the portable video display device. The portable video display device receives these data, and decodes and displays the other device video data, and decodes and reproduces the other device sound data.
US09088745B2
An inspection apparatus, inspection system, inspection method, and inspection control program stored in a recording medium, each of which sets a reference point in a master image and a read image read from a printed image, which is to be used for detecting the positional shift between the read image and the master image, based on determination whether a pattern previously added to the printed image for detecting the positional shift is available or can be used to effectively detect the positional shift.
US09088742B2
An X-ray detector is disclosed. According to one aspect, the X-ray detector includes a plurality of light sensing pixels each including a photodiode for generating an electrical detection signal corresponding to incident light and a switching device for transmitting the detection signal. The X-ray detector additionally includes a gate driver for supplying a gate pulse to the switching device via a plurality of gate lines. The gate pulse may be configured to turn on the switching device. The X-ray detector also includes a read out integrated circuit for reading out the detection signal from the plurality of light sensing pixels. During a scrubbing period, in which gate scanning is performed at least once to initialize the photodiodes of the plurality of light sensing pixels, a plurality of gate pulses are supplied to each gate line during each gate scan.
US09088730B2
A shooting device includes: a display unit which is provided with a plurality of display areas; an image pickup unit which acquires an image by capturing a subject; a display control unit which controls the display unit so that an image displayed in a display area in a plurality of display areas is changed from a live view image to an image acquired by the image pickup unit at the shoot instruction when a shoot instruction is received, and an image displayed on the display area specified by the cancel instruction is changed to a specified image when the cancel instruction that specifies the display area is received; and a combined image processing unit which combines image data of the plurality of images displayed on the plurality of display areas, and generates image data of a combined image which is laid out as being displayed on the display unit.
US09088718B2
An imaging apparatus includes a first image shake correcting unit for correcting image shake and moves a correction lens in a direction perpendicular to the optical axis using detection information obtained by an attitude detection sensor. In a second image shake correcting unit, a translational motion detecting unit acquires information about an image captured by an imaging element from a pre-processing unit so as to detect the motion of the image in the translational direction. An in-plane rotational motion detecting unit detects the motion of the image in the rotational direction about the optical axis. A geometric deforming unit acquires detection information from the translational motion detecting unit and the in-plane rotational motion detecting unit so as to correct the image shake of the corrected image, which occurs when the image is subject to rotational correction based on the detection information obtained from the in-plane rotational motion detecting unit.
US09088717B2
An optical device with an imaging device for forming an image of a subject with a lens device, including a lens unit, a movable member making the lens unit movable within a plane orthogonal to the optical axis of the lens unit, an image pickup device imaging the subject image formed by the lens device, a fixed member limiting the movement of the movable member in the optical axis direction, at least three balls rolling between the movable and fixed member, a vibration detecting unit, and a pitch and yaw direction drive units for driving the movable member in the pitch and yaw directions within the optical axis orthogonal plane, respectively. The pitch and yaw direction drive units press the movable member toward the fixed member side by means of magnetic pressing forces caused by magnetic attractive action between drive magnets and yokes.
US09088716B2
Methods and apparatus for image processing suitable for use in wireless capsule endoscopy are provided. The image processing techniques exploit characteristic features of endoscopic images to enable low complexity compression. A color space conversion, coupled with lossless predictive coding and variable length coding are employed. Sub-sampling and clipping may also be used. The described image processing can be used both with both white-band imaging and narrow-band-imaging.
US09088711B2
A digital photographing apparatus and a method of controlling the digital photographing apparatus are provided. The digital photographing apparatus stores an image signal in a memory at the same time with the calculation of a horizontal AF evaluation value with respect to the image signal, and calculates a vertical AF evaluation value by using the stored image signal. Accordingly, exact AF detection may be performed with respect to images of all patterns.
US09088702B2
An imaging device includes: an image sensor that photoelectrically converts subject light to generate image signals; a storage portion that sets a second area within a first area so as to correspond to a specific area specified by a setting value for setting an extracting range of an image based on the image signals; a timing adjustment unit that adjusts the timing at which the image signals are read from the image sensor and written to the storage portion and the timing at which the image signals are read from the storage portion; an image conversion processor that performs predetermined processing on the image based on the image signals read from the image sensor; an output unit that converts processed image signals with continuous scanning timing into image signals of a predetermined format and outputs the image signals to a display unit.
US09088697B2
Embodiments generally relate to processing media streams during a multi-user video conference. In one embodiment, a method includes obtaining at least one audio file and obtaining one or more parameters from a remote user. The method also includes adding user-specified audio content from the at least one audio file to a media stream based on the one or more parameters.
US09088690B2
A video conference method, applied to a video conference system in a multi-way conference is provided. The video conference method includes: retrieving a first number of a plurality of terminals of the multi-way conference; determining whether at least one other terminal is requiring to join in on the multi-way conference; when the at least one other terminal is requiring to join in on the multi-way conference, increasing the first number of the terminals of the multi-way conference to a second number of the terminals; and determining a resolution of the video signal captured and transmitted by the video conference system according to the second number of the terminals. A video conference system using the video conference method, is also provided.
US09088688B2
A method is provided in one example embodiment and includes receiving video data associated with a meeting in a video conferencing environment; and displaying a plurality of images of participants of the meeting around a presenter or around collaboration material such that an overview of the participants is rendered on a display. The presenter or the collaboration material is rendered near a middle portion of the display. At least some of the participants are at one or more locations, which are remote from the display.
US09088680B2
An image reading device includes a first conveying unit that sequentially feeds a plurality of media placed in a tray one by one in a conveying direction, a second conveying unit disposed downstream of the first conveying unit in the conveying direction and conveys a medium among the plurality of media fed by the first conveying unit in the conveying direction, and an imaging unit disposed downstream of the second conveying unit in the conveying direction. The imaging unit captures an image of the medium conveyed thereto and generates image data of the medium.The image reading device detects the medium conveyed based on the image data, and stops conveying a next medium subsequent to the medium conveyed before the first conveying unit starts conveying the next medium. The image reading device resumes conveying the next medium when the medium conveyed is no longer detected based on the image data.
US09088679B2
The present invention provides an image forming apparatus and its control method that can suitably control processing of originals in a number larger than the maximum placeable number, while suppressing an increase in the cost and complexity of the control. To accomplish this, the image forming apparatus includes an ADF that conveys a plurality of originals sheet by sheet, and stops reading of the originals when the number of originals that have been conveyed reaches a predetermined number. Moreover, when the number of originals that have been conveyed reaches a predetermined number, in a case where a currently performed job is a first type of job, the image forming apparatus performs processing of read originals, and, in a case where a currently performed job is a second type of job, the image forming apparatus waits without performing processing of read originals.
US09088678B2
An image processing device includes: a display part on which various types of screens are displayed; a manipulation detecting part for detecting an input by a user on the screen of the display part; a setting part for setting an event to detect in response to the user's input among from multiple events by associating it with each screen displayed on the display part; an event determining part for running only an operational event determining routine corresponding to the event associated by the setting part with the screen being displayed on the display part of multiple operational event determining routines, each of which corresponds to the respective events, when the user's input is detected by the manipulation detecting part, thereby specifying the event corresponding to the user's input; and a controlling part for controlling operations based on the event specified by the event determining part.
US09088659B2
A method and apparatus are provided for provisioning call handling resources in a contact handling system. The method includes the steps of identifying a call handling resource within a first contact center, copying call handling data associated with the identified contact handling resource and writing the call handling data into a contact handling structure of a second contact center.
US09088655B2
Automated response processing includes receiving a first audible prompt from a called system and a response to the first audible prompt from a calling system during a first phone call. Automated response processing further includes determining, using a processor, a semantic identifier for the first audible prompt using semantic analysis and storing the semantic identifier of the first audible prompt in association with the response. The stored response is played responsive to determining that a semantic identifier for a second audible prompt played to the calling system matches the semantic identifier of the first audible prompt.
US09088653B2
In an example system for operating a call center, personal profiles of clients of a service of the call center are maintained. At least some of the profiles include contact information for entities in a trusted network designated by the respective clients. When a contact is received at the call center relating to a particular one of the clients, the call center automatically selects on of the designated entities to contact. The automatic selection may be made based on one or more of a number of factors, for example the location of the designated entity, the nature of the incident that prompted the initial contact to the call center, skills possessed by the designated entities, or other factors.
US09088652B2
In a particular embodiment, a method includes determining, at a processor, a first destination based on a communication associated with a source, wherein an account is associated with the source. The method further includes determining a storage value associated with the account, wherein the storage value is associated with an amount of available storage associated with the account. The method further includes routing the communication based on a comparison of the storage value to a threshold.
US09088650B2
Simulation is used to determine optimal dialer parameters for a predictive dialing system. A call history is logged over a period of time for a plurality of outgoing calls initiated by the predictive dialing system. The call history includes call data for each of the outgoing calls. A simulation is run on the call history by adjusting one or more dialer parameters and determining one or more values for those dialer parameter values that provide at least a target agent utilization within the simulation without causing a threshold abandonment rate to be exceeded within the simulation. Timing and/or quantity of outgoing calls to be initiated by the predictive dialing system are determined based, at least in part, on the one or more values for the dialer parameters determined from the simulation. The predictive dialing system initiates outgoing calls in accordance with the determined timing and quantity.
US09088649B2
A user of a personal computing device may identify an item of interest displayed in a user interface provided by a network-based service and would like to obtain more information. The user may submit one or more electronic contact requests to a contact service in communication with a contact distribution system in order to obtain more information. The contact distribution system determines accurate, real-time availability of service agents and enables communications between the customer and an agent to be established in accordance with user contact information provided by the user.
US09088646B2
All calls terminating to a customer's directory number are intercepted. If caller identification information can be presented, the call is forwarded to a service node for disposition. The service node reconfigures signaling information of the call so that the call is not intercepted, then forwards the call to the subscriber's telephone. When the call is answered, the service node states the name or telephone number of the calling party which has been retrieved from the signaling information. The caller can decide whether to take the call, deny the call, send the call to voice mail or send a sales refusal message or other disposition option.
US09088643B2
An approach for subscriber migration to alternative access networks is described. A subscriber migration platform determines a fault in a wireline voice network associated with a subscriber premise, determines that the subscriber premise is associated with a chronic account based on the fault, and migrates the subscriber premise from the wireline voice network to a wireless voice network.
US09088637B2
Methods and systems for an Ethernet IP phone chip are provided. In this regard, data may be received via a first port of an Ethernet switch in the Ethernet IP phone chip, and the port(s) via which the data is forwarded may be determined based on characteristics of the data. The Ethernet switch may receive data from a network via a first port, and communicate the received data to one or more on-chip interfaces via a second port. The on-chip interfaces may process the received data and may communicate video contained in the data to an off-chip video processing device. The Ethernet IP phone chip may receive video data from an off-chip video processing device via one or more on-chip interfaces, packetize the video data into one or more Ethernet packets; and communicate the packet(s) onto a network link via the Ethernet switch.
US09088636B2
Embodiment of the present invention include a method, system and computer program product for a data processing system for QoS based planning in a Web services aggregation. The system can include Web service aggregation and coordination logic configured to identify accessible Web services in a registry and to arrange an aggregation of the Web services for invocation responsive to requests received from communicatively coupled clients over a computer communications network. The system further can include QoS planning logic coupled to the Web service aggregation and coordination logic. The QoS planning logic can be enabled to measure both the individual performance of the Web services in an aggregation of Web services and also the cumulative performance of the aggregation of Web services. Finally, the QoS planning logic can be enabled to modify the aggregation of Web services responsive to measuring both of the individual performance of Web services in the aggregation of Web services and also of the cumulative performance of the aggregation of Web services.
US09088623B2
A collaborative system for more efficiently viewing streamed content in a time shifted manner utilizes collaborative home set-top box (STB) and a cloud component (the cloud STB) and a receiving device, such as an antenna or cable component, all cooperatively shared among a community of users. The cloud STB may further comprise a network accessible distributed part and/or a cross licensed portion of other home STBs. The home STB may be connected to the cloud STB and other home STBs over any local or wide area network topology infrastructure, such as the Internet. A group of home STBs may be cross licensed to each other within a community of users sharing the same viewing rights to a collaboratively copy content retained either in the system or among a plurality of shared user systems. Various network infrastructure configurations and streaming techniques, including unicast, multicast, and upstream and downstream collaborative streaming, are proposed to optimize network bandwidth efficiency and increase viewing options.
