A coaxial cable connector for connecting to a coaxial cable, the connector including a body having a longitudinal axis, a front end, an opposed rear end, and an interior. The connector also includes an inner post extending through the body and a coupling nut carried on the inner post. A pawl is carried in the interior of the body for engaging with a cable applied to the interior and preventing removal of the cable after being so applied to the interior. The pawl moves out of and into interference with the cable in response to the application of the cable into the interior of the the retraction of the cable off the inner post, respectively.
The present invention discloses an antenna system for a wireless communication device, which includes a first metal slice formed with a first slot structure, a second metal slice formed with a second slot structure, a first signal transmission line, and a second signal transmission line, wherein when the first metal slice and the second metal slice are not connected and have a distance between each other, a feeding direction of the first transmission corresponding to the first metal slice is substantially opposite to a feeding direction of the second transmission corresponding to the second metal slice; or when the first metal slice and the second metal slice are partially connected, a feeding direction of the first transmission corresponding to the first metal slice is substantially the same as or different to a feeding direction of the second transmission corresponding to the second metal slice.
An antenna system and method for fabricating an antenna are provided. The antenna system includes a substrate and an antenna. The antenna includes a conductive particle based material applied onto the substrate. The conductive particle based material includes conductive particles and a binder. When the conductive particle based material is applied to the substrate, the conductive particles are dispersed in the binder so that at least a majority of the conductive particles are adjacent to, but do not touch, one another.
A wireless device includes: a casing having a first face; a display configured to be visible from the first face; a touch sensor formed by a transparent material and mounted in the casing with respect to the display as a part of the first face; a substrate mounted to a side opposite to the first face with respect to the display; and an antenna element including: a first portion built in the casing, connected to a feeding point included in the substrate, and located within a first range occupied by the touch sensor when viewed from a direction perpendicular to the first face; and a second portion located within a second range other than the first range.
There is provided a magnetic composite sheet including: a magnetic layer including first and second magnetic pieces having different sizes; and a cover film formed on one surface or both surfaces of the magnetic layer, wherein, in a cross-section of the magnetic composite sheet taken in a direction parallel to a direction in which the magnetic layer and the cover film are laminated, when a length of the first magnetic piece in a vertical direction is a and a length thereof in a horizontal direction is b, and a length of the second magnetic piece in the vertical direction is a′ and a length thereof in the horizontal direction is b′, b/a is greater than b′/a′(b/a>b′/a′).
A hybrid coupler may include first, second, third, and fourth ports, and first, second, third, fourth, fifth, sixth, seventh, and eighth transmission lines. Each of the transmission lines may include a signal conductor inductively coupled to a signal-return conductor. The first, second, third, and fourth transmission lines may be connected together to form a loop with the first, second, and third transmission lines in series and the fourth transmission line twisted. The fifth, sixth, seventh, and eighth transmission lines may respectively connect respective junctions of the loop to the first, second, third, and fourth ports. A junction of the signal-return conductors of the first, fourth, and fifth transmission lines may not be directly connected to ground. Similarly, a junction of the signal conductor of the fourth transmission line and the signal-return conductors of the third and eighth transmission lines may not be directly connected to ground.
The directional coupler supports ultra high bandwidth of 5600 MHz (from 400 MHz to 6 GHz) in compact structure and also provides high directivity of (>15 dB). The coupler uses a two stage micro-strip directional coupler for a frequency range of 400 MHz to 6 GHz, where the first stage supports a frequency of operation from 0.4 GHz to 1 GHz and the second stage supports a frequency of operation from 1 GHz to 6 GHz and the required coupled port can be chosen using a radio frequency switch as required by the application used in.
A battery charging system includes a battery pack having a plurality of battery cells and a pack terminal, a passage that accommodates a circulation therethrough of a temperature conditioning fluid for the battery pack, the passage includes an inflow part through which the temperature conditioning fluid is introduced and an outflow part through which the temperature conditioning fluid is discharged, an inner control unit that measures a state of the battery pack to supply an inner fluid to the passage, and an outer charging unit that charges the battery pack and that supplies an outer fluid to the passage.
An apparatus may include a vehicle cover having a plurality of photovoltaic cells, an inverter, a vehicle battery connector, a plug, and a switch assembly configured to operatively couple the inverter selectively to one of the vehicle battery connector and the plug based, at least in part, on a charge level of the battery. Another apparatus may include a receptacle configured to receive a plug having an identification tag; an identification tag reader to obtain, from the identification tag, identification data associated with a customer of a power company providing a power distribution system; and a controller to receive the identification data and provide the identification data to an account server associated with the power company. A method may include receiving a plug including an identification tag, reading identification data, contacting an account server, and providing the identification data to the account server.
A sensor system for mitigating a flame condition in a battery subject to an overcharge condition and being charged using a charging current is provided. A temperature sensor is configured to detect a temperature of at least one component of the battery, and a gas sensor is configured to detect an inflammable gas or vapor. A sensor control is configured to, when the temperature of the at least one component of the battery exceeds a pre-determined temperature threshold and when the gas sensor detects an inflammable gas or vapor, halt the charging current.
A comparator circuit includes: a switching element that is disposed between a positive electrode of a battery cell and a fixed potential supply source, that has a control terminal connected to a negative electrode of the battery cell, and that operates in response to a voltage applied from the battery cell to the control terminal; a voltage regulating unit that is disposed between the battery cell and the switching element and that regulates the voltage applied from the battery cell to the switching element; and an output signal line that outputs a potential between the switching element and the fixed potential supply source.
A battery multi-series system and a communication method thereof. The battery multi-series system includes a master battery management system managing a battery; and a block master battery management system connected to the master battery management system and receiving data from at least one slave battery management system and storing the received data, wherein the master battery management system receives data periodically from the block master battery management system.
A positive electrode protective layer composition of a rechargeable lithium battery includes a polymer compound and an ionic liquid including a borate-based anion. A rechargeable lithium battery includes the positive electrode protective layer. A method of manufacturing the same is also provided.
Provided is a high-capacity and highly-flexible electrode group for thin batteries, a thin battery including the electrode group, and an electronic device in which the thin battery is incorporated.The electrode group for thin batteries includes: a sheet-like first electrode, a sheet-like second electrode being laminated on each of both surfaces of the first electrode, and an electrolyte layer interposed between the first electrode and the second electrode. The second electrode has a polarity opposite to that of the first electrode. The second electrode has a flexural modulus lower than that of the first electrode. The thin battery includes the electrode group, and a pouch-like housing accommodating the electrode group. The electronic device includes an electronic device main body with flexibility, and the thin battery is incorporated in the electronic device main body.
A cathode composite material includes a cathode active material and a coating layer coated on a surface of the cathode active material. The cathode active material includes a spinel type lithium manganese oxide. The coating layer comprises a lithium metal oxide having a crystal structure belonging to C2/c space group of the monoclinic crystal system. The present disclosure also relates to a lithium ion battery including the cathode composite material.
Adjacent elementary cells are connected in series by connecting elements, each of which is arranged in an interconnection area. The connecting elements are separated from the respective electrolytic membranes of the two adjacent cells to be connected thereby. In this way, they are never in contact with these electrolytic membranes. For one of the two cells, the connecting element is separated from the electrolytic membrane by an empty space, whereas for the other cell, it is separated from the electrolytic membrane by a thin barrier layer designed to act as buffer area for variations in volume of said membrane when the cell is in operation. The thin barrier layer is formed by a polymer material having a lower water absorption capacity than that of the polymer material constituting the electrolytic membrane of the cell.
A plurality of cell units is stacked. A pressurizing mechanism applies a compressive force in a stacked direction to a stacked structure of the cell units. Each of the cell units includes a power storage cell, and a frame body which supports the power storage cell. The frame body includes a positioning portion which restrains a relative position with respect to a direction perpendicular to the stacked direction of the frame bodies adjacent in the stacked direction. The positioning portion positions the frame bodies with respect to the direction perpendicular to the stacked direction. A margin is kept in a direction in which the frame bodies are closer in the stacked direction in a state where the compressive force is applied to the stacked structure due to pressurization through the pressurizing mechanism.
An adhesive material is used to bond between layers of a fuel cell. The adhesive material includes an adhesive resin, conductive particles and a conductive resin.
A removable, or reusable, template suitable for forming three dimensional structures of various devices ranging from photovoltaics to electrodes for electrochemical cells is disclosed.
A method and apparatus for extracting water. The apparatus comprises a first and second cooling device and a controller. The first cooling device has a first and second side. The first side heats materials located at the first side and generates a water vapor. The second side cools the water vapor and fluids collected from a source. The second cooling device transfers heat from the water vapor and the fluids flowing through the second cooling device to an environment around the second cooling device. A controller controls a first amount of power delivered to the first cooling device and a second amount of power delivered to the second cooling device based on a temperature for the fluids and the water vapor at an output. Water extracted from the fluids and the water vapor by cooling the fluids and the water vapor is collected at the output.
A method of fabricating an organic electroluminescence display device includes providing a substrate including a plurality of pixel regions, first electrodes, and a partition wall, the pixel regions including two pixel columns, providing a mask including openings and first inclined surfaces, the openings being at positions corresponding to the two pixel columns, each of the first inclined surfaces being inclined toward one of the openings and including a portion extending to a region between the two pixel columns, positioning the mask such that each of the openings faces a portion of one of the pixel regions, dropping a solution containing an organic electroluminescence material onto the first inclined surfaces such that the solution is supplied onto the first electrodes through the openings to coat the first electrodes, evaporating solvent from the solution to form an organic electroluminescence layer, and forming a second electrode on the organic electroluminescence layer.
A semiconductor memory device having a cell pattern formed on an interconnection and capable of reducing an interconnection resistance and a fabrication method thereof are provided. The semiconductor device includes a semiconductor substrate in which a cell area, a core area, and a peripheral area are defined and a bottom structure is formed, a conductive line formed on an entire structure of the semiconductor substrate, a memory cell pattern formed on the conductive line in the cell area, and a dummy conductive pattern formed on any one of the conductive line in the core area and the peripheral area.
A method for manufacturing a pattern multilayer body that has a plurality of pattern layers, and where a pattern is formed in each pattern layer, includes a step of forming an overlay pattern within an overlay pattern formation region, and in the step of forming the overlay pattern, a photoresist film is formed, and after a photoresist film is exposed via a main mask, a resist pattern is formed by exposing a sub mask(s). The main mask has a pattern light-shielding part that is commonly used for forming a pattern in each pattern layer, and each main light-shielding part for forming each overlay pattern; and a sub mask has an opening part that is exposable to an unexposed region(s) within an overlay pattern formation region other than an unexposed region(s) on the photoresist film, which has been light-shielded by the main light-shielding part for forming a corresponding overlay pattern.
A semiconductor device is provided having a free layer and a pinned layer spaced apart from each other. A tunnel barrier layer is formed between the free layer and the pinned layer. The pinned layer may include a lower pinned layer, and an upper pinned layer spaced apart from the lower pinned layer. A spacer may be formed between the lower pinned layer and the upper pinned layer. A non-magnetic junction layer may be disposed adjacent to the spacer or between layers in the upper or lower pinned layer.
An ultrasonic-motor-driving device is provided which allows fine adjustment of the periods of driving waves that are generated by a driving-wave-generating portion. A driving device for an ultrasonic motor includes a driving-wave-generating portion. The driving-wave-generating portion generates signals for driving piezoelectric elements included in the ultrasonic motor. The driving-wave-generating portion is constructed capable of generating rectangular waves including a plurality of rectangular waves with different periods.
A light-emitting device includes a substrate, a light-emitting element mounted on a first flat surface of the substrate, and a glass sealing member for sealing the light-emitting element, wherein the sealing member is in contact with the first flat surface and a side surface of the substrate and a second flat surface of the surface opposite to the first flat surface is exposed.
A light emitting device includes an electrically conductive member provided with a reflective film; a light emitting element mounted on the reflective film; and a protective film continuously covering a surface of the light emitting element and a surface of the reflective film. A thickness of the protective film on the reflective film in a vicinity of the light emitting element is substantially equal to a thickness of the protective film on the reflective film in the region except for the vicinity of the light emitting element.
The present invention belongs to the technical field of optical interconnection and relates to a photo detector, in particular to a photo detector consisting of tunneling field-effect transistors.
Disclosed are a metal wrap through solar cell including a metal wrap through (MWT) structure as a back contact silicon solar cell and a fabrication method thereof.
An optical sensor, according to an embodiment of the present invention, includes a photodetector region and a plurality of slats over the photodetector region. In an embodiment, the slats are made of an opaque polymer material, such as an opaque photoresist. In an embodiment, the slats are angled relative to a surface of the photodetector region.
The formation of solar cell contacts using a laser is described. A method of fabricating a back-contact solar cell includes forming a poly-crystalline material layer above a single-crystalline substrate. The method also includes forming a dielectric material stack above the poly-crystalline material layer. The method also includes forming, by laser ablation, a plurality of contacts holes in the dielectric material stack, each of the contact holes exposing a portion of the poly-crystalline material layer; and forming conductive contacts in the plurality of contact holes.
According to embodiments of the present invention, a semiconductor photomultiplier device is provided. The semiconductor photomultiplier device includes a substrate having a front side and a back side, a common electrode of a first conductivity type adjacent to the back side, and a cell including an active region of a second conductivity type adjacent to the front side, and a contact region of the second conductivity type adjacent to the front side, the contact region being spaced apart from the active region by a separation region.
Provided is a rectifier such as a detector in which a cutoff frequency may be increased in a view point different from the reduction in size of the structure. The rectifier includes: a Schottky barrier portion including a Schottky electrode; a barrier portion having a rectifying property with respect to a majority carrier in the Schottky barrier portion; and an ohmic electrode in electrical contact with the barrier portion having the rectifying property, in which each of the Schottky barrier portion and the barrier portion having the rectifying property has an asymmetrical band profile whose gradient on one side is larger than a gradient of another side, and the Schottky barrier portion and the barrier portion having the rectifying property are connected to each other so that the steep gradient side of the band profile is located on a side of the Schottky electrode.
A method for manufacturing a semiconductor light emitting device includes forming an isolation pattern on a semiconductor single crystal growth substrate. A first conductivity-type semiconductor layer, an active layer, and a second conductivity-type semiconductor layer are sequentially grown in one chip unit region of the semiconductor single crystal growth substrate defined by the isolation pattern, and a reflective metal layer is formed to cover the light emitting structure and the isolation pattern. A support substrate is formed on the reflective metal layer, and the semiconductor single crystal growth substrate is removed from the light emitting structure. The support substrate is then cut into individual light emitting devices.
A trench structure that in one embodiment includes a trench present in a substrate, and a dielectric layer that is continuously present on the sidewalls and base of the trench. The dielectric layer has a dielectric constant that is greater than 30. The dielectric layer is composed of tetragonal phase hafnium oxide with silicon present in the grain boundaries of the tetragonal phase hafnium oxide in an amount ranging from 3 wt. % to 20 wt. %.
The present description relates the formation of a first level interlayer dielectric material layer within a non-planar transistor, which may be formed by a spin-on coating technique followed by oxidation and annealing. The first level interlayer dielectric material layer may be substantially void free and may exert a tensile strain on the source/drain regions of the non-planar transistor.
A method and apparatus for use in improving linearity sensitivity of MOSFET devices having an accumulated charge sink (ACS) are disclosed. The method and apparatus are adapted to address degradation in second- and third-order intermodulation harmonic distortion at a desired range of operating voltage in devices employing an accumulated charge sink.