US09088622B2
The disclosure generally describes computer-implemented methods, software, and systems for modeling and deploying decision services. One computer-implemented method includes establishing a push-channel session uniquely associated with a client, wherein the push channel session communicates with the client using a single push channel. The computer-implemented method further includes registering the established push-channel session with a messaging channel runtime creating a client-specific messaging channel and registering a backend application with the push-channel-session-associated single push channel using a push channel registration session. The method further includes, responsive to an application message received from an application session associated with the backend application using a client-specific application channel, dispatching the received application message to the push-channel session from the messaging channel runtime using the client-specific messaging channel. The method includes communicating the dispatched application message to the client using the single push channel.
US09088612B2
A network socket application programming interface (API) running on a communication device is operative to provide, to applications running on the device, information about the performance of communication links used by sockets for communicating across a network. The socket API receives packets associated with sockets, and retrieves from the packets performance information for corresponding communication links. In response to receiving a request from an application for performance information associated with a particular socket, the API identifies performance information for the particular socket and returns the retrieved information to the application. A performance monitoring network device provides the performance information. The performance monitoring device stores information about the performance of a plurality of communication links used by sockets of communications devices in the network, and inserts the performance information for particular sockets into associated packets before transmitting the packets to corresponding communication devices.
US09088610B2
An apparatus for accelerating communications over the Ethernet between a first processor and a second processor where the communications include CIP messages, the apparatus comprising a network accelerator that includes memory locations, the accelerator associated with the first processor and programmed to, when the second processor transmits a data packet to the first processor over the Ethernet, intercept the data packet at a first processor end of the Ethernet, extract a CIP message from the data packet, parse the CIP message to generate received data, store the received data in the memory locations and provide a signal to the first processor indicating that data for the first processor in stored in the memory locations.
US09088609B2
Provided are techniques for to enable a virtual input/output server (VIOS) to establish cryptographically secure signals with target LPARs to detect an imposter or spoofing LPAR. The secure signal, or “heartbeat,” may be configured as an Internet Key Exchange/Internet Protocol Security (IKE/IPSec) encapsulated packet (ESP) connection or tunnel. Within the tunnel, the VIOS pings each target LPAR and, if a heartbeat is interrupted, the VIOS makes a determination as to whether the tunnel is broken, the corresponding LPAR is down or a media access control (MAC) spoofing attach is occurring. The determination is made by sending a heartbeat that is designed to fail unless the heartbeat is received by a spoofing device.
US09088608B2
In one embodiment, a switch in a computer network may receive a neighbor solicitation (NS) message for a target node for which no neighbor authentication (NA) reply has been received at the switch. The switch may then determine whether to forward the NS message to only non-constrained links of the switch, or to both non-constrained links and constrained links of the switch. The determining may be configured to intermittently result in forwarding the NS message for the target node to both the non-constrained links and the constrained links. The switch may then forward the NS message according to the determination.
US09088602B2
Method and arrangement in a mediating function (204) for supporting detection of fraud in a network, when a network security function (200) is employed for analyzing activities in the network in view of predefined alert criteria, and a fraud detection function (202) is employed for analyzing e.g. charging information of users. When a first alert is received from a first one of the network security function and the fraud detection function, indicating that the predefined alert criteria of said first function have been satisfied, the alert criteria of the second one of said network security function and fraud detection function are modified based on the received first alert. Thereby, the network security and fraud detection functions can be correlated and made more efficient regarding accuracy and/or speed in detecting fraud.
US09088600B2
A method for implementing a SIP feature includes, in particular embodiments, establishing a communication session via a communications platform between a first and second user and receiving a request from a third user to join the communication session. The second and third users are from a plurality of users using a shared line. The method further includes integrating communications of the third user into the communication session. In particular embodiments the method includes establishing a communication session between a first and second user via a communications platform. The method also includes receiving a select request that locks the communication session so that a third user cannot resume the communication session with the first user. In particular embodiments the method includes receiving a request from a first user of a shared line to enable a privacy feature that reduces call information generated by the communications platform in remote state notifications.
US09088596B2
Systems, methods, and media for generating sanitized data, sanitizing anomaly detection models, and generating anomaly detection models are provided. In some embodiments, methods for sanitizing anomaly detection models are provided. The methods including: receiving at least one abnormal anomaly detection model from at least one remote location; comparing at least one of the at least one abnormal anomaly detection model to a local normal detection model to produce a common set of features common to both the at least one abnormal anomaly detection model and the local normal detection model; and generating a sanitized normal anomaly detection model by removing the common set of features from the local normal detection model.
US09088588B2
A system that incorporates the subject disclosure may include, for example, a method for receiving and granting, by a first session border controller, registration requests from a plurality of communication devices, where the plurality of communication devices are assigned to a second session border controller as a primary source for communication services, and where the registration requests are received responsive to the second session border controller being unable to provide services to the plurality of communication devices. The method can further include receiving, by the first session border controller, a re-registration request from one of the plurality of communication devices, and transmitting, by the first session border controller, a message to the one of the plurality of communication devices responsive to receiving the re-registration request to cause the one of the plurality of communication device to register with the second session border controller. Other embodiments are disclosed.
US09088587B2
Disclosed is a method, a communication system, and a communication device for transmitting data to a first subscriber, within the framework of a connection signaling from a first primary service communication device of the first subscriber to a second primary service communication device, a primary address information message associated with the first primary service communication device and a secondary address information message associated with a first secondary service communication device of the first subscriber is transmitted to the second primary service communication device. The transmitted address information messages are identified and stored via the primary service communication device. For the transmission of data to be transmitted to the first subscriber, the stored secondary address information message is transferred from the second primary service communication device to a second secondary service communication device, and is transmitted based on the transferred secondary address information message during transmission to the first secondary service communication device.
US09088581B2
Methods, apparatus, and computer readable storage medium for authenticating assertions of a source are disclosed. In one aspect, a method for authenticating an assertion of a source in an environment of distributed control include receiving a notification of the assertion; determining an entity responsible for maintaining an authenticated list of assertions by the source based on a first trusted public record, determining an assertion authenticator for the entity based on a second trusted public record, determining one or more assertions of the source from the assertion authenticator, and authenticating the assertion based on the determined one or more assertions.
US09088579B2
According to one embodiment, a communication device is described that comprises a determining circuit configured to determine a type of an information indicated by a first message, wherein the first message is formed in accordance with a first transmission protocol; a selecting circuit configured to select a type of message according to a second transmission protocol based on the determined type of information; and a message generating circuit configured to generate a second message of the selected type according to the second transmission protocol indicating the information.
US09088576B2
An aspect of electronic media creation and distribution includes receiving an electronic media collection including pre-assembled media content generated by a service provider computer, modified pre-assembled media content generated by a subscriber entity, and custom generated media content from end user computers associated with the subscriber entity. A further aspect includes receiving a media content item, as the custom generated media content, from one of the end user computers, receiving a request from the end user computer to publish the media content item, determining a content channel selected by the subscriber entity, and determining a frame associated with the content channel. A further aspect includes integrating the media content item with the pre-assembled media content and the modified pre-assembled media content, and distributing the electronic media collection to at least one other end user computer for presentation on a display device.
US09088569B2
Systems and methods to manage access to shared resources are provided. A particular method may include receiving a request to access a shared resource from a first client of a plurality of clients and determining whether the shared resource is being used. A first window credential associated with the first client may be retrieved. The first window credential may be one of a plurality of window credentials associated with the plurality of clients. The first window credential may be used to access the shared resource.
US09088559B2
A method for sharing login status between an application platform and an application, both running on a client device, is performed at a computer. In response to a login request from the client device, the computer analyzes the login request to determine whether the login request is associated with the application platform or the application. If the login request is with the application platform, the computer then establishes a first connection with an application platform server and forwards the login request to the application platform server. Upon receiving a login key from the application platform server, the computer returns the login key to the client device. If not, the computer establishes a second connection with an application server and forwards the login request to the application server. Upon receiving a login key from the application server, the computer then returns the login key to the client device.
US09088551B2
The present invention is directed to a system, method and computer program for easily and securely managing multiple keys on a computer, each key being used to access one or a plurality of computing resources. The method comprises the steps of receiving a command for selecting a key among one or plurality of keys, each key comprising one or a plurality of key fields; receiving a command for activating a computing resource corresponding to the selected key in order to have access to the computing resource; retrieving and displaying on a computer screen, the one or plurality of key fields associated with the selected key; displaying on the computer screen one or a plurality of input fields, each input field being used to enter the content of an appropriate key field associated with the key selected to access the activated computing resource; passing, in response to an action of a pointing device on a displayed key field, the content of the key field in an appropriate input field of the activated computing resource; and having access to the activated computing resource when all key fields of the selected key have been passed to the appropriate input fields.
US09088546B2
Systems, methods and apparatuses of establishing an IPsec (Internet Protocol Security) VPN (Virtual Private Network) tunnel are disclosed. One method includes receiving, by a wireless mesh network access point, a user configuration, wherein the user configuration includes a type of traffic, determining an internal interface of the wireless mesh network access node based on the type of traffic, dynamically determining a local endpoint address for the IPsec VPN tunnel based on the selected internal interface, establishing the IPsec VPN tunnel through the selected internal interface of the wireless mesh network access node, and encapsulating non-IP packets of non-IP traffic within IP packets.
US09088537B2
Methods for selecting an initial agent for an agent transaction context (ATC) are presented, the ATC configured to process a transaction utilizing a number of active agents in a multiagent system using a computing device including: causing the computing device to determine whether an agent having a top priority message is present, where the agent is one of the number of active agents in the multiagent system; if the agent having the top priority message is present, causing the computing device to determine whether the agent having the top priority message is processing; and if the agent having the top priority message is not processing, causing the computing device to select the agent having the top priority message as the initial agent for the ATC.
US09088536B2
An information distribution service system includes a mobile terminal device with a communication part and another terminal device connected to the mobile terminal device via the communication part. The mobile terminal device includes a server function part that provides information to another terminal device; an email control part that sends information, regarding an access method for accessing the information with another terminal device, to another terminal device via an email; and a server access control part that operates the server function part so as to start processing for providing the information when another terminal device makes an access according to the access method.
US09088530B2
In one embodiment, a system and method include determining bandwidth of a link that connects a local modem to a remote router. A first percentage of the bandwidth is assigned to a first class of data and a second percentage of bandwidth is assigned to a second class of data. The remaining percentage of the bandwidth is assigned for nominal excess capacity. The flow of first class of data and second class of data are controlled to below respective percentages of the bandwidth.
US09088529B2
Described is a system and methods for multiple tier distribution of task portions for distributed processing. Essentially, a task is divided into portions by a first computer and a task portion transferred to second participatory computer on the network, whereupon an allocated task portion is again portioned by the second computer into subtask portions, and a subtask portion transferred by the second computer to a third participatory computer on the network, whereby distributed processing transpires, and results collated as required.
US09088514B2
Systems and methods for implementing FlexRay communications between FlexRay nodes using Ethernet are provided. An Ethernet switch includes ports, each of which receives an Ethernet data packet (EDP) from a respective FlexRay node. Each EDP includes a FlexRay message, which includes at least one of a data frame and a frame identification (ID). A first EDP is received at a first port no later than a second EDP is received at a second port. The Ethernet switch also includes a controller module that determines whether the second EDP has higher priority than the first EDP based on the frame IDs associated with the first and second EDPs. The controller module is configured to route the second EDP to a second destination no later than routing the first EDP to a first destination and meet FlexRay transmission cycle times when it has been determined that the second EDP has higher priority.
US09088504B2
Systems, methods, and devices for communicating long packets are described herein. In one aspect, an apparatus for wireless communication includes a receiver and a processor. The receiver wirelessly receives via wireless local area network a data unit comprising a plurality of training fields interposed between data symbols. The plurality of training fields includes a first training field followed by a second training field. The first training field includes a gain control sequence, and the second training field includes a channel estimation sequence. The processor decodes at least one data symbol based on the plurality of training fields. In another aspect, an apparatus for wireless communication includes a processor and a transmitter. The processor generates a data unit comprising a plurality of training fields inserted between data symbols, and the transmitter wirelessly transmits the data unit via wireless local area network.