A first first-conductivity-type impurity region (4) is provided in an upper portion of a semiconductor layer (102) around a trench (12). A gate electrode (8) is provided on a sidewall surface of the trench (12), and on the semiconductor layer (102) around the trench (12) with a gate insulating film (11) interposed therebetween. A second-conductivity-type impurity region (50) and a second first-conductivity-type impurity region (51) are interposed between a portion of the gate electrode (8) around the trench (12) and the first first-conductivity-type impurity region (4) sequentially on the first first-conductivity-type impurity region (4).
A system and method for providing a post-passivation and underbump metallization is provided. An embodiment comprises a post-passivation layer that is larger than an overlying underbump metallization. The post-passivation layer extending beyond the underbump metallization shields the underlying layers from stresses generated from mismatches of the materials' coefficient of thermal expansion.
Device structures and design structures for a bipolar junction transistor. A semiconductor material layer is formed on a substrate and a mask layer is formed on the semiconductor material layer. The mask layer is patterned to form a plurality of openings to the semiconductor material layer. After the mask layer is formed and patterned, the semiconductor material layer is etched at respective locations of the openings to define a first trench, a second trench separated from the first trench by a first section of the semiconductor material layer defining a terminal of the bipolar junction transistor, and a third trench separated from the first trench by a second section of the semiconductor material layer defining an isolation pedestal. A trench isolation region is formed at a location in the substrate that is determined at least in part using the isolation pedestal as a positional reference.
A substrate transferring system and a substrate transferring method are disclosed. The substrate transferring system comprises a substrate processing stage comprising a first substrate processing stage and a second substrate processing stage; a substrate outlet stage being adapted to output a substrate; a substrate transferring stage being disposed between the first substrate processing stage and the second substrate processing stage to receive the substrate from the substrate processing stage; a substrate supporting stage being disposed adjacent to the substrate transferring stage to receive the substrate from the substrate transferring stage; and a substrate conveying and transshipping stage being disposed in parallel with the substrate outlet stage to receive the substrate from the substrate supporting stage and to transfer the substrate to the substrate outlet stage. With this arrangement of the present disclosure, substrates can be transferred rapidly to shorten the substrate transferring period, thus improving the production efficiency.
A semiconductor device includes an n-type drain layer, an n-type base layer provided on the n-type drain layer, a p-type base layer and an n-type source layer partially formed in surface layer portions of the n-type base layer and the p-type base layer, respectively, a gate insulation film formed on a surface of the p-type base layer between the n-type source layer and the n-type base layer, a gate electrode formed on the gate insulation film facing the p-type base layer across the gate insulation film, a p-type column layer formed within the n-type base layer to extend from the p-type base layer toward the n-type drain layer, a depletion layer alleviation region arranged between the p-type column layer and the n-type drain layer and including first baryons converted to donors, a source electrode connected to the n-type source layer, and a drain electrode connected to the n-type drain layer.
A method of three dimensional heterogeneous integration including forming HBT devices on a first substrate, each HBT device having a collector, removing the first substrate, forming first bonding pads on each collector of the heterojunction bipolar transistor devices, forming high electron mobility transistor (HEMT) devices on a first side of a growth substrate, wherein the growth substrate comprises a thermally conductive substrate, such as SiC or diamond, forming second bonding pads on the first side of the growth substrate, aligning and bonding the first bonding pads to the second bonding pads, forming CMOS devices on a Si substrate, bonding the CMOS devices on the Si substrate to a second side of the growth substrate, and forming selectively interconnects between the HBT devices, the HEMT devices, and the CMOS devices by forming vias and first and second level metal interconnects.
Disclosed are semiconductor structures with metal lines and methods of manufacture which reduce or eliminate extrusion formation. The method includes forming a metal wiring comprising a layered structure of metal materials with an upper constraining layer. The method further includes forming a film on the metal wiring which prevents metal extrusion during an annealing process.
A method is disclosed for fabricating a semiconductor structure. The method includes providing a semiconductor substrate having an oxide layer on a surface of the semiconductor substrate, and removing the oxide layer to expose the surface of the semiconductor substrate. The method also includes performing a thermal annealing process on the semiconductor substrate using an inert gas as a thermal annealing protective gas after removing the oxide layer, and forming an insulating layer on the semiconductor substrate after performing the thermal annealing process. Further, the method includes forming a high-K gate dielectric layer on a surface of the insulating layer, and forming a protective layer on a surface of the high-K gate dielectric layer.
A semiconductor structure and a method for manufacturing the same are provided. The method comprises following steps. A first silicon-containing conductive material is formed on a substrate. A second silicon-containing conductive material is formed on the first silicon-containing conductive material. The first silicon-containing conductive material and the second silicon-containing conductive material have different dopant conditions. The first silicon-containing conductive material and the second silicon-containing conductive material are thermally oxidized for turning the first silicon-containing conductive material wholly into an insulating oxide structure, and the second silicon-containing conductive material into a silicon-containing conductive structure and an insulating oxide layer.
A semiconductor device includes at least one semiconductor chip, a gate wiring connected to the at least one semiconductor chip, a first wiring connected to the at least one semiconductor chip, and a second wiring connected to the at least one semiconductor chip. The first and second wirings extend along the gate wiring. The first wiring is arranged between the gate wiring and second wiring. The first wiring is the wiring closest to the gate wiring. A first part of the gate wiring opposing the first wiring is shorter than a second part of the gate wiring opposing the second wiring.
An electrically conductive lead is formed using a bonding tool. After bonding the wire to a metal surface and extending a length of the wire beyond the bonding tool, the wire is clamped. Movement of the bonding tool imparts a kink to the wire at a location where the wire is fully separated from any metal element other than the bonding tool. A forming element, e.g., an edge or a blade skirt provided at an exterior surface of the bonding tool can help kink the wire. Tensioning the wire using the bonding tool causes the wire to break and define an end. The lead then extends from the metal surface to the end.
Settings of color parameters relating to a plurality of colors and length parameters relating to lengths of line segments of the respective colors are accepted via a setting image. A Line having the plurality of colors is created by an image processing unit connecting the line segments of the respective colors to each other that respectively have the colors according to the color parameters and the lengths according to the length parameters, and a pattern with multiple lines is created by the image processing unit arranging the created line in a repeated manner in a predetermined area. Effects: Various types of cyclic patterns are automatically created.
An etching method can improve etching accuracy as well as secure selectivity when forming a dummy gate of a fin-type field effect transistor. In the etching method, the dummy gate of a fin-type field effect transistor is formed with a target object. In the etching method, a gate material deposited between multiple fins is etched by using surface wave plasma. A pressure in the etching method is 50 mTorr (6.67 Pa) or more, a frequency of a power to be applied to a mounting table configured to mount thereon the target object is in a range of 10 Hz or more to 200 Hz or less, and the power is pulse-modulated such that a duty ratio as a ratio of an ON-time to a pulse cycle is 50% or less.
A method of making a semiconductor assembly including the steps of: (i) providing an initial-state assembly including: (a) a fin layer, and (b) a hard mask layer located on top of at least a portion of the fin layer; (ii) performing a first material removal on the initial-state assembly, by CMP, to yield a second-state assembly; and (iii) performing a second material removal on the second-state assembly to yield a third-state assembly. In the first material-removal step: (i) any remaining portion of the soft sacrificial layer is removed, (ii) a portion of the fin layer is removed, and (iii) the lower portion of the hard mask layer is used as a stop layer for the second material removal.
By depositing a layer of oxidizing metal on the semiconductor surface first and then depositing a layer of the high-k oxide material over the layer of oxidizing metal by an atomic layer deposition, a high-k metal oxide is formed at the interface between the semiconductor substrate and the high-k oxide and prevents formation of the undesirable low-k semiconductor oxide layer at the semiconductor/high-k oxide interface.
Semiconductor packages and methods for forming a semiconductor package are disclosed. The method includes providing a package substrate having first and second major surfaces. The package substrate includes a base substrate having a mold material and a plurality of interconnect structures including via contacts extending through the first to the second major surface of the package substrate. A die having conductive contacts on its first or second surface is provided. The conductive contacts of the die are electrically coupled to the interconnect structures. A cap is formed over the package substrate to encapsulate the die.
A semiconductor structure includes a III-V monocrystalline layer and a germanium surface layer. An interlayer is formed directly between the III-V monocrystalline layer and the germanium surface layer from a material selected to provide stronger nucleation bonding between the interlayer and the germanium surface layer than nucleation bonding that would be achievable directly between the III-V monocrystalline layer and the germanium surface layer such that a continuous, relatively defect-free germanium surface layer is provided.
A method of fabricating an LDMOS device includes: forming a gate of the LDMOS device on a semiconductor substrate; performing tilt body implantation by implanting dopants of a first conductivity type in the semiconductor substrate using a mask, wherein the tilt body implantation is implanted at an angle from a vertical direction; performing zero tilt body implantation by implanting dopants of the first conductivity type using the same mask, wherein the zero tilt body implantation is implanted with zero tilt from the vertical direction, and wherein the tilt body implantation and the zero tilt body implantation are configured to form a body region of the LDMOS device; and forming a source region and a drain contact region of the LDMOS device, wherein the source region and the drain contact region are of a second conductivity type.
A magnetic memory device is provided. The magnetic memory device may include a plurality of word lines extending along a direction crossing a plurality of active regions and at least one source line connected to a plurality of first active regions arranged on a level that is lower than the upper surface of a substrate. A plurality of contact pads may be connected to a plurality of second active regions and a plurality of buried contact plugs may be connected to the plurality of second active regions via the plurality of contact pads. Said buried contact pads may further be arranged in a hexagonal array structure. A plurality of variable resistance structures may be connected to the plurality of second active regions and arranged in a hexagonal array structure.
A semiconductor device according to one embodiment is provided with a first metal substrate, a second metal substrate separated from the first metal substrate, a normally-off transistor of a silicon semiconductor provided on the first metal substrate, and a normally-on transistor of a nitride semiconductor provided on the second metal substrate.
A solid-state imaging device includes a pixel unit in which a plurality of pixels converting physical quantities into electric signals are arranged in a two-dimensional shape, a vertical signal line for reading signals from the pixels, and column circuits arranged corresponding to columns of the pixel unit and collecting the signals from the vertical signal line at the inside of the pixel unit.
A method for fabricating a thin film transistor includes printing source, drain and channel regions on a passivated transparent substrate, forming a gate dielectric over the channel region and forming a gate conductor over the gate dielectric. A permanent antireflective coating is deposited over the source region, drain region and gate electrode, and an interlevel dielectric layer is formed over the permanent antireflective coating. Openings in the permanent antireflective coating and the interlevel dielectric layer are formed to provide contact holes to the source region, drain region and gate electrode. A conductor is deposited in the contact holes to electrically connect to the source region, drain region and gate electrode. Thin film transistor devices and other methods are also disclosed.
An active matrix substrate (20a) includes a gate electrode (25) formed on an insulating substrate (10a), and a planarizing film (26) formed on the gate electrode (25) and made of a baked SOG material. The gate electrode (25) is a multilayer film including a first conductive film (27) formed on the insulating substrate (10a) and made of a metal except copper, a second conductive film (28) formed on the first conductive film (27) and made of copper, and a third conductive film (29) formed on the second conductive film (28) and made of the metal except copper.
An apparatus and a method for creating a CMOS with a dual raised source and drain for NMOS and PMOS. The spacers on both stack gates are of equal thickness. In this method, a first insulating layer is formed on the surface. The first region is then masked while the other region has the first layer etched away and has an epitaxial source and drain grown on the region. A second layer is formed to all exposed surfaces. The second region is then masked while the first region is etched away. The epitaxial source and drain is formed on the first region. The second region can also be masked by adding a thin layer of undoped silicon and then oxidize it. Another way to mask the second region is to use a hard mask. Another way to form the second source and drain is to use amorphous material.
A semiconductor device includes first conductive layers and first interlayer insulating layers stacked alternately with each other, at least one second conductive layer and at least one second interlayer insulating layer formed on the first conductive layers and the first interlayer insulating layers and stacked alternately with each other, a first semiconductor layer passing through the first conductive layers and the first interlayer insulating layers and including polysilicon, and a second semiconductor layer coupled to the first semiconductor layer and passing through the at least one second conductive layer the at least one second interlayer insulating layer, wherein the second semiconductor layer includes silicon germanium.
A semiconductor device includes a plurality of cylindrical structures located at vertices and central points of a plurality of hexagons in a honeycomb pattern, and a unitary support having a plurality of openings. Each of the openings exposes a part each of four of the cylindrical structures. Each of the openings has the shape of a parallelogram or an oval substantially. A first distance between opposite cylindrical structures of a first pair of the four cylindrical structures exposed by each opening is shorter than a second distance between opposite cylindrical structures of a second pair of the four cylindrical structures exposed by the opening. The first distance is equal to a distance between the central point and each of the vertices of the hexagon.
A transistor includes a multilayer film in which an oxide semiconductor film and an oxide film are stacked, a gate electrode, and a gate insulating film. The multilayer film overlaps with the gate electrode with the gate insulating film interposed therebetween. The multilayer film has a shape having a first angle between a bottom surface of the oxide semiconductor film and a side surface of the oxide semiconductor film and a second angle between a bottom surface of the oxide film and a side surface of the oxide film. The first angle is acute and smaller than the second angle. Further, a semiconductor device including such a transistor is manufactured.
One method disclosed herein includes performing at least one common process operation to form a plurality of first gate structures for each of a plurality of field effect transistors and a plurality of second gate structures above a region where a bipolar transistor will be formed and performing an ion implantation process and a heating process to form a continuous doped emitter region that extends under all of the second gate structures. A device disclosed herein includes a first plurality of field effect transistors with first gate structures, a bipolar transistor that has an emitter region and a plurality of second gate structures positioned above the emitter region, wherein the bipolar transistor comprises a continuous doped emitter region that extends laterally under all of the plurality of second gate structures.
According to example embodiments, a semiconductor device may include a high electron mobility transistor (HEMT) on a first region of a substrate, and a diode on a second region of the substrate. The HEMT may be electrically connected to the diode. The HEMT and the diode may be formed on an upper surface of the substrate such as to be spaced apart from each other in a horizontal direction. The HEMT may include a semiconductor layer. The diode may be formed on another portion of the substrate on which the semiconductor layer is not formed. The HEMT and the diode may be cascode-connected to each other.
A treatment system comprises an energy source that generates a energy beam that is emitted along an energy beam pathway. A beam section shaper is positioned along the energy beam pathway that receives an incident energy beam and modifies a section shape thereof to output a shape-modified energy beam. A beam intensity shaper is positioned along the energy beam pathway that receives an incident energy beam having a first intensity profile and outputs an intensity-modified energy beam having a second intensity profile, wherein the first intensity profile has a relative maximum average intensity at a center region thereof and wherein the second intensity profile has a relative minimum average intensity at a center region thereof.
A method for crystallizing a silicon substrate includes manufacturing a crystallized silicon test substrate that is crystallized by scanning excimer laser annealing beams with different energy densities on respective areas of an amorphous silicon test substrate, irradiating a surface of the crystallized silicon test substrate using a light source, and measuring reflectivity corresponding to the respective areas of the crystallized silicon test substrate in a visible light wavelength range, extracting average reflectivities of the respective areas of the crystallized silicon test substrate in wavelength ranges corresponding to respective colors, calculating an optimum energy density (OPED) index per energy density by using a value acquired by subtracting average reflectivity of red-based colors from average reflectivity of blue-based colors, selecting an optimal energy density, and crystallizing an amorphous silicon substrate using the optimal energy density.