US09088499B2
According to an example, a routing generation method and apparatus is applied in Fiber Channel over Ethernet (FCoE). Based on the additions to the TLV, which may be carried in the Hello packet and the LSP packet, the Hello packet of the ISIS protocol may be used to implement neighbor discovery of the FC protocol, and the LSP synchronization of the ISIS protocol may be used to implement the link information synchronization of the FC protocol. Thus, the FC routing may be generated without the FSPF. Therefore, FCoE may be implemented with a lower cost.
US09088482B2
A system and method are provided for optimizing maintenance of a geographically distributed data processing system. The method comprises selecting a primary territory having associated operating hours, identifying maintenance hours that exclude the operating hours, and selecting a maintenance time within the available maintenance hours. The midpoint of the maintenance hours may be selected as the maintenance time, or activity distribution data may be analyzed to select a maintenance time corresponding to a low activity time.
US09088481B2
Individual network activities are correlated to interactions with a target web page to facilitate an analysis of the performance of the web page. This correlation is preferably performed using a combination of heuristics and rules developed to filter network activities into those activities that are likely to have been caused by the particular transaction, and those that are unlikely to be associated with that transaction. The activities that are identified as being associated with the transaction are subsequently organized to identify a time-flow of these activities within the transaction, from which performance statistics can be determined and presented to a user. Because the individual activities within the transaction are identified and time-ordered, an analysis of the effects of each activity on the overall performance of the web page can be performed to identify potential problem areas, or to diagnose reported problems.
US09088476B2
A method of operation of a network communication system includes: analyzing a packet header by: loading a packet input register, generating a forwarding hash from the packet input register, and identifying a routing update by comparing the forwarding hash; accessing a packet analysis bus for updating the packet header; and enabling a routing switch for forwarding a packet including the packet header updated.
US09088475B2
A service management system may include a data storage device storing a hierarchy of a network in a user premises. The hierarchy may include virtual network layers and devices in each layer. The devices may be connected to the network in the user premises. The storage device may also store service profiles for services associated with the virtual network layers and the devices. The system can create services for the devices and identify services to trigger based on data received from the devices and the hierarchy.
US09088473B2
In a data communication system according to one aspect of the present invention, a data carrier driving apparatus, which communicates with a data carrier apparatus using a rectification smoothing circuit for generating a power supply voltage, controls a pulse width of each pulse of a clock signal (pulse voltage) supplied to the data carrier apparatus. The data carrier driving apparatus sets the duration of each pulse of a pulse voltage generated by the data carrier driving apparatus, so as to suppress a decrease in the level of the pulse voltage caused by a charging operation for the rectification smoothing circuit, particularly, such that the duration in which the pulse voltage becomes a high-level voltage is longer than or equal to the duration in which the pulse voltage becomes a low-level voltage during one period.
US09088462B2
Embodiments of the present invention provide a method, system and computer program product for shared data storage in page processing over a computer communications network. In an embodiment of the invention, a method of shared data storage has been provided for page processing over a computer communications network. The method can include registering a content browser executing in memory of a computer with a remote storage service and receiving content from a content server over the computer communications network. The method additionally can include invoking in the content browser an instance of a localStorage object to cache data associated with the content according to a unique key. Thereafter, in response to the invocation of the instance of the localStorage object, the data can be stored in the remote storage service in reference to the unique key.
US09088456B2
A method, transmitter node, and receiver node for communicating a transport block of information bits from the transmitter node to the receiver node are provided. The transmitter node encodes the information bits and divides the coded bits into antenna selection bits and modulation bits. The antenna selection bits are used to select a transmit antenna from a plurality of transmit antennas. The modulation bits are used by a modulator to select modulation symbols for transmission utilizing the selected antenna. The receiver node receives the radio signal with a front-end receiver and computes a plurality of combined signals, each corresponding to one hypothesized transmit antenna at the transmitter node. The receiver forwards the plurality of combined signals to a soft value computer, which computes soft values for the antenna selection and modulation bits. The soft values are combined and decoded to produce decision bits for recovering the transport block.
US09088448B2
The calibration method, performed on a phased array device including channel elements coupled in parallel by a transmission line, has the steps of: obtaining channel responses corresponding to the channel elements through the transmission line, and each of the channel responses is obtained when one of the channel elements is turned on, and the rest of the channel elements are turned off; calculating a characteristic value corresponding to the transmission line based on the obtained channel responses of the channel elements; and adjusting a channel parameter of one of the channel elements based on the characteristic value of the transmission line.
US09088442B2
Embodiments of the present invention disclose a method, an apparatus, and a system for sending and receiving service data, where the method includes: first, obtaining, by a sending end, a target modulation mode different from a current modulation mode; and then, generating, by the sending end, invalid data, and temporarily storing service data at the same time; and then, performing encapsulation and mapping on the invalid data, switching the current modulation mode to the target modulation mode, modulating encapsulated and mapped invalid data according to the target modulation mode, and sending modulated invalid data to a receiving end; and finally, after the sending end completes the encapsulation and mapping on the invalid data, performing encapsulation and mapping on the temporarily stored service data, modulating encapsulated and mapped service data according to the target modulation mode, and sending modulated service data to the receiving end.
US09088439B2
The present disclosure relates to a networking device, a system and a method for the creation of a portable proximity communication network. A networking device comprises a communication interface and a networking component for establishing connections of the networking device, via the communication interface, with any one of a plurality of communication devices. The networking component is capable of establishing a connection with a peer networking device for creating a long range based communication network.
US09088433B2
An advanced communication controller unit for a distributed communication system having a plurality of communication controller units, at least one being an advanced communication controller unit, each coupled to a communication medium and adapted to communicate using a communication is presented. The advanced communication controller unit comprises a protocol event recording circuit having a monitoring input connected to at least one protocol event data transmission path of the advanced communication controller unit and a debug output connected to a memory device; and adapted to filter protocol event data received from the monitoring input depending on at least one configuration parameter and to provide filtered protocol event data to the debug output. A method for recording protocol events using a protocol event recording circuit in an advanced communication controller unit and a vehicle comprising at least one advanced communication controller unit are also disclosed.
US09088427B2
The present invention related to a method for recording a mobile phone call and mobile phone recording system for recording audio from mobile phone calls. An external call is established with the mobile phone. A call recording application can set up a loopback. Audio of the internal call can be captured and stored at the mobile phone. The internal call can be tagged with an identification. Thereafter, the audio, and data such as SMS and MMS, can be forwarded to a third party database for storage or stored locally for the end user to play back on the phone or transfer to an external device using USB, wireless, or similar data connection.
US09088426B2
Embodiments generally relate to processing media streams during a multi-user video conference. In one embodiment, a method includes obtaining at least one frame from a media stream, and determining a plurality of coordinates within the at least one frame. The method also includes obtaining at least one media content item, obtaining one or more parameters from a remote user, and adding the at least one media content item to the at least one frame based on the plurality of coordinates and the one or more parameters.
US09088406B2
Systems, methods, and devices synchronize data streams by hashing received data frames to generate a sequence of hash values, comparing the generated hash value sequence to a hash value sequence received in a control stream, and processing data frames when the hash value sequences match. A source device and multiple receiver devices may synchronize audio data encoded in data frames, applying a hash function to each data frame to generate a first sequence of hash values, transmitting the data frames on a first channel and the first sequence of hash values on a control channel, receiving the data frames and the first sequence of hash values in the receiver devices, applying the hash algorithm to received data frames to generate a second sequence of hash values, comparing the first and second sequences of hash values, and processing data frames when the first and second sequences of hash values match.
US09088403B1
Various aspects provide for modifying a data stream for rate adaptation. A clock component receives a data stream at a first clock rate. In an aspect, a rate adaptation component inserts a first identification codeword into a particular location in the data stream based on a set of encoding rules in response to a determination that the first clock rate is lower than a second clock rate associated with a device configured for receiving a rate-adapted version of the data stream. In another aspect, the rate adaptation component removes a predefined codeword from the data stream and transforms another predefined codeword in the data stream into a second identification codeword in response to a determination that the first clock rate is greater than the second clock rate.
US09088393B2
A method for reporting channel state information (CSI), performed by a beamformee, in a wireless local area network system using multi-channels is provided. The method includes receiving, from a beamformer, an NDP announcement (NDPA) frame announcing that a null data packet (NDP) frame follows the NDPA frame, receiving the NDP frame from the beamformer, estimating a channel from a training symbol of the NDP frame and transmitting to the beamformer a CSI report frame containing a result obtained by estimating the channel, wherein the channel is a multi-channel acquired by aggregating first and second channels which are non-contiguous to each other, and wherein the CSI report frame includes an average signal to noise ratio (SNR) for each space-time stream of the first channel and a steering matrix for each subcarrier of the first channel and an average SNR for each space-time stream of the second channel and a steering matrix for each subcarrier of the second channel.
US09088390B1
Systems and methods of this disclosure can operate to re-synchronize timing between communication devices and can include a timing server. The timing server can provide timing messages containing timing correction values to communication devices that can synchronize the communication devices. If communication devices fail to receive timing messages, the communication devices may continue to provide communication services using their internal clocks that can drift over time. When timing messages are restored, the timing correction values can be significant enough to result in the loss of communications if immediately applied by communication devices. By gradually applying timing corrections over a period of time approaching the received timing correction value, communication devices can achieve re-synchronization while avoiding and/or minimizing the loss of communications.
US09088373B2
Methods and systems for communicating information in a wireless communication system are disclosed herein and may include determining at least a bit-error-rate (BER) for at least a DVB-H downlink communication path utilized for communicating multimedia content in a communication system. The communication system may include a plurality of downlink communication paths, at least two of the plurality of downlink communication paths may use different communication protocols, and at least one of the plurality of downlink communication paths may include the DVB-H downlink communication path. At least a portion of the multimedia content may be communicated via at least one of the plurality of downlink communication paths to at least one mobile communication device based on at least the determined at least the BER.
US09088358B1
Systems and methods can operate to detect and avoid optical beat interference (OBI) in broadband devices by use of restrictive channel assignment. An OBI-mitigating mapper algorithm can leash OBI candidates in a circular queue to avoid scheduling service flows likely to result in OBI generation. In some implementations, the algorithm can automatically leash all pre-DOCSIS 3.0 service flows. In alternative implementations, the algorithm can allow the CMTS to normally load balance pre-DOCSIS 3.0 devices while manually adding and/or removing pre-DOCSIS 3.0 service flows from the OBI candidate queue based upon lost transmissions or a designated age-out timer.
US09088356B2
Embodiments of the claimed subject matter provide a method and apparatus for translating testing requirements between different reference points. Some embodiments of the method include generating mapping information that relates at least one first requirement associated with an active antenna array to at least one second requirement associated with the active antenna array. The first requirements are associated with a first reference point and the second requirements are associated with a second reference point that differs from the first reference point. Some embodiments of the method also include storing the mapping information in a non-transitory computer-readable storage media.
US09088354B2
A method for communicating optically between nodes of an optical network, including forming, between a first node and a second node of the network, a set of lightpaths, each of the set of lightpaths having a respective configuration, and transferring communication traffic between the first and second nodes via the set of lightpaths. The method also includes forming a determination for the set of lightpaths that a communication traffic level associated therewith is less than a predetermined threshold, and in response to the determination, removing a lightpath having a given configuration from the set of lightpaths to form a reduced set of lightpaths. The method further includes transferring the communication traffic between the first and second nodes via the reduced set of lightpaths, while reducing a level of power consumption in the removed lightpath and while maintaining the given configuration of the removed lightpath.
US09088345B2
Methods, devices, and systems for the transmission of information in a wireless communication system are disclosed. In one embodiment, a method for the transmission of information in a wireless communication system comprises receiving a downlink message, wherein the downlink message includes a first control channel element; determining a first index using the location of the first control channel element; determining a second index; determining a first orthogonal resource using the first index; determining a second orthogonal resource using the second index; spreading an uplink message using the first orthogonal resource to form a first spread signal; spreading the uplink message using a second orthogonal resource to form a second spread signal; transmitting the first spread signal using a first antenna; and transmitting the second spread signal using a second antenna.
US09088344B2
A method of providing frequency dependent signal attenuation. An RF input signal is split into a first signal portion and a second signal portion. The first signal portion is discrete time filtered and bandstop filtered to provide a filtered signal portion. The second signal portion is applied to a component and a component output signal portion is received from the component. The component output signal portion is combined with the filtered signal portion to provide an RF output signal having frequency dependent attenuation.