A method transfers a graphene layer from a donor substrate onto a final substrate. The method includes: providing a metal layer on the donor substrate; and growing a graphene layer on the metal layer. The method also includes: laminating a dry film photo-resist on the graphene layer; laminating a tape on the dry film photo-resist; chemically. etching the metal layer, obtaining an initial structure that includes the tape, the dry film photo-resist and the graphene layer; laminating the initial structure on the final substrate; thermally realizing the tape, so as to obtain an intermediate structure that includes the dry film photo-resist, the graphene layer and the final substrate; removing the dry film photo-resist; and obtaining a final structure that includes the final substrate with a transferred graphene layer.
In a semiconductor memory device, a plurality of control gates is stacked in a first region and a second region of a substrate. A plurality of interlayer insulating layers is stacked in a portion of the second region of the substrate. Each interlayer insulating layer is formed at the same level as a corresponding one of the control gates. A plurality of sub-control gates is stacked in the first and second regions region of the substrate and interposed between the control gates and the interlayer insulating layers. A common node penetrates the interlayer insulating layers and the sub-control gates.
A method of fabricating a semiconductor device that includes providing a substrate having at least a first semiconductor layer atop a dielectric layer, wherein the first semiconductor layer has a first thickness of less than 10 nm. The first semiconductor layer is etched with a a halide based gas at a temperature of less than 675° C. to a second thickness that is less than the first thickness. A second semiconductor layer is epitaxially formed on an etched surface of the first semiconductor layer. A gate structure is formed directly on the second semiconductor layer. A source region and a drain region is formed on opposing sides of the gate structure.
Presented is a mass spectrometer comprising an ion path along which ions are transported between different sections of the mass spectrometer, and further comprising an arrangement with a receptacle being located along the ion path in the mass spectrometer and a complementary mount for carrying a removable ion-optical assembly, such as a carrier of electrodes for a MALDI ion source, wherein the mount can be removed from and reinserted into the receptacle in a plane approximately perpendicular to an ion path axis.
A method of generating a signal representing with an ion energy analyzer for use in determining an ion energy distribution of a plasma. The ion energy analyzer, used for determining an ion energy distribution of a plasma, includes a first grid and a second grid that is spaced away from and electrically isolated from the first grid. The first grid forms a first surface of the ion energy analyzer and is positioned to be exposed to the plasma. The first grid includes a first plurality of openings, which are dimensioned to be less than a Debye length for the plasma. A voltage source and an ion current meter are operably coupled to the second grid, the latter of which is configured to measure an ion flux onto the ion collector and to transmit a signal that represents the measured ion flux. The method includes selectively and variably biasing the second grid relative to the first grid.
Key switch mechanisms are typically used for mediating user input to computing devices. A key switch mechanism provides immediate tactile feedback to a user upon user-actuation thereof. Unlike touchscreen interfaces, existing key switch mechanisms of conventional keyboards do not provide a user with a dynamically changeable interface. Described is a key switch mechanism that comprises a circuit module, a key cap and a linkage mechanism for guiding travel of the key cap substantially along a travel axis. The linkage mechanism comprises a positioning board and a main link pivotably inter-coupling the positioning board and the key cap. The main link substantially impedes tilt of the key cap away from the travel axis during travel of the key cap therealong from a released position, whereat the key cap is biased, to a depressed position whereat a control signal is generated.
An operating knob including a first illumination portion with an annular shape and a second illumination portion, is provided around the operating knob. The operating knob is configured by a combination of an inner shaft body made of a resin and a grip ring body, allowing the inner shaft body to be fitted outward. A light shielding cap is attached to a front end portion of the inner shaft body. A cylindrical light guide portion having the first illumination portion in the front end face and a drive portion to be connected to a rotating shaft are integrally molded in the inner shaft body, and a rear end face of the cylindrical light guide portion opposes a first light emitting face. A light incident face opposes a light source and the first and second illumination portions and are illuminated by light of the light source via the light guide member.
A contact device includes a contact point block, a drive unit, and permanent magnets. The contact point block includes fixed terminals having fixed contact points and a movable contactor having movable contact points arranged side by side on one surface of the movable contactor. The movable contact points are configured to come into contact and out of contact with the fixed contact points. The drive unit drives the movable contactor such that the movable contact points come into contact and out of contact with the fixed contact points. The permanent magnets are arranged in a mutually opposing relationship across the contact point block along a direction orthogonal to an arrangement direction of the movable contact points and to a direction in which the movable contact points come into contact and out of contact with the fixed contact points. The permanent magnets are provided with mutually-opposing surfaces having the same polarity.
A two terminal arc suppressor for protecting switch, relay or contactor contacts and the like comprises a two terminal module adapted to be attached in parallel with the contacts to be protected and including a circuit for deriving an operating voltage upon the transitioning of the switch, relay or contactor contacts from a closed to an open disposition, the power being rectified and the resulting DC signal used to trigger a power triac switch via an optoisolator circuit whereby arc suppression pulses are generated for short predetermined intervals only at a transition of the mechanical switch, relay or contactor contacts from an closed to an open transition and, again, at an open to a close transition during contact bounce conditions.
A vibration limit switch system and related method is provided with a piezoelectric transmitting- and/or receiving unit, in operable connection with a membrane that can be put in oscillation, and a mechanical oscillation arrangement that is coupled to the membrane, whereby the piezoelectric transmitting- and/or receiving unit is adhered directly, or via an adaptation layer by an adhesive layer, to the membrane 4. In this improvement, the adhesive layer between the membrane and the transmitting-and/or receiving unit or the adaptation layer has a thickness in an edge area R which thickness is elevated in comparison to a central area Z. This thickness is arranged in differing geometries and amounts to further improve performance.
A multilayer ceramic capacitor includes a ceramic body; first and second internal electrodes including first and second body parts overlapped with each other and first and second lead-out parts having an overlap region and exposed to one surface of the ceramic body; first and second external electrodes formed on one surface of the ceramic body; and an insulating layer formed on one surface of the ceramic body, wherein first and second connection surfaces extended from end portions of the first and second body parts to end portions of the first and second lead-out parts are inclined, and when half of length of the internal electrode is defined as A and length from a center of the ceramic body to a starting point of the connection surface is defined as B, B/A satisfies 0.03≦B/A≦0.90.
A multilayer ceramic electronic component includes: a ceramic main body; a plurality of internal electrodes laminated within the ceramic main body; and external electrodes formed on outer surfaces of the ceramic main body and electrically connected to the internal electrodes, wherein an average thickness of the external electrodes is 10 μm or less, and when a thickness of the external electrodes in a central portion of the ceramic main body in a width direction is Tc and a thickness of the external electrodes at a lateral edge of a printed surface region of the internal electrodes is T1, 0.5≦|T1/Tc|≦1.0 is satisfied.
In a multilayer capacitor, a dimension of a third terminal electrode on a second main surface in a length direction is greater than a dimension of first and second terminal electrodes on the second main surface in the length direction. The first to third terminal electrodes extend across the second main surface from one end to the other end in a width direction and have a thickest portion at a portion on a side of the other end beyond the center portion in the width direction, and the thickest portion projects toward the center in the length direction.