US09088326B2
A front end radio architecture is configured to provide a split band frequency arrangement that includes co-banding. The disclosed split band frequency arrangement combines a medium bandwidth filter with a small bandwidth filter to provide enough bandwidth to pass a relatively large communication band. The medium bandwidth filter has a bandwidth that is large enough to support co-banding of smaller communication bands, while also having a narrow enough bandwidth to realize a relatively steep roll-off that ensures coexistence with adjacent bands that are not co-banded. The bandwidths of the medium bandwidth filter and the small bandwidth filter overlap in bandwidth by an amount that is at least as large as the highest bandwidth signal expected to be received or transmitted. The split band frequency arrangement reduces the number of filters needed in the front end radio architecture by repurposing the small bandwidth filter, and by co-banding the smaller communication bands.
US09088322B2
A method and apparatus are provided for an apparatus. The apparatus includes at least one memory including computer program code, and at least one processor. The at least one memory and the computer program code are configured to, with the at least one processor, cause the apparatus at least to receive an indication of a set of codeword groups to be included in a codebook, and to select a precoding matrix index based on the indicated set of codeword groups in the codebook. The apparatus is also cause to transmit the precoding matrix index to a network node.
US09088319B2
A radio frequency (RF) transmitter architecture includes at least one digital signal processing module. The at least one digital signal processing module is configurable to operate in at least a first mode wherein the at least one digital signal processing module is arranged to receive a digital input signal, select, from a reduced set of digital power amplifier (DPA) control values, a plurality of DPA control values based at least partly on the received digital input signal, perform interpolation of the plurality of selected DPA control values to determine a DPA control value from a non-reduced set of DPA control values representative of the received digital input signal, and output to at least one DPA component the determined DPA control value representative of the received digital input signal.
US09088313B2
A multiple-input multiple-output (MIMO) capable system is contemplated. The communication system may include a signal processor configured to separate an input stream into multiple signal paths to facilitate simultaneous transport through a communication medium. The capability to simultaneously transmit multiples signal paths may be beneficial in order to maximize throughput and/or minimize expense.
US09088302B2
Provided is a low-density parity-check (LDPC) code decoder and a decoding method. The decoding method may include calculating a message of a variable node (V-node), calculating a message of a check node (C-node), and calculating log-likelihood ratio (LLR) data of a channel using the message of the V-node and the message of the C-node.
US09088295B1
The present disclosure includes systems and techniques relating to low power current-voltage mixed analog to digital converter (ADC) architecture. In some implementations, an ADC device includes a comparator array configured to receive an input analog voltage signal during a sample phase and a collection of reference voltages during a hold phase, a capacitor configured to receive the input analog voltage signal during the sample phase and to act as a feedback capacitor during the hold phase, an opamp coupled with the capacitor, and a transistor array configured to be powered by the opamp and activated by the comparator array to add or subtract currents to form a residue output voltage signal, which corresponds to the input analog voltage signal, used in analog to digital conversion of the input analog voltage signal.
US09088293B1
Examples are provided for a method and apparatus for calibration of an analog-to-digital converter (ADC). The method includes selecting a reference sub-ADC from multiple sub-ADCs. A calibration signal is sent to an input node of each sub-ADC of the sub-ADCs. For each sub-ADC, other than the reference sub-ADC, a corresponding error signal is generated based on output signals of the sub-ADC and the reference sub-ADC. Each sub-ADC is calibrated based on the corresponding error signal. The ADC may be a time-interleaved ADC that includes the plurality of sub-ADCs, and the reference sub-ADC has a lowest relative offset among the sub-ADCs.
US09088291B2
The present invention disclosed a Universal Serial Bus (USB) apparatus. The apparatus includes: a signal detecting unit for detecting a packet signal transmitted from a USB host and generating an acknowledgment signal according to a detection result; an error detecting unit, coupled to the signal detecting unit, for generating a control signal according to the acknowledgment signal; and a frequency generating unit, coupled to the error detecting unit, for generating an output clock signal according to the control signal.
US09088280B2
A body bias control circuit including an output coupled to provide a bias voltage to a body terminal. The body bias control circuit is configured to change the bias voltage from a first bias voltage to a second bias voltage over a period of time in which a magnitude of an effective rate of change of the bias voltage varies over the period of time. For voltages between the first and second bias voltages closer to a source voltage, the magnitude of the effective rate of change is smaller than for bias voltages between the first and second bias voltages further from the source voltage.
US09088278B2
Methods, systems and devices related to authentication of chips using physical physical unclonable functions (PUFs) are disclosed. In preferred systems, differentials of PUFs are employed to minimize sensitivity to temperature variations as well as other factors that affect the reliability of PUF states. In particular, a PUF system can include PUF elements arranged in series and in parallel with respect to each other to facilitate the measurement of the differentials and generation of a resulting bit sequence for purposes of authenticating the chip. Other embodiments are directed to determining and filtering reliable and unreliable states that can be employed to authenticate a chip.
US09088277B2
An output driver circuit may include a electrically conductive medium, an output logic inverter having a first switch adapted to couple a first positive supply voltage to the electrically conductive medium and a second switch adapted to couple a ground supply voltage to the conductive medium. A first biasing network includes a first input that is coupled to the conductive medium, a second input that receives a clock signal, and a first output that is adapted to couple a second positive supply voltage to each input of the first and the second switch. Based on the second switch coupling the conductive medium to the ground supply voltage and the received clock signal generating a logic low, the biasing network reverse biases the first switch by coupling the second positive supply voltage to the respective input of the first switch causing a leakage current reduction in the first switch.
US09088269B2
A semiconductor device having a power-saving circuit. The semiconductor device includes an input-output terminal and a holding circuit. When the input-output terminal is used, an inverter loop of the holding circuit is made not to operate by controlling a switch, and when the input-output terminal is not used, the inverter loop of the holding circuit operate by controlling the switch. Power consumption of the holding circuit can be reduced. An OS transistor is preferably used for the switch.
US09088268B2
A shifter with invalid signal filtering mechanism, comprising: a first shifting stage, for receiving and capturing an input signal in a first clock cycle; and a second shifting stage, after the first shifting stage, for receiving the input signal from the first shifting stage, and for receiving a validity signal indicating whether the input signal is valid or invalid, before a second clock cycle next to the first clock cycle occurs; wherein the second shifting stage captures the input signal transmitted from the first shifting stage if the validity signal indicates that the input signal is valid, where the second shifting stage does not capture the input signal transmitted from the first shifting stage if the validity signal indicates that the input signal is invalid.
US09088266B2
An impedance matching device includes a first variable capacitor connected to an RF power source and including a first shaft moving linearly, a first linear motion unit axially coupled to the first shaft of the first variable capacitor to provide linear motion, a first insulating joint connecting the first shaft to a first driving shaft of the first linear motion unit, and a first displacement sensor adapted to measure a movement distance of the first driving shaft of the first linear motion unit.
US09088248B2
An amplifier includes a first lower active sub cell and a second lower active sub cell, each comprising an input terminal and an output terminal, wherein the input terminals of the lower active sub cells are connected to the amplifier input and the output terminals of the lower active sub cells are not shorted. Furthermore, the amplifier includes a first upper active sub cell and a second upper active sub cell, each including a biasing terminal, wherein the input terminals and the output terminals of the upper active sub cells are coupled between the output terminals of the lower active sub cells and the amplifier output. The amplifier includes a bias controller configured to provide a first biasing signal to the first upper active sub cell and a second biasing signal to the second upper active sub cell based on an output power of the output signal.
US09088242B2
A daughter circuit board of an electronically commutated motor for interface signal conversion, including circuit units integrated on the daughter circuit board and five ports for communicating with a control system of a user terminal. The five ports include: a R/T port, a Vcc port, a Common port, a Vsp port, and an FG port.
US09088239B2
A voltage increasing control circuit is connected to a power supply to regulate power supplied to a load. The voltage increasing control circuit includes a voltage increasing unit configured to increase voltage that is supplied from the power supply, and supply the voltage to the load. A power estimation unit determines whether or not to increase the power supplied to the load. A voltage control unit controls the voltage increasing unit. When the power estimation unit determines to increase the power supplied to the load, the voltage control unit controls the voltage increasing unit to increase the power supplied to the load.
US09088237B2
A system for controlling motor switching in a sensorless BLDC having a stator with three stator windings and a permanent magnet rotor. The system includes a controller unit comprising a control signal generator, a memory device, a processing unit, a signal acquisition device, and an analog-to-digital converter. A power stage controlled by the controller unit has a plurality of switches and drives two windings of the three stator windings with a pulse width modulation signal and leaves one stator of the three stator windings undriven. The processing unit acquires a demodulated measured voltage on the undriven winding. The processing unit calculates a threshold at which the power stage will change which two windings of the three stator windings are driven when the demodulated measured voltage surpasses the threshold.
US09088231B2
A method of implementing a remedial short in a rotating polyphase electric machine (EM) includes detecting a fault condition; and initially commanding a power inverter module (PIM) into an electrically-open state. Once in an open state, a controller may determine a phase angle of a current generated by the rotating EM, and may control the PIM to apply a voltage to the EM that is out-of-phase from the determined phase angle of the generated current. The magnitude of the applied voltage signal may ramped from a first voltage to zero over a period of time; whereafter the PIM may be commanded to electrically couple all of the electrical windings of the EM to each other.
US09088228B2
The signalling method is implemented in an electronic power system (6) of a multiple-phase alternator. The system (6) is of the type comprising a set of rectifiers (5) capable of rectifying the voltage of phases (Ph1, Ph2, Ph3, Ph4, Ph5, Ph6) produced by the alternator, and a control assembly (2, 3) capable of controlling an excitation current from the alternator, of monitoring the conformity of at least one current characteristic of at least one (Ph) of the voltage of phases (Ph1, Ph2, Ph3, Ph4, Ph5, Ph6) in relation to a nominal characteristic, and of signalling any non conformity. In accordance to the method of the invention, the non conformity of at least one current characteristic of at least one (Ph) of the voltage of phases (Ph1, Ph2, Ph3, Ph4, Ph5, Ph6) is simulated in case of impaired function of at least one of the rectifiers (5). The invention thus permits the use of signalling means provided in an existing regulator to signal additional impaired functions which were not initially processed by the signalling means.
US09088225B2
Exemplary embodiments for controlling a switching branch for a three-level converter, and a switching branch are disclosed. A first semiconductor switch and a second semiconductor switch, a first diode and a second diode, a third semiconductor switch and a fourth semiconductor switch, a third diode, and a fourth diode, a fifth semiconductor switch and a sixth semiconductor switch, a fifth diode, and a sixth diode, and a control arrangement for controlling the semiconductor switches are provided. The first semiconductor switch, the first diode, the fifth semiconductor switch and the fifth diode reside in a first switching branch-specific semiconductor module, and the fourth semiconductor switch, the fourth diode, the sixth semiconductor switch and the sixth diode reside in a second switching branch-specific semiconductor module.
US09088219B2
A dual-mode circuit for the control of an AC/DC power converter is disclosed. An example dual-mode controller circuit generates a waveform that drives a switch on or off and controls the power converter. The controller circuit in addition to power factor correction (PFC) circuitry includes a critical conducting mode (CrM) module as well as a discontinuous conducting mode (DCM) module configured to generate waveforms adapted for CrM and DCM operation of a power converter. The circuit includes a node for receiving a feedback signal of a voltage or a current. Based on the received signal, one of the modules is selected at a time to supply the waveform at the output of the dual-mode controller. An example of the output waveform is a series of pulses that are configured to drive the switch that controls the transfer of power between input and output of the power converter.
US09088217B2
System and method for regulating an output voltage of a power conversion system. The system includes a sampling component located on a chip configured to receive an input voltage through a terminal. The sampling component is configured to sample the input voltage and generate a sampled voltage. Additionally, the system includes an error amplifier configured to process information associated with the sampled voltage and a threshold voltage and generate a first output signal, and a first signal generator configured to generate a second output signal and one or more third output signals. Moreover, the system includes a comparator configured to receive the first output signal and the second output signal and generate a comparison signal, and a gate driver directly or indirectly coupled to the comparator and configured to generate a drive signal based on at least information associated with the comparison signal.
US09088213B2
A method for the phase diagnosis of a multiphase converter for detecting potential errors in individual converter phases is provided, wherein a symmetrical load distribution for the individual converter phases is regulated. During the operation of the converter, the distribution of the load prescribed for each individual phase of the converter is detected at least two different times, at different temperatures, and in any order.
US09088211B2
A buck-boost regulation methodology operable, in one embodiment, with a single inductor, four-switch (S1-S4) buck-boost regulator configured for DCM. Buck-boost transition switching control is operable when inductor charge time exceeds a max charge time, and inductor discharge time exceeds a max discharge time, and includes: (a) during charge transition cycles, at the end of the max charge time, if IL is less than a predetermined peak current IL—MAX, switching S2 on (grounding the output side of the inductor) and S4 off, causing IL to increase (a rapid S1S2 charging current ramp), until IL reaches IL—MAX, and (b) during discharge transition cycles, at the end of the max charge time, if IL is greater than zero, switching S1 off and S3 on (grounding the input side of the inductor), causing IL to increase (a rapid S3S4 IL discharging current ramp), until IL reaches zero.
US09088198B2
A motor including a housing, a stator assembly, a rotor assembly, a controller, and a top end cover. The housing includes a cavity. The stator assembly includes a stator core and a stator winding and is housed in the cavity. The top end cover is disposed on the top of the housing. The rotor assembly includes a permanent magnet, a revolving shaft, and a rotor support. A bearing support extends inward from the center of a top end face of the top end cover, with a bearing chamber respectively provided on both ends thereof. The revolving shaft is disposed into and supports the bearing. A connection kit extends from the edge of the rotor support and outside the bearing support. The permanent magnet is disposed on the connection kit. The motor is characterized by simple and compact structure, lower cost, easy thermal dissipation, smaller axial dimension, and convenient assembly.
US09088188B2
A waste-heat recovery system for a waste-heat source, made up of an ORC (Organic-Rankine Cycle) postconnected thereto. The waste-heat source is connected with the heating device of the ORC as well as an expansion machine, coupled to a generator, for steam expansion in the ORC, which has magnetic bearings with an associated control device and a power supply via a direct current intermediate circuit of a generator frequency converter. The design and safe operating behavior of a waste-heat recovery system made up of an ORC post-connected to a waste-heat source are optimized. In a power supply failure, the electric energy that a down-running generator continues to generate is used to supply the magnetic bearings with the associated control device in order to ensure a safe operation in the event of a power supply failure.
US09088182B2
An electric power management system includes a power generation apparatus for generating electric power, a power meter for receiving grid-connected information and a power conditioner for outputting the electric power generated by the power generation apparatus to the electric power system based on the grid-connected information. The grid-connected information is information related to stabilization of electric power of an electric power system from a management center for managing the electric power of the electric power system.
US09088173B2
A control apparatus 13 outputs an order signal to order supply apparatuses 12-1 through 12-N to perform supply of a signal in a contactless manner at a respectively different timing. The control apparatus 13 determines that a moving apparatus 11 is stopped at the position of the supply apparatus 12 being the output destination of the signal output order, when a wireless signal is received from the moving apparatus 11 within a certain period of time after outputting the order signal. Then, the supply apparatus 12 at the position at which the moving apparatus 11 is ordered to start supplying a signal.
US09088171B2
A method for wireless charging of an electronic apparatus includes: requesting a server for information regarding chargeable electronic devices; receiving the information regarding chargeable electronic devices from the server; and performing charging with at least one electronic device.
US09088164B2
A battery system, a method of controlling the battery system, and an energy storage system including the battery system are disclosed. The method of controlling the battery system includes steps of selecting one of the plurality of batteries by using a multiplexer; measuring a voltage of the selected battery; and calculating a charging capacity of the battery based on the measured voltage. Accordingly, cell balancing may be efficiently performed.
US09088157B2
A boost type power converting apparatus is disclosed. The boost type power converting apparatus includes a boost type power converting circuit and a protection circuit. The boost type power converting circuit receives an input voltage and generates an output signal at an output terminal thereof according to the input voltage, and outputs the output signal to a load. The protection circuit is coupled between the boost type power converting circuit and the load in series to form an electrical loop, and turns on or off the electrical loop according to the output signal.
US09088153B2
A gap assembly for a arrester includes a spark gap assembly and an MOV block disposed electrically in series with the spark gap assembly. The spark gap assembly includes a resistor, a capacitor disposed electrically in series with the resistor and a spark gap disposed electrically parallel to the resistor and to the capacitor.
US09088149B2
Methods and systems to detect and control plasma fires are disclosed. An example apparatus includes a first optical fiber proximate a conductor through which electricity is to flow and a sensor to identify a change in a signal received via the optical fiber. The change is associated a physical change in the optical fiber or a casing surrounding the first optical fiber. The example apparatus also includes a controller to control a flow of electricity through the conductor based on the change in the signal.
US09088140B2
A cable backplane system includes a backplane having a plurality of openings therethrough. A cable rack is coupled to a rear of the backplane, which includes a tray and spacers coupled to the tray that have guide pins. Cable connector assemblies are held by the tray. Removable dust caps are coupled to corresponding cable connectors each having a distal end and guide walls extending therefrom that guide mating of the cable rack with the backplane. The distal end of each dust cap is received in a corresponding opening in the backplane. The guide walls guide the cable rack relative to the backplane such that the guide pins of the spacers are aligned with guide holes of the backplane and such that the cable connectors are aligned with the openings of the backplane. The removable dust caps are removed after the cable rack is coupled to the backplane.
US09088139B2
A five-direction switch base structure includes a bottom rest, four base components, and two outer covers. A self-luminous push switch is centrally selectively disposed at the bottom rest. The base components each have one side selectively disposed with a self-luminous tactile switch and another side corresponding in position to four sides of the bottom rest so as to be inserted into and fixed to the bottom rest to therefore form a base structural body. The two outer covers cover the self-luminous push switch from above such that, after the base components have been coupled together to form the base structural body, the base structural body and the self-luminous push switch are fixed to each other to form two connection layers. Hence, the base structural body comprising the bottom rest and the base components enables switch installation to take place in five directions, namely forward, backward, leftward, rightward, and upward.
US09088138B2
A mounting device for securing an electronic component includes a support base, a fixing board and a latching member. The support base includes a first track defining a first sliding direction and a second track defining a second sliding direction that intersects with the first sliding direction. The fixing board is connected to the electronic component and capable of sliding along the first track with the electronic component. The latching member is capable of sliding along the second track and includes an elastic element. The elastic element is configured to position the latching member at a desired position with respect to the support base and to provide a resilient force to the latching member, allowing the latching member to push the fixing board to cause the fixing board to abut against the support base, thereby limiting a movement of the fixing board along the first track.
US09088135B1
Gallium and nitrogen containing optical devices operable as laser diodes are disclosed. The devices include a gallium and nitrogen containing substrate member, which may be semipolar or non-polar. The devices include a chip formed from the gallium and nitrogen substrate member. The chip has a width and a length. The devices have a cavity oriented substantially parallel to the length of the chip, a dimension of less than 120 microns characterizing the width of the chip, and a pair of etched facets configured on the cavity of the chip. The pair of etched facets includes a first facet configured at a first end of the cavity and a second facet configured at a second end of the cavity.
US09088119B2
A cable assembly can include a single C form-factor pluggable (CFP) connector adhering to a CFP multi-source agreement (MSA), and providing a maximum bandwidth of between 100 and 120 gigabits-per-second (Gbps) over ten-to-twelve lanes. The cable assembly can include, for instance, one, two, or three quad small form-factor pluggable (QSFP/QSFP+) connectors adhering to a QSFP/QSFP+ MSA, and each providing a maximum bandwidth of forty Gbps over four lanes. The cable assembly can include one or more cables equal in number to the QSFP/QSFP+ connectors and each connecting the single CFP connector to the one of the QSFP/QSFP+ connectors. The four lanes over which each QSFP/QSFP+ connector provides the maximum bandwidth of forty Gbps corresponds to a different four of the ten-to-twelve lanes over which the single CFP connector provides the maximum bandwidth of between 100 and 120 Gbps.
US09088112B1
According to one or more embodiments of the disclosure, a device is provided. The printed circuit board may include an electronic receptacle. Additionally, the printed circuit board may include a housing element housing a portion of the electronic receptacle. As such, the housing element may include a top portion, a bottom portion, and at least one side portion. To this end, the top portion of the housing element may extend above a bottom surface of the printed circuit board, and the bottom portion of the housing element may extend below the bottom surface of the printed circuit board. Moreover, the printed circuit board may include at least one spring connector coupled to the electronic receptacle and the printed circuit board.
US09088111B2
A battery connector, used to connect the battery and PCB, includes an insulating housing and a number of contacts received in the housing. Each contact is equipped with a retaining portion, a soldering portion extending downwardly from a lower edge of the retaining portion, and a contacting portion extending forwardly from a front edge of the retaining portion. A first notch is defined between a lower junction part which is formed between a lower edge of the retaining portion and a rear edge of the contacting portion and the first notch positioned beside the soldering portion.
US09088109B2
An electrical connector assembly for suppressing a back electromotive force (“EMF”) spike originating from an electromagnetic device is provided. The electrical connector assembly includes a pin-side electrical connector coupled to the electromagnetic device. In one example, the pin-side electrical connector has a diode opening surrounded by an insulating material. The electrical connector assembly further includes a socket-side electrical connector for mechanically mating with and electrically coupling to the pin-side electrical connector. The socket-side electrical connector includes a suppression diode for suppressing the back EMF spike from the electromagnetic device. The suppression diode is positioned within the diode opening when the socket-side electrical connector is mechanically mated with and electrically coupled to the pin-side electrical connector.
US09088107B2
A housing for containing at least an electronic component therein is provided. At least a tuning element is disposed in a wall of the housing at a predetermined location. The at least a tuning element forms an opening having a pilot aperture with a countersink aperture connected thereto. The pilot aperture and the countersink aperture are determined such that the housing has a tuned mechanical frequency response for improving the signal quality of an electric signal transmitted therein or therethrough.
US09088106B2
Communications jacks include a housing and a flexible printed circuit board that is at least partly within the housing. Eight input contacts that are mounted on the flexible printed circuit board, with the fourth and fifth input contacts forming a first differential pair, the first and second input contacts forming a second differential pair, the third and sixth input contacts forming a third differential pair, and the seventh and eighth input contacts forming a fourth differential pair. The plug contact regions of the input contacts are arranged in numerical order across a plug aperture of the jack. Eight output contacts are also provided, and the flexible printed circuit board includes conductive paths that electrically connect each input contact to a respective output contact. The fourth and fifth input contacts are mounted on the flexible printed circuit board at respective first and second mounting locations that are closer to a back end of the housing than are respective third and fourth mounting locations where the third and sixth input contacts are mounted on the flexible printed circuit board.
US09088102B2
The present invention relates to an anti-loose socket and a pull-out locking mechanism thereof, wherein inside the anti-loose socket, there are a pull-out locking mechanism composed of a bevelled sleeve (15) and two cylinders (16) arranged in a symmetrical manner at two sides within the bevelled sleeve; an inside longitudinal section of the bevelled sleeve has a cone angle in an umbrella shape, the middle portion of the bevelled sleeve allows a plug pin (61) to pass through; the cylinder is mounted on a floating block (14) movable up and down, and can move up and down along the inside conical surface of the bevelled sleeve by the floating block. When the plug (6) is pulled out upwards, the cylinder moves upwards, however due to the limiting action of the bevel surface, the cylinders stick to the two bevel surfaces more and more tightly.
US09088097B2
Provided is a magnetic connector module including: a pattern electrode part module; and a pin terminal part module, wherein the pattern electrode part module includes pattern electrodes having a concentric circle shape, pattern electrode part magnets, and a pattern electrode part connector, wherein the pin terminal part module includes a plurality of pin terminals, pin terminal part magnets, and a pin terminal part connector wherein the plurality of pin terminals include a power terminal VCC, a ground power terminal GND, and a signal terminal S, wherein an electrode contacting the ground power terminal GND and an electrode contacting the signal terminal S among the pattern electrodes are electrically short-circuited, and wherein the pin terminal part module includes the power supply blocking circuit allowing power supply to the power terminal VCC only in a state in which the ground power terminal GND and the signal terminal S are electrically short-circuited.
US09088094B2
A high-voltage power connector comprising mating plug and socket assemblies. The socket assembly can include a hollow core surrounded by a bellows assembly filled with an inert liquid that eliminates arcing when an electrical connection is formed or broken. Embodiments of the plug and socket assemblies can include multiple contacts that first couple in air before an electrical circuit is formed and as the plug and socket are mated additional contacts inside the socket assembly mate while surrounded by an inert arc-suppressing fluid.