Provided are an electroconductive polymer suspension solution and a method for producing the same, which has excellent adhesion to a substrate and excellent liquid resistance and which can provide an organic material having high electroconductivity. An electroconductive polymer suspension solution of an exemplary embodiment of the invention contains an electroconductive polymer, at least one kind of a water-soluble polyhydric alcohol, and at least one kind of a water-soluble organic substance having two or more functional groups which can be polycondensed with the water-soluble polyhydric alcohol. The electroconductive polymer suspension solution can be produced by collecting an electroconductive polymer which is obtained by chemical oxidative polymerization of a monomer giving the electroconductive polymer by using an oxidant in a solvent containing an organic acid or a salt thereof as a dopant, by contacting the electroconductive polymer with an oxidant in an aqueous solvent containing a polyacid, and further by mixing at least one kind of a water-soluble polyhydric alcohol and at least one kind of a water-soluble organic substance having two or more functional groups which can be polycondensed with the water-soluble polyhydric alcohol.
A method for manufacturing an electronic component for avoiding electromagnetic interference includes: (a) placing a T-shaped core and an air-core coil in a metal mold; (b) injecting a mixture of a composite magnetic material and a resin into the metal mold so that the T-shaped core and the air-core coil are embedded by the mixture; (c) heating the mixture at a first temperature; (d) adjusting an outer shape while removing excessive mixture; and (e) hardening the mixture. The method may further include a process of polishing an outside of the hardened mixture. The method may further include a process of applying a pressure of 0.1 to 20.0 kg/cm2 to the mixture for adjusting an outer shape of the mixture by a movable punch of a press machine before the hardening process.
In an embodiment, a permanent magnet includes a composition represented by R(Fep(TisM1-s)qCur(Co1-tAt)1-p-q-r)z (R is at least one element selected from rare earth elements, M is at least one element selected from Zr and Hf, A is at least one element selected from Ni, V, Cr, Mn, Al, Ga, Nb, Ta and W, and p, q, r, s, t and z are numbers satisfying 0.3≦p≦0.6, 0.01≦q≦0.1, 0.01≦r≦0.15, 0.2≦s≦0.8, 0≦t≦0.2, 6≦z≦9 in an atomic ratio, respectively), and a structure composed mainly of a Th2Zn17 crystal phase and a CaCu5 crystal phase.
A collimator for an imaging system includes a first region comprising a first one-dimensional array of apertures along a channel direction, and a second region comprising a second one-dimensional array of apertures along the channel direction, wherein an aspect ratio of the apertures of the first region is greater than an aspect ratio of the second region.
An X-ray obscuration (XRO) film comprising one or more metallic wire mesh layers and an adjacent layer of indium foil having portions which extend into openings of the wire mesh and in contact with metallic portions thereof. The XRO film can be capable of absorbing at least a portion of X-ray energy thereby creating an interference pattern when the XRO film is coupled with an electronic circuit and placed between an X-ray source and an X-ray detector and subjected to radiographic inspection. The interference pattern can create sufficient visual static to effectively obscure circuit lines in the electronic circuit when subjected to radiographic inspection techniques. The XRO film can be substantially thinner than existing solutions for preventing X-ray inspection with an exemplary embodiment being no more than 5 mils thick. The metallic XRO film can also provide electromagnetic shielding and/or heat dissipation for electronic circuits.
A pre-charging method applied in DRAM which includes steps of: enabling wordlines in an active array and an reference array; disabling the wordlines in the active array; equilibrating digital lines in the active array and the reference array to half of a power supply voltage; storing the half of the power supply voltage in reference cells of the reference array; disabling the wordlines in the reference array; pre-charging the digital lines in the active array and the reference array to the power supply voltage; and enabling the wordlines in the active array and the reference array at the same time.
Apparatus and method for using a precharge command in which a plurality of address lines are individually used to specify which banks of memory cells within a memory device have an open row that is to be closed.
A memory device and method, such as a flash memory device and method, includes a memory having a plurality of nonvolatile memory cells for storing stored values of user data. The memory device and method includes a memory controller for controlling the memory. The memory controller includes an encoder for encoding user write data for storage of code values as the stored values in the memory. The encoder includes an inserter for insertion of an indicator as part of the stored values for use in determining when the stored values are or are not in an erased state. The memory controller includes a decoder for reading the stored values from the memory to form user read data values when the stored values are not in the erased state.
Integrated circuits and methods for fabricating integrated circuits are provided. In an exemplary embodiment, an integrated circuit includes a semiconductor substrate doped with a first conductivity-determining impurity. The semiconductor substrate has formed therein a first well doped with a second conductivity-determining impurity that is different from the first conductivity-determining impurity, a second well, formed within the first well, and doped with the first conductivity-determining impurity, and a third well spaced apart from the first and second wells and doped with the second conductivity-determining impurity. The integrated circuit further includes a floating gate structure formed over the semiconductor substrate. The floating gate structure includes a first gate element disposed over the second well and being separated from the second well with a dielectric layer, a second gate element disposed over the third well and being separated from the third well with the dielectric layer, and a conductive connector.
An embodiment of the invention includes first and second Ternary Content Addressable Memories (TCAMs), a first vector, and TCAM match-merge unit. Each of the TCAMs includes a plurality of words, stores TCAM match entries and outputs a TCAM match signal for each word in the plurality of words. The first vector includes first TCAM group enable register bits. An enabling value on the first TCAM register bit indicates that the first TCAM match signal and the neighboring first TCAM match are in the same TCAM group. The TCAM match-merge unit receives the first TCAM match signal from each of the words and the first vector and outputs a first TCAM group match signal for each of the words. The TCAM match-merge unit outputs a match indication when any of the TCAM match signals indicate a match and outputs a mismatch when none of the TCAM match signals match.
Semiconductor memory is provided wherein a memory cell includes a capacitorless transistor having a floating body configured to store data as charge therein when power is applied to the cell. The cell further includes a nonvolatile memory comprising a resistance change element configured to store data stored in the floating body under any one of a plurality of predetermined conditions. A method of operating semiconductor memory to function as volatile memory, while having the ability to retain stored data when power is discontinued to the semiconductor memory is described.
A control circuit includes a data driver, a charge circuit, and a first data line coupled with the data driver and the charge circuit. The charge circuit is configured to charge the first data line when the first data line is selected for accessing a memory cell corresponding to the first data line and to not charge the first data line when the first data line is not selected for accessing the memory cell. The data driver, based on a first control signal, is configured to transfer a signal on the first data line to an output of the data driver.
An SRAM includes a first SRAM column having first SRAM cells and a first local evaluation logic coupled to a global bit line and a second SRAM column having second SRAM cells and a second local evaluation logic coupled to the same global bit line. The first SRAM column is selected with a first write line and the second SRAM column is selected with a second write line.
A block storage system includes a host and comprises a block storage module that is coupled to the host. The block storage module includes a MRAM array and a bridge controller buffer coupled to communicate with the MRAM array. The MRAM array includes a buffer widow that is moveable within the MRAM array to allow contents of the MRAM array to be read by the host through the bridge controller buffer even when the capacity of the bridge controller buffer is less than the size of the data being read from the MRAM array.
A transmission medium and protocol is provided for bi-directional communication between an audio system and a peripheral device. The transmission medium includes a communication medium for communicating data and a communication medium for communicating a clock signal that corresponds to a transmission rate of bits on the other communication media. By transmitting the clock signal on a separate communication medium from the data, clock recovery is avoided. There may be multiple clock domains. By having multiple clock domains, multiple sample rates can be supported. Synchronization information is embedded in the signal by using run length limiting markers between the data for each channel and a synchronization word having more consecutive zero bits than the number of bits for each channel. One or more channels may be dedicated to providing control and status information.
A control circuit for a hard disk drive (HDD) includes a control chip, a connector connected between the control chip and a motherboard, and a function transform circuit connected between the control chip and the connector. A status pin of the control chip is connected to a status receiving pin of the connector through the function transform circuit, to send a working state signal of the hard disk drive to the status receiving pin of the connector. The status receiving pin shows a normal operation of the HDD through a light emitting diode connected to the status receiving pin. The function transform circuit provides a high level signal to a staggered spin-up pin of the control chip, to make the control chip control the hard disk drive to execute staggered spin-up function.