US09088081B2
A system for sealing a building electrical outlet of the type mounted within a wall surface of the building having one or more electrical plug sockets adapted to receive an electrical plug and a cover plate. The system includes two primary components. A gasket formed of an elastomeric material is provided with a pair of electrical terminal slots. A plug cover element forms a front cover panel and includes a pair of tabs extending from a back of the face surface to engage the electrical plug socket terminal slots. Two modes of operation are available. When an electrical plug is inserted into the electrical plug socket, the gasket is positioned between the plug and the socket to seal against air infiltration. When an electrical plug is not inserted into the socket, the plug cover is used to maintain the gasket in position for sealing against the electrical plug socket.
US09088076B2
Both ends of a feeder and both ends of a reflector of an antenna device are connected using a pair of diodes. When the diodes are turned on, a loop antenna is formed which loops the feeder, the diode, the reflector, a capacitor, and the diode, and the antenna device operates as the loop antenna. When the diodes are turned off, the antenna device operates as a Yagi-Uda antenna which is formed of the feeder, the reflector, and a wave guide.
US09088060B2
For associating different technologies of a microstrip line and of a rectangular waveguide, for example on a ceramic, in a transition device including a mode transformer between the line integrated into a printed circuit board, and the waveguide, the board includes a housing containing the waveguide with a large sidewall coplanar and coaxial to the strip of the line and another large sidewall fixed onto a metallic layer of the board at the bottom of the housing. A linking metallic element bridges a mechanical tolerance gap between the transformer and one of the line and the waveguide. The transformer can be integrated into the board, or into the waveguide in a microwave component.
US09088047B2
The invention relates to an electrode for a lithium battery that contains LiFePO4 as electrochemically active material and a binder consisting of polyacrylic acid. The polyacrylic acid has a mean molecular weight greater than or equal to 1,250,000 g·mol−1 and strictly less than 2,000,000 g·mol−1. The percentage of LiFePO4 is greater than 90% by weight and the percentage of polyacrylic acid is less than or equal to 4%, said percentages being calculated with respect to the total weight of the electrode. The invention further relates to a lithium storage battery having a power or energy operating mode that contains the electrode for a lithium battery.
US09088042B2
A battery pack is disclosed. An embodiment of the battery pack includes a bare cell comprising a first surface, a positive electrode and a negative electrode; a circuit module disposed over the first surface and comprising a positive electrode terminal and a negative electrode terminal; a first lead plate disposed over the first surface and coupled to the positive electrode and the positive electrode terminal; and a second lead plate disposed over the first surface and coupled to the negative electrode and the negative electrode terminal; wherein the first surface of the bare cell is curved, and each lead plate has a curvature conforming to the first surface.
US09088039B2
A rechargeable battery module including at least two unit cells, each unit cell having a positive electrode terminal and a negative electrode terminal, each unit cell having a side surface disposed crosswise to one direction, the at least two unit cells overlapping at their side surfaces, a positive electrode terminal and a negative electrode terminal respectively, of different unit cells being coupled to each other and facing each other, and a conductive spacer interposed between the positive electrode terminal and the negative electrode terminal of the respective unit cells, and electrically connecting the positive electrode terminal and the negative electrode terminal to each other.
US09088035B2
A non-aqueous electrolyte secondary battery including: a positive electrode including a positive electrode material mixture layer; a negative electrode including a negative electrode material mixture layer; a separator or lithium-ion conductive porous film interposed between the positive electrode and the negative electrode; and a lithium-ion conductive non-aqueous electrolyte. The positive electrode material mixture layer contains a positive electrode active material comprising a lithium transition metal composite oxide, and the lithium transition metal composite oxide contains lithium, a transition metal, and a metal different from the transition metal. The negative electrode material mixture layer contains a negative electrode active material comprising a carbon material. In the area where the positive electrode material mixture layer and the negative electrode material mixture layer are opposed to each other, the ratio R:Wp/Wn is 1.3 to 2.2 where Wp is the weight of the positive electrode active material contained in the positive electrode material mixture layer per unit opposed area and Wn is the weight of the negative electrode active material contained in the negative electrode material mixture layer per unit opposed area. The end of charge voltage is set to 4.25 to 4.5 V in normal operation.
US09088033B2
Disclosed herein is a battery pack including a battery cell array including three or fewer battery cells, each of which has an electrode assembly of a cathode/separator/anode structure disposed in a battery case together with an electrolyte in a sealed state, arranged in the lateral direction, the battery cells having a current capacity of 3 amperes (Ah) or more and being electrically connected in series to each other, a protection circuit module (PCM) connected to the upper end of the battery cell array to control the operation of the battery pack, the protection circuit module including a protection circuit, from which a function to adjust voltage unbalance between the battery cells is removed, and a pack case in which the battery cell array and the protection circuit module are disposed.
US09088031B2
A battery module 100 includes a plurality of cells 10, wherein a cooling unit 20 in which a coolant is sealed is disposed in the vicinity of the cells 10, the coolant is liquid adjusted to have a viscosity within the range of 2 Pa·s to 350 Pa·s, and the cooling unit 20 includes an unsealable portion 23 which is partially unsealed to release the coolant when at least one of the cells 10 abnormally generates heat.
US09088029B2
A battery pack is provided for a mobile communication device, comprising a casing defining a cavity that conforms, at least partially, to the outer shape of the mobile communication device and one or more rechargeable power cells housed within the thickness of the casing. An internal interface engages a corresponding interface on the mobile communication device to provide power from the one or more rechargeable cells to the mobile communication device. An external interface is electrically coupled to the internal interface in order to transmit signals from the mobile communication device to an external device and may further serve to recharge the one or more rechargeable power cells. The battery pack may also serve as an extendible platform by providing additional integrated communication interfaces and/or processors that can be utilized by the mobile communication device to extend its communication and/or processing capabilities.
US09088025B2
Disclosed herein is a secondary battery including an electrode assembly, having pluralities of electrode tabs joined to electrode leads, mounted in a receiving part of a battery case, wherein the battery case has concave steps formed at the inner upper end of the receiving part thereof between electrode tab-electrode lead coupling portions (a cathode terminal portion and an anode terminal portion) of the electrode assembly and at the inner opposite sides of the receiving part thereof corresponding to the opposite sides of the electrode assembly such that the electrode assembly is in tight contact with the concave steps.
US09088022B2
A fuel cell has a fuel cell main body, a fuel supply unit, a voltage sensor, a supply speed determining unit, a fuel supply control unit, and a connecting unit. The voltage sensor measures the open-circuit voltage of the fuel cell main body. The supply speed determining unit determines the fuel supply speed of the fuel supply unit, on the basis of the results obtained from the measurement performed by the voltage sensor, in the case where the voltage measured by the voltage sensor is smaller than a predetermined value. The fuel supply control unit controls, on the basis of the supply speed thus determined, the fuel supply from the fuel supply unit. The connecting unit connects a load to the fuel cell main body, in the case where the voltage measured by the voltage sensor is larger than the predetermined value.
US09088019B2
An electrochemical cell provided with two half cells. A pressure or density differential is created between the cathode and anode electrodes, each of which is contained in one of the half cells. The pressure or density differential is created by single or multiple sources including compression, vacuum, weight (gravity) of mass, chemical, molecular, or, pressure or density differentials created by thermal gradients.
US09088012B2
By way of example, the present subject matter provides a method, including stacking a plurality of substantially planar electrodes into a stack, in alignment, encapsulating the stack by pressing a first beveled edge of a first cup-shaped housing piece against a second beveled edge of a second cup-shaped housing piece, with the first beveled edge of the first cup-shaped housing piece encouraged into substantially coextensive alignment with the second beveled edge of the second cup-shaped housing piece and joining the first beveled edge of the first cup-shaped housing piece to the second beveled edge of the second cup-shaped housing piece.
US09088007B2
An organic light emitting diode (OLED) display is provided. The OLED display includes a substrate, an organic light emitting element on the substrate, and a thin film encapsulation layer on the substrate and covering the organic light emitting element. The thin film encapsulation layer includes at least one conductive layer having a voltage application pad.
US09088005B2
An OLED display according to an exemplary embodiment includes: a first substrate; a second substrate arranged opposite to the first substrate; a sealant arranged in the shape of a closed loop along an edge of the second substrate between the first substrate and the edge of the second substrate; and a metal wire formed along the sealant between the first substrate and the sealant. One area of the metal wire has an opening pattern.
US09088003B2
An organic light emitting diode display includes a thin film transistor (TFT) substrate, which has TFTs for an array of pixels. Each TFT has a gate electrode, a source electrode, and a drain electrode. An organic layer is disposed over the TFT substrate. The organic layer has through-hole above the drain electrode. The display also includes pixel electrodes disposed over the organic layer. Each pixel electrode is connected to the drain electrode in the through-hole of the organic layer for each pixel. An organic light emitting diode (OLED) layer is disposed over the pixel electrode for each pixel. The organic light emitting layer is divided into pixels or sub-pixels by a pixel defining layer over the pixel electrode. The display further includes a common electrode and a conductive layer disposed over the OLED layer such that the conductive layer does not block light emission from the organic light emitting layer.
US09088001B2
Discussed are an organic light emitting display and a method for fabricating the same to improve color purity and efficiency. The organic light emitting display includes a substrate having first to third sub-pixels, first and second electrodes formed on the substrate, the first and second electrodes facing each other, a red light emitting layer formed in the first sub-pixel between the first and second electrodes, a green light emitting layer formed in the second sub-pixel between the first and second electrodes, and a blue common light emitting layer formed in the first to third sub-pixels between the first and second electrodes, wherein a thin film layer formed between the first electrode and the blue common light emitting layer and contacting the blue common light emitting layer includes a blue host.
US09087999B2
A method of fabricating an electronic device, such as an organic thin film transistor, is disclosed. A substrate, for example a silicate glass substrate, has a surface which supports at least one metallic electrode comprising at least one metal, for example gold, and at least a portion of the surface of the substrate is exposed. The method comprises selectively forming a self-assembled layer on the exposed portion of the substrate surface such that no self-assembled layer is formed on the at least one metallic electrode and applying a solution or other liquid which is repelled by the self-assembled layer to at least one metal electrode so as to selectively form a layer of further material, such as a charge injection promoting material, on the at least one metallic electrode.
US09087991B2
A photovoltaic element (110) is proposed for conversion of electromagnetic radiation to electrical energy, more particularly a dye solar cell (112). The photovoltaic element (110) has at least one first electrode (116), at least one n-semiconductive metal oxide (120), at least one electromagnetic radiation-absorbing dye (122), at least one solid organic p-semiconductor (126) and at least one second electrode (132). The p-semiconductor (126) comprises silver in oxidized form.
US09087987B2
Phase-change memory cells for storing information in a plurality of programmable cell states. A phase-change component is located between first and second electrodes for applying a read voltage to the phase-change component to read the programmed cell state. The component includes opposed layers of phase-change material extending between the electrodes. A core component extends between the electrodes in contact with respective inner surfaces of the opposed layers. An outer component extends between the electrodes in contact with respective outer surfaces of the opposed layers. At least one of the core and outer component is formed of electrically-conductive material and is arranged to present, to a cell current produced by the read voltage, a lower-resistance current path than the amorphous phase of the phase-change material in any of said cell states. The current path has a length dependent on size of the amorphous phase in the opposed layers.
US09087985B2
A phase-change memory element with side-wall contacts is disclosed, which has a bottom electrode. A non-metallic layer is formed on the electrode, exposing the periphery of the top surface of the electrode. A first electrical contact is on the non-metallic layer to connect the electrode. A dielectric layer is on and covering the first electrical contact. A second electrical contact is on the dielectric layer. An opening is to pass through the second electrical contact, the dielectric layer, and the first electrical contact and preferably separated from the electrode by the non-metallic layer. A phase-change material is to occupy one portion of the opening, wherein the first and second electrical contacts interface the phase-change material at the side-walls of the phase-change material. A second non-metallic layer may be formed on the second electrical contact. A top electrode contacts the top surface of the outstanding terminal of the second electrical contact.
US09087980B2
A magnetoresistive element according to an embodiment includes: a base layer; a first magnetic layer formed on the base layer, and including a first magnetic film having an axis of easy magnetization in a direction perpendicular to a film plane, the first magnetic film including MnxGa100-x (45≦x<64 atomic %); a first nonmagnetic layer formed on the first magnetic layer; and a second magnetic layer formed on the first nonmagnetic layer, and including a second magnetic film having an axis of easy magnetization in a direction perpendicular to a film plane, the second magnetic film including MnyGa100-y (45≦y<64 atomic %). The first and second magnetic layers include different Mn composition rates from each other, a magnetization direction of the first magnetic layer is changeable by a current flowing between the first magnetic layer and the second magnetic layer via the first nonmagnetic layer.