In one general embodiment, an apparatus includes a write pole, a near field transducer, a waveguide for delivering light to the near field transducer, and a first heating device positioned between the write pole and at least one of the waveguide and the near field transducer.
A space for accommodating therein a portion of an optical pickup mechanism is arranged below a disk loading portion of a turn table member of a chucking mechanism of the present invention. The space is arranged axially below a disk mounting surface. Since such space is provided, a recording/reproducing portion will be allowed to move closer to a brushless motor, and therefore a second lens arranged further away from the brushless motor will be allowed to move radially inward of a recording/reproducing area of an optical disk.
Servo data of one or more tracks of a disk are collected using first and second read transducers co-located on a slider. Redundant portions of the servo data collected by the first and second read transducers are compared, and at least part of the servo data validating or corrected based on comparing the redundant portions.
According to one embodiment, a magnetic recording head includes a medium-facing surface, a near-field transducer partially exposed in the medium-facing surface, and a magnetic pole including a distal end surface and a pole end surface facing the near-field transducer. The pole end surface in the medium-facing surface is asymmetric with respect to a central axis passing through a center of the near-field transducer and extending in a longitudinal direction of the medium-facing surface.
According to one embodiment, a magnetic head includes a spin torque oscillator formed between a main magnetic pole and auxiliary magnetic pole. The spin torque oscillator includes a transmission-type spin transfer layer, first interlayer, oscillation layer, second interlayer, and reflection-type spin transfer layer. The transmission-type spin transfer layer includes a first perpendicular magnetization film and first interface magnetic layer. The first interface magnetic layer contains at least one element selected from Fe, Co, and Ni, and at least one element selected from Cr, V, Mn, Ti, and Sc. The reflection-type spin transfer layer includes a second perpendicular magnetization film.
A magnetic recording head includes a magnetic pole that applies a recording magnetic field to a recording medium, a light generating element configured to generate light to heat a recording surface of the recording medium, and a waveguide on a leading side of the light generating element to guide an incident light to the light generating element. The waveguide includes a first waveguide having an incident surface into which the light enters, and a second waveguide having a first surface facing the first waveguide, through which the light from the first waveguide enters, and a second surface facing the light generating element and extending substantially perpendicular to the recording surface of the recording medium, through which the light entering the light generating element passes. A refractive index of the second waveguide is different from a refractive index of the first waveguide.
A method of controlling power in an optical disc apparatus is provided. A method of controlling power in an optical disc apparatus includes: measuring a temperature of an inside of the optical disc apparatus; calculating, based on the measured temperature, a driving value with which a laser diode (LD) outputs target power; and driving the LD with the calculated driving value. The driving value uses a function in which a temperature acts as a variable and may be calculated for a read channel and a write channel in a divided manner. In the read channel, a driving value of read power in a read mode and a driving value of read power in a record mode may be calculated using different functions, and in the write channel, a driving value of at least one segment of record power divided into two or more segments may be calculated using different functions.
As for a quadruple light receiving unit, in a case where divided regions of A to D as in a DPD scheme is defined, when binarization signals of light reception signals in regions A to D are set as signals A to D, <1> exclusive OR between the signal A without delay and the signal B with delay, <2> exclusive OR between the signal A with delay and the signal C without delay, <3> exclusive OR between the signal B without delay and the signal D with delay, and exclusive OR between the signal B with delay and the signal D without delay are calculated, and a tracking error signal is obtained on the basis of the calculation of (<1>+<3>)−(<2>+<4>). Thus, the above problem can be solved.
Systems and methods are provided for scoring speech. A speech sample is received, where the speech sample is associated with a script. The speech sample is aligned with the script. An event recognition metric of the speech sample is extracted, and locations of prosodic events are detected in the speech sample based on the event recognition metric. The locations of the detected prosodic events are compared with locations of model prosodic events, where the locations of model prosodic events identify expected locations of prosodic events of a fluent, native speaker speaking the script. A prosodic event metric is calculated based on the comparison, and the speech sample is scored using a scoring model based upon the prosodic event metric.
Acoustic energy is received at a lighting apparatus to create acoustic data, and speech recognition is performed on the acoustic data to determine one or more words. A message based on the acoustic data is sent across a network from the lighting apparatus.
Surround audio decoding for selectively generating an audio signal from a multi-channel signal. In the surround audio decoding, a down-mixed signal, e.g., as down-mixed by an encoding terminal, is selectively up-mixed to a stereo signal or a multi-channel signal, by generating spatial information for generating the stereo signal, using spatial information for up-mixing the down-mixed signal to the multi-channel signal.
A sound insulator of the invention includes a sound absorption layer and an air-impermeable resonance layer, which are bonded to each other via an adhesive layer. The sound absorption layer has a thickness in a range of 5 to 50 mm, an area-weight of not greater than 2000 g/m2 and a two-layer structure of a high-density sound absorption layer and a low-density sound absorption layer. The high-density sound absorption layer is bonded to the air-impermeable resonance layer via the adhesive layer and has a density in a range of 0.05 to 0.20 g/cm3 and a thickness in a range of 2 to 30 mm. The low-density sound absorption layer is bonded to the other face of the high-density sound absorption layer via an adhesive layer and has a density in a range of 0.01 to 0.10 g/cm3 and a thickness in a range of 2 to 30 mm.
A sampling device includes: an obtainer that obtains a streaming audio waveform; a detector that detects a tap by a user; a designator that designates a sampling start point on the obtained audio waveform when at least a single tap has been detected by the detector, the designating being performed on the basis of one tap among a plurality of the taps when the plurality of taps are detected; a calculator that calculates a sampling duration on the basis of time intervals between the respective taps when the plurality of taps are detected, the calculating being performed from the sampling start point to a subsequent tap that is performed after the one tap; and a waveform sampler that samples the obtained audio waveform, the sampling starting from the designated sampling start point and ending in accordance with the calculated sampling duration.
A liquid crystal display device includes a liquid crystal panel, a gate driver, a data driver, and an initial driving control unit. The liquid crystal panel includes a plurality of liquid crystal cells. Each liquid crystal cell is defined by a gate line, a data line and a thin film transistor. The gate driver controls the thin film transistor connected to the gate line of each liquid crystal cell according to a gate control signal. The data driver outputs a pixel signal to the data line of the each liquid crystal cell according to a data control signal. The data driver includes a switch connected to the data line of the each liquid crystal cell. The initial driving control unit is structured to compare a clock count with a predetermined reference value and operable to alternately generate a first state signal and a second state signal based on the comparison. The unit applies the first state signal to the switch during a masking interval. The pixel signal is not output to the data line during the masking interval.
Methods and systems for producing an electro-optic display with a barrier layer for a seamless front surface of a user device. The electro-optic display may include a barrier layer, supported by a release film, disposed above a layer of electro-optic medium disposed above a backplane. The barrier layer may have dimensions greater than the electro-optic layer, but less than the backplane. An underfill edge seal is created under the barrier layer and release firm, and the release film is removed. A front-surface material is disposed above the barrier layer. The dimensions of the front-surface material may be greater than or equal to the dimensions of the backplane to create a seamless front surface on the user device.
The biodegradable badge has a paper name tag placed within a translucent envelope carried by a lanyard secured to the envelope by at least one clamp. The paper name tag degrades readily. The translucent envelope shows the name tag but upon disposing of the envelope, it degrades in the waste stream and at a landfill. The envelope has a material that degrades rapidly by solar, thermal, and chemical action with minimal release of toxic and volatile organic compounds. The lanyard also degrades readily in the waste stream with material such as textile blends or that of the envelope. The clamp joins the lanyard to the envelope. Designed for single use, the clamp strongly grips the lanyard and then the envelope, and then the clamp degrades when placed in the waste stream. The entire biodegradable badge poses no long-term pollution of the environment as it uses formulations, such as polyethylene terephthalate (g) and poly lactic acid, along with natural fibers such as cotton and wool.