US09087979B2
An acoustic wave device includes: a piezoelectric film made of an aluminum nitride film containing a divalent element and a tetravalent element, or a divalent element and a pentavalent element; and an electrode that excites an acoustic wave propagating through the piezoelectric film.
US09087978B1
Embodiments of the invention include nonvolatile memory elements and memory devices comprising the nonvolatile memory elements. Methods for forming the nonvolatile memory elements are also disclosed. The nonvolatile memory element comprises a first electrode layer, a second electrode layer, and a plurality of layers of an oxide disposed between the first and second electrode layers. One of the oxide layers has linear resistance and substoichiometric composition, and the other oxide layer has bistable resistance and near-stoichiometric composition. Preferably, the sum of the two oxide layer thicknesses is between about 20 Å and about 100 Å, and the oxide layer with bistable resistance has a thickness between about 25% and about 75% of the total thickness. In one embodiment, the oxide layers are formed using reactive sputtering in an atmosphere with controlled flows of argon and oxygen.
US09087975B2
According to embodiments of the present invention, a resistive memory arrangement is provided. The resistive memory arrangement includes a nanowire, and a resistive memory cell including a resistive layer including a resistive changing material, wherein at least a section of the resistive layer is arranged covering at least a portion of a surface of the nanowire, and a conductive layer arranged on at least a part of the resistive layer. According to further embodiments of the present invention, a method of forming a resistive memory arrangement is also provided.
US09087968B2
There is provided a white light emitting device including: a blue LED emitting blue light; a red phosphor excited by the blue light, emitting red light, and including a nitrogen (N)-containing compound; a yellow phosphor excited by the blue light and emitting yellow light; a first green phosphor excited by the blue light, emitting first green light having a first full width half maximum, and including a nitrogen (N)-containing compound; and a second green phosphor excited by the blue light and emitting second green light having a second full width half maximum larger than the first full width half maximum of the first green phosphor.
US09087967B2
A light-emitting device of an embodiment of the present application comprises a substrate; a first semiconductor light-emitting structure formed on the substrate, wherein the first semiconductor light-emitting structure comprises a first semiconductor layer having a first conductivity type, a second semiconductor layer having a second conductivity type and a first active layer formed between the first semiconductor layer and the second semiconductor layer, wherein the first active layer is capable of emitting a first light having a first dominant wavelength; and a first thermal-sensitive layer formed on a path of the first light, wherein the first thermal-sensitive layer comprises a material characteristic which varies with a temperature change.
US09087961B2
A light emitting device includes a first conductive semiconductor layer (112), an active layer (114) including a quantum well (114w) and a quantum barrier (114b) on the first conductive semiconductor layer (112). An undoped last barrier layer (127) is provided on the active layer (114), and an AlxInyGa(1−x−y)N (0≦x≦1, 0≦y≦1)-based layer (128) is provided on the undoped last barrier layer (127). A second conductive semiconductor layer (116) is provided on the AlxInyGa(1−x−y)N-based layer (128).
US09087959B2
A device for generating electric energy includes at least one heated heat-conducting main body, at least one projection and thermoelectric elements laterally attached to the at least one projection. A thermoelectric efficiency of each thermoelectric element and a heat output of the at least one projection are matched to each other.
US09087952B2
A method of forming an integrated photonic semiconductor structure having a photonic device and a CMOS device may include depositing a first silicon nitride layer having a first stress property over the photonic device, depositing an oxide layer having a stress property over the deposited first silicon nitride layer, and depositing a second silicon nitride layer having a second stress property over the oxide layer. The deposited first silicon nitride layer, the oxide layer, and the second silicon nitride layer encapsulate the photonic device.
US09087938B2
The present invention is a production method of an electrode for a dye-sensitized solar cell, comprising: a first step of providing current collector wiring on an electrically conductive substrate; and a second step of producing an electrode for a dye-sensitized solar cell by sequentially forming a plurality of thermoplastic wiring protective layers on the current collector wiring so that softening points of the thermoplastic wiring protective layers become lower as the thermoplastic wiring protective layers move away from the current collector wiring, and by heat-treating the second and subsequent thermoplastic wiring protective layers from the current collector wiring at a heat treatment temperature lower than a softening point of the thermoplastic wiring protective layer formed immediately prior thereto.
US09087919B2
Methods of fabricating semiconductor devices and structures thereof are disclosed. In one embodiment, a method of manufacturing a semiconductor device includes forming a gate material stack over a substrate having a first region and a second region. The gate material stack includes a semiconductive gate material. A thickness is altered or a substance is introduced to the semiconductive gate material in the first region or the second region of the substrate. The gate material stack is patterned in the first region and the second region resulting in a first transistor in the first region of the substrate comprising an NMOS FET of a CMOS device and a second transistor in the second region of the substrate comprising an NMOS FET of the CMOS device. The first transistor has a first threshold voltage and the second transistor has a second threshold voltage different than the first threshold voltage.
US09087913B2
A thermally-grown oxygen-containing layer is formed over a control gate in an NVM region, and a high-k dielectric layer and barrier layer are formed in a logic region. A polysilicon layer is formed over the oxygen-containing layer and barrier layer and is planarized. A first masking layer is formed over the polysilicon layer and control gate defining a select gate location laterally adjacent the control gate. A second masking layer is formed defining a logic gate location. Exposed portions of the polysilicon layer are removed such that a select gate remains at the select gate location and a polysilicon portion remains at the logic gate location. A dielectric layer is formed around the select and control gates and polysilicon portion. The polysilicon portion is removed to result in an opening at the logic gate location which exposes the barrier layer.
US09087908B2
The concentration of impurity elements included in an oxide semiconductor film in the vicinity of a gate insulating film is reduced. Further, crystallinity of the oxide semiconductor film in the vicinity of the gate insulating film is improved. A semiconductor device includes an oxide semiconductor film over a substrate, a source electrode and a drain electrode over the oxide semiconductor film, a gate insulating film which includes an oxide containing silicon and is formed over the oxide semiconductor film, and a gate electrode over the gate insulating film. The oxide semiconductor film includes a region in which the concentration of silicon is lower than or equal to 1.0 at. %, and at least the region includes a crystal portion.
US09087898B2
A semiconductor device includes a first device isolation insulating film defining a first region, a first conductive layer of a first conductivity type formed in the first region, a semiconductor layer formed above the semiconductor substrate and including a second conductive layer of the first conductivity type connected to the first conductive layer and a third conductive layer of the first conductivity type connected to the first conductive layer, a second device isolation insulating film formed in the semiconductor layer and isolating the second conductive layer and the third conductive layer from each other, a gate insulating film formed above the second conductive layer, and a gate electrode formed above the gate insulating film and electrically connected to the first conductive layer via the third conductive layer.
US09087893B2
A parallel p-n layer (20) is provided as a drift layer between an active portion and an n+ drain region (11). The parallel p-n layer (20) is formed by an n-type region (1) and a p-type region (2) being repeatedly alternately joined. An n-type high concentration region (21) is provided on a first main surface side of the n-type region (1). The n-type high concentration region (21) has an impurity concentration higher than that of an n-type low concentration region (22) provided on a second main surface side of the n-type region (1). The n-type high concentration region (21) has an impurity concentration 1.2 times or more, 3 times or less, preferably 1.5 times or more, 2.5 times or less, greater than that of the n-type low concentration region (22). Also, the n-type high concentration region (21) has one-third or less, preferably one-eighth or more, one-fourth or less, of the thickness of a region of the n-type region (1) adjacent to the p-type region (2).
US09087887B2
Techniques are disclosed for forming a non-planar quantum well structure. In particular, the quantum well structure can be implemented with group IV or III-V semiconductor materials and includes a fin structure. In one example case, a non-planar quantum well device is provided, which includes a quantum well structure having a substrate (e.g. SiGe or GaAs buffer on silicon), a IV or III-V material barrier layer (e.g., SiGe or GaAs or AlGaAs), and a quantum well layer. A fin structure is formed in the quantum well structure, and an interfacial layer provided over the fin structure. A gate metal can be deposited across the fin structure. Drain/source regions can be formed at respective ends of the fin structure.
US09087881B2
A trench in an inter-layer dielectric formed on a semiconductor substrate is defined by a bottom and sidewalls. A copper barrier lines the trench with a copper-growth-promoting liner over the barrier. The trench has bulk copper filling it, and includes voids in the copper. The copper with voids is removed, including from the sidewalls, leaving a void-free copper portion at the bottom. Immersion in an electroless copper bath promotes upward growth of copper on top of the void-free copper portion without inward sidewall copper growth, resulting in a void-free copper fill of the trench.
US09087879B2
A multiple-patterned semiconductor device and a method of manufacture are provided. The semiconductor device includes a conductive layer. The conductive layer includes conductive tracks which may be defined by photomasks. The conductive tracks may have quality characteristics. Distinct quality characteristics of distinct conductive tracks may be compared. Based on the comparison, signals and supply voltage may be routed on particular conductive tracks.
US09087873B2
A recessed portion is formed around an outer edge of a device wafer at a peripheral edge portion of a first face of the device wafer. A recessed portion is formed around an outer edge of a support substrate, at a bonding face of the support substrate. The first face of the device wafer and the bonding face of the support substrate are bonded together by an adhesive. The device wafer is ground from a second face side, on the opposite side to the first face 11, as far as a depth position to reach a bottom face of the recessed portion.
US09087864B2
In some embodiments, apparatus are provided that provide for flexible processing in high productivity combinatorial (HPC) system. The apparatus allow for interchangeable functionality that includes deposition, plasma treatment, ion beam treatment, in-situ annealing, and in-situ metrology. The apparatus are designed so that the functionality may be integrated within a single processing chamber for enhanced flexibility.
US09087863B2
Nanowire structures having non-discrete source and drain regions are described. For example, a semiconductor device includes a plurality of vertically stacked nanowires disposed above a substrate. Each of the nanowires includes a discrete channel region disposed in the nanowire. A gate electrode stack surrounds the plurality of vertically stacked nanowires. A pair of non-discrete source and drain regions is disposed on either side of, and adjoining, the discrete channel regions of the plurality of vertically stacked nanowires.
US09087862B2
A semiconductor device includes a region in a semiconductor substrate having a top surface with a first charge storage layer on the top surface. A first conductive line is on the first charge storage layer. A second charge storage layer is on the top surface. A second conductive line is on the second charge storage layer. A third charge storage layer is on the top surface. A third conductive line is on the third charge storage layer. A fourth charge storage layer has a first side adjoining a first sidewall of the first conductive line and a second side adjoining a first sidewall of the second conductive line. A fifth charge storage layer has a first side adjoining a second sidewall of the second conductive line and a second side adjoining a first sidewall of the third conductive line. Source and drain regions are formed in the substrate on either side of the semiconductor device.
US09087856B2
A semiconductor device includes trenches defined in a substrate, buried bit lines partially filling the trenches, a first source/drain layer filling remaining portions of the trenches on the buried bit lines, stack patterns having a channel layer and a second source/drain layer stacked therein and bonded to the first source/drain layer, wherein the channel layer contacts with the first source/drain layer, and word lines crossing with the buried bit lines and disposed adjacent to sidewalls of the channel layer.
US09087853B2
In one embodiment, an isolation device has a substrate, a metal plate, a conductive layer, first and second isolation layers are disclosed. The conductive layer may be formed within the substrate. The conductive layer may be arranged coupled to the metal plate, so as to receive a capacitively coupled signal from the metal plate. The first and second isolation layers may be sandwiched between the metal plate and the conductive layer. In another embodiment, an isolation device having a semiconductor substrate, a topmost metal layer and a plurality of additional metal layers is disclosed. The isolation device further has an isolation capacitor formed using the topmost metal layer and a conductive layer coupled to at least one of the plurality of additional metal layers.
US09087846B2
Systems and methods are provided for stacked semiconductor memory packages. Each package can include an integrated circuit (“IC”) package substrate capable of transmitting data to memory dies stacked within the package over two channels. Each channel can be located on one side of the IC package substrate, and signals from each channel can be routed to the memory dies from their respective sides.
US09087840B2
A strip-line includes a ground plane extending through a plurality of dielectric layers over a substrate; a signal line over the substrate and on a side of the ground plane; a first plurality of metal strips under the signal line and in a first metal layer, wherein the first plurality of metal strips is parallel to each other, and is spaced apart from each other by spaces; and a second plurality of metal strips under the signal line and in a second metal layer over the first metal layer. The second plurality of metal strips vertically overlaps the spaces. The first plurality of metal strips is electrically coupled to the second plurality of metal strips through the ground plane, and no via physically contacts the first plurality of metal strips and the second plurality of metal strips.
US09087835B2
Embodiments of the present disclosure provide a method that comprises providing a first die having a surface comprising a bond pad to route electrical signals of the first die and attaching the first die to a layer of a substrate. The method further comprises forming one or more additional layers of the substrate to embed the first die in the substrate and coupling a second die to the one or more additional layers, the second die having a surface comprising a bond pad to route electrical signals of the second die. The second die is coupled to the one or more additional layers such that electrical signals are routed between the first die and the second die.
US09087834B2
A multi-chip electronic package and methods of manufacture are provided. The multi-chip package includes a plurality of chips mounted on a chip carrier. The multi-chip package further includes a lid mounted on the chip carrier using a bonding material or compression seal, and at least one single piston extending from the lid. Each piston covers an entirety of multiple chips of the plurality of chips.
US09087829B2
A semiconductor arrangement includes a first and second controllable vertical n-channel semiconductor chip. Each of the controllable vertical n-channel semiconductor chips has a front side, a rear side opposite the front side, a front side main contact arranged on the front side, a rear side main contact arranged on the rear side, and a gate contact arranged on the front side for controlling an electric current between the front side main contact and the rear side main contact. The rear side contacts of the first and second semiconductor chips are electrically connected to one another.
US09087828B2
A semiconductor device with thick bottom metal comprises a semiconductor chip covered with a top plastic package layer at its front surface and a back metal layer at its back surface, the top plastic package layer surrounds sidewalls of the metal bumps with a top surface of the metal bumps exposing from the top plastic package layer, a die paddle for the semiconductor chip to mount thereon and a plastic package body.
US09087821B2
Embodiments of forming a semiconductor device structure are provided. The semiconductor device structure includes a first semiconductor wafer and a second semiconductor wafer bonded via a hybrid bonding structure, and the hybrid bonding structure includes a first conductive material embedded in a first polymer material and a second conductive material embedded in a second polymer material. The first conductive material is bonded to the second conductive material and the first polymer material is bonded to the second polymer material. The semiconductor device also includes at least one through silicon via (TSV) extending from a bottom surface of the first semiconductor wafer to a metallization structure of the first semiconductor wafer. The semiconductor device structure also includes an interconnect structure formed over the bottom surface of the first semiconductor wafer, and the interconnect structure is electrically connected to the metallization structure via the TSV.
US09087819B2
A semiconductor package includes a semiconductor chip having a first surface, a second surface which faces away from the first surface, and through holes which pass through the first surface and the second surface; a dielectric layer formed on one or more of the first surface and the second surface and formed with grooves around the through holes on a fourth surface of the dielectric layer facing away from a third surface of the dielectric layer which is attached to the semiconductor chip; through-silicon vias filling the through holes; and bumps formed on the through-silicon vias and on portions of the dielectric layer around the through-silicon vias and filling the grooves.
US09087818B2
A semiconductor integrated circuit device having a control signal system for avoiding failure to check an indefinite signal propagation prevention circuit, for facilitating a check included in an automated tool, and for facilitating a power shutdown control inside a chip. In the semiconductor integrated circuit device, power shutdown priorities are provided by independent power domains (Area A to Area I). A method for preventing a power domain having a lower priority from being turned OFF when a circuit having a high priority is turned ON is also provided.
US09087816B2
To achieve a reduction in cost of a semiconductor device, in a common board (a wiring board), a plurality of bonding leads each extend toward the center of the board, and a solder resist film as a die bonding region supporting a minimum chip is coated with a die bonding material. With this, even when a first semiconductor chip as a large chip is mounted, wire bonding can be performed without causing the die bonding material to cover the bonding leads. Thus, development cost can be reduced to reduce the cost of the semiconductor device (LGA).
US09087814B2
A heat dissipation module for an electronic component is provided. The heat dissipation module includes a supporting structure and a heat pipe. The supporting structure is adjacent to the heat electronic component. The heat pipe is connected to the supporting structure by soldering, and the bottom surface of the heat pipe is directly in contact with the upper surface of the electronic component.
US09087812B2
There are disclosed herein various implementations of composite semiconductor devices. In one implementation, such a composite semiconductor device includes a transition body formed over a diode, the transition body including more than one semiconductor layer. The composite semiconductor device also includes a transistor formed over the transition body. The diode may be connected across the transistor using through-semiconductor vias, external electrical connectors, or a combination of the two.
US09087810B2
A thin film transistor structure includes a substrate, a gate layer, a gate insulator layer, a first semiconductor island, a second semiconductor island and a source and drain layer. The gate layer is disposed on the substrate, and includes a first gate electrode and a second electrode electrically connected to the first gate electrode. The gate insulator layer is disposed on the substrate and covers the first and second gate electrodes. The first semiconductor island is disposed on the gate insulator layer and corresponding to the first gate electrode. The second semiconductor island is disposed on the gate insulator layer and corresponding to the second electrode. The source and drain layer is disposed on the gate insulator layer and next to the first semiconductor island and the second semiconductor island. A display device using the above thin film transistor structure is also provided.
US09087803B2
Methods of fabricating integrated circuit devices utilize fuse elements to support sequential testing of vertically-integrated test elements during fabrication. These methods include forming a first test element, a first fuse and a first test pad electrically connected by the first fuse to the first test element, on a substrate. The first test element is tested by passing a first current between the first test element and first test pad and through the first fuse. The first fuse is then “cut” by increasing an impedance of the first fuse, which may include breaking the first fuse to create an electrical “open” (infinite impedance) or greatly increasing a resistance of the first fuse (e.g., by narrowing the fuse through electromigration). A second test element and a second test pad, which is electrically connected to the second test element and the first test pad, are then formed on the substrate.
US09087797B2
A light-emitting element display device including: a thin film transistor substrate that includes a transistor which controls an amount of light emission from each sub-pixel arranged on an entire display region; and a color filter substrate that is arranged to overlap with the thin film transistor substrate, and includes a color filter which causes a light having a predetermined wavelength region in each sub-pixel to pass. The thin film transistor substrate includes a first light-emitting layer that covers the entire display region and emits a light having one wavelength region, and a second light-emitting layer that emits a light having a wavelength region different from that of the first light-emitting layer, and covers a plurality of independent regions in the display region.
US09087791B2
A semiconductor device and a method of manufacturing the same are provided. The device includes first and second line pattern units configured to extend substantially parallel to one another in a first direction and alternately disposed such that end portions of the first and second line pattern units are arranged in a diagonal direction, third and fourth pattern units configured to respectively extend from the end portions of the first and second line pattern units in a second direction crossing the first direction, first contact pad units respectively formed in the third line pattern units disposed a first distance from the end portions of the first line pattern units, and fourth contact pad units respectively formed in the fourth line pattern units disposed a second distance from the end portions of the second line pattern units. Here, the second distance is different from the first distance.
US09087781B2
A semiconductor device includes a wiring substrate, a semiconductor chip whose connection terminal is connected to the wiring substrate, an underfill resin formed from a clearance between the wiring substrate and the semiconductor chip to a periphery area of the semiconductor chip, wherein the underfill resin in the periphery area is formed at a same height as an upper surface of the semiconductor chip, an auxiliary member fixed on the semiconductor chip by an adhesive layer, and including a protruding portion which protrudes to an outside from the semiconductor chip, and the protruding portion arranged at least on the underfill resin via the adhesive layer, and a sealing resin sealing the underfill resin and at least side faces of the auxiliary member, wherein respective coefficients of thermal expansion of the auxiliary member and the adhesive layer are larger than a coefficient of thermal expansion of the semiconductor chip.
US09087773B2
Among other things, one or more systems and techniques for defining one or more implant regions or for doping a semiconductor arrangement are provided. A first implant region is defined based upon a first implant mask overlaying a first active region of a semiconductor arrangement. A second implant region is defined based upon the first implant mask and a second implant mask overlaying a second active region of the semiconductor arrangement. A third implant region is defined based upon the second implant mask overlaying a third active region of the semiconductor arrangement. One or more doping processes are performed through the first implant mask and the second implant mask to dope the semiconductor arrangement. Because the first implant mask and the second implant mask overlap the second active region, doping area coverage is improved thus mitigating undesirable voltage threshold variations otherwise resulting from inadequate doping area coverage.
US09087754B2
Structures with improved solder bump connections and methods of fabricating such structures are provided herein. The structure includes a via formed in a dielectric layer to expose a contact pad and a capture pad formed in the via and over the dielectric layer. The capture pad has openings over the dielectric layer to form segmented features. The solder bump is deposited on the capture pad and the openings over the dielectric layer.
US09087747B2
The display device includes a substrate, a thin film transistor (TFT), which includes a gate electrode, a semiconductor layer, and source and drain electrodes, on the substrate member, a passivation layer on the TFT and having an opening to expose a portion of the drain electrode, and a pixel electrode directly on the drain electrode and only within the opening.
US09087742B2
A high density micro-electrode array includes a transistor layer including a plurality of access transistors and a substrate in operable communication with the transistor layer including, wherein at least a portion of the substrate includes a plurality of trenches. The system includes a plurality of electrodes at least partially located in the plurality of trenches, wherein each of the plurality of electrodes is connected to at least one of the plurality of access transistors and wherein each of the electrodes is separated by a distance less than approximately one microns.
US09087727B2
A semiconductor device includes a semiconductor body including a first upper surface with a first side surface extending downwardly therefrom, a second upper surface with a second side surface extending downwardly therefrom, and a bottom surface interfacing first and second side surfaces. The first and second side surfaces and the bottom surface together define a groove. A conductive film partially fills the groove with an intervention of an insulating film therebetween so the conductive film terminates at a first intermediate portion of the first side surface between the first upper surface and the bottom surface and at a second intermediate portion of the second side surface between the second upper surface and the bottom surface. A distance between the first intermediate portion of the first side surface and the first upper surface exceeds a distance between the second intermediate portion of the second side surface and the second upper surface.
US09087722B2
A method of manufacturing multiple finFET devices having different thickness gate oxides. The method may include depositing a first dielectric layer on top of the semiconductor substrate, on top of a first fin, and on top of a second fin; forming a first dummy gate stack; forming a second dummy gate stack; removing the first and second dummy gates selective to the first and second gate oxides; masking a portion of the semiconductor structure comprising the second fin, and removing the first gate oxide from atop the first fin; and depositing a second dielectric layer within the first opening, and within the second opening, the second dielectric layer being located on top of the first fin and adjacent to the exposed sidewalls of the first pair of dielectric spacers, and on top of the second gate oxide and adjacent to the exposed sidewalls of the second pair of dielectric spacers.
US09087720B1
A method for forming FinFETs with reduced series resistance includes providing an intermediate semiconductor structure comprising a semiconductor substrate, a fin disposed on the semiconductor substrate, a gate disposed over a first portion of the fin, and a first sidewall spacer disposed over the fin and adjacent to the gate, increasing epitaxially the thickness of a second portion of the fin disposed outside the gate and the first sidewall spacer, and forming a second sidewall spacer disposed over the second portion of the fin and adjacent to the first sidewall spacer. A thickness of the second portion of the fin disposed under the second spacer is equal to or greater than a thickness of the first portion of the fin disposed under the gate.
US09087716B2
The present disclosure provides an improved method for forming a thin semiconductor alloy layer on top of a semiconductor layer. The proposed method relies on an implantation of appropriate impurity species before performing deposition of the semiconductor alloy film. The implanted species cause the semiconductor alloy layer to be less unstable to wet and dry etches performed on the device surface after deposition. Thus, the thickness uniformity of the semiconductor alloy film may be substantially increased if the film is deposited after performing the implantation. On the other hand, some implanted impurities have been found to decrease the growth rate of the semiconductor alloy layer. Thus, by selectively implanting appropriate impurities in predetermined portions of a wafer, a single deposition step may be used in order to form a semiconductor alloy layer with a thickness which may be locally adjusted at will.