A preexisting FMS system may be upgraded to increase its functionality while still taking advantage of certain components of the legacy system previously provided on the aircraft and replacing other preexisting components with different components for enhancing the functionality of the FMS system. The preexisting IRU, CADC, DME receiver and DFGC in the upgraded FMS system are in communication with the legacy AFMC but, instead of employing the legacy EFIS which existed in the prrexisting FMS system, the EFIS is replaced by a data concentrator unit as well as the display control panel and integrated flat panel display, and a GPS receiver. The upgraded FMS system is capable of such increased functionality as increased navigation database storage capacity, RNP, VNAV and RNAV capability utilizing a GPS based navigation solution, and RTA capability, while still enabling the legacy AFMC to exploit its aircraft performance capabilities throughout the flight.
A vehicular information-processing device and a vehicular information-processing method with which driver operation information can be smoothly linked to learning results are provided. The information-processing ECU learns pieces of operation information, which are obtained in correspondence with various vehicle operations by a driver, in association with the respective spots where the vehicle operations occurred, and, on the basis of the result of learning, provides operation information specific to each spot as driving assistance information. The information-processing ECU determines whether or not the specific operation information provided at the same spot conforms to the driver's vehicle operation at the spot, and learns the repeatability of the specific operation information provided at the spot on the basis of the number of times that it is determined that there is conformity or the number of times that it is determined there is no conformity.
The present invention provides a gaming machine which can provide games that are prevented from progressing monotonously and thus can provide a player with a feeling of tension, thereby facilitating the consumption of more gaming media. A currently played chance game is discontinued and the chance game is started afresh from the first game under the condition that a second symbol appears on a symbol display unit upon the number of games being less than a predetermined number in the chance game mode.
A wagering game system and its operations are described herein. In some embodiments, the operations can include presenting primary wagering game content, during a wagering game session, in an area of a display assigned to a primary wagering game application. The operations can further include detecting player input that indicates activation of a secondary wagering game application during the wagering game session and superimposing a portion of the secondary wagering game content over the primary wagering game content in the first area of the display in response to the player input. The operations can further include generating an outcome value for a playing turn of the secondary wagering game application in response to the player input, and presenting the outcome value for the secondary wagering game application via the portion of the secondary wagering game content.
In one aspect, a multiplayer game format is provided that permits both off-property and on-property players to participate in a multiplayer game that provides awards to a winning player. Such a game format may include rake games which maximize the income of such types of games.
A gaming machine adapted for slot machine play and poker-type games includes a housing, an interface supported by the housing, a set of primary reels and a bonus reel. The primary reels share a common axis and the bonus reel has an axis generally perpendicular to the axis of the bonus reels. This spatial relationship between the bonus reel and the primary reels defines at least one payline between the primary reels and the bonus reel.
Embodiments of the present invention are directed to a method for creating an electronic log for documenting entries into electronic gaming machines on a network. The network is monitored by a network computing device. People who enter the machines carry mobile computing devices that communicate over a normally operating wireless network. Cooperating among the network computing device and the wireless network results in creating an entry that includes the identify of a person entering one of the gaming machines, the identity of the gaming machine entered, and the reason for entry. The entry is stored in an electronic log.
A method for using an Electronic Flight Bag (EFB) located on an aircraft to communicate with a remote aircraft system data communications unit concerning aircraft systems problems and malfunctions, is disclosed. The method may include receiving aircraft systems data from one or more aircraft systems, identifying any problems or malfunctions in the aircraft systems, automatically communicating any identified problems or malfunctions in the aircraft systems to the remote aircraft system data communications unit, receiving information concerning a solution to the identified problems or malfunctions in the aircraft systems from the remote aircraft system data communications unit, and implementing the solution to the identified problems or malfunctions in the aircraft systems.
An onboard information system having an antenna for receiving satellite-based geoposition data. The onboard information system includes a housing that can be installed in a vehicle interior and a module for processing satellite-based geoposition data. The antenna for receiving satellite-based geoposition data is arranged on the housing such that in the installed state a reception direction of the antenna points toward the vehicle interior. The onboard information system can be used particularly in a vehicle as a tachograph, preferably as a digital tachograph, and/or toll collection appliance.
Methods and apparatuses for maintaining continuity of augmentations are disclosed. In one embodiment, a method for use with an augmented reality enabled device (ARD) comprises tracking a plurality of objects and a background based at least in part on visual information derived from an image, maintaining states of the plurality of objects based at least in part on information other than the visual information, and providing data for rendering augmentation in response to the states of the plurality of objects.
A system for generating a reconstruction of an object of interest comprises a shape model generator (1) for generating a shape model representing a shape of the object in dependence on a plurality of projections of the object, and a reconstructor (2) for reconstructing the object, based on the projections, in dependence on the shape model to obtain the reconstruction of the object. The reconstructor (2) comprises a soft-tissue reconstructor (4) for generating a reconstruction favoring soft tissue, based on the plurality of projections, and a sparse reconstructor (5) for generating a reconstruction of sparse objects, based on the plurality of projections. The reconstructor (2) comprises a clipping subsystem (3) for clipping an outside of the object from the reconstruction, based on the shape model, or the reconstructor (2) is arranged for reconstructing only an inside and/or boundary of the object as defined by the shape model.
A new hardware architecture defines an indexing and encoding method for accelerating incoherent ray traversal. Accelerating multiple ray traversal may be accomplished by organizing the rays for minimal movement of data, hiding latency due to external memory access, and performing adaptive binning. Rays may be binned into coarse grain and fine grain spatial bins, independent of direction.
The present invention tracks or locates small moving objects, or generates a 3-D frame of data by using 3-D focal plane arrays with low laser energy and few mechanically moving parts. The invention may be used to determine the direction of a laser designating a target, for target tracking, used as a 3-D movie/video camera or used to provide data for autonomous navigation.
A method and system for creating event data including 3-D data representing at least one participant in an event and making the event data available to be served is provided. The system includes a communications network. A plurality of camera units are coupled to the communications network. The camera units are configured and installed at an event venue to generate a plurality of images from waves which propagate from objects in the event and includes the at least one participant in a plurality of non-parallel detector planes spaced about the event venue. The camera units include a plurality of detectors for measuring energy in the images in the detector planes to produce a plurality of signals obtained from different directions with respect to the at least one participant and a plurality of signal processors to process the plurality of signals from the plurality of detectors with at least one control algorithm to obtain image data. A processor subsystem is coupled to the communications network to process the image data to obtain the event data including the 3-D data. A server, which includes a data engine, is in communication with the processor subsystem through the communications network. The server is configured to receive the event data including the 3-D data from the processor subsystem and to make the event data available to be served.
A novel and useful mechanism for generating a fly-through review for digital images such as tissue sample scans. A fly-through path based on the sample image is determined and one or more fly-through curves are generated. Two-dimensional image manipulations are applied to the sample image in accordance with the one or more fly-through curves and any user preferences to generate a sequence of frame images to be displayed.
A flow diverter is automatically detected from medical imaging data. The appearance of the flow diverter as represented in the data as well as the geometry or shape of the flow diverter is used in the detection. Using scoring for appearance relative to the centerline and cross-section of the centerline, the flow diverter is detected for increasing visualization.
A mapping data of a location associated with a traffic collision incident can be presented within an automobile incident application interface executing within a computing device. A visualization of the incident can be performed within the interface. The visualization can be a computer generated graphic re-creation of the incident having a starting location and a collision location associated with an object model. The object model can be a graphical representation of a vehicle. A user input can be received during the visualization. The user input can include manipulating the position of an object model presented upon the mapping data. The manipulation can be a translation, rotation, and/or scaling operation. The object model can be associated with visualization data which can link the object model with a heading and/or a track. The appropriate heading and track of the object model can be visually presented within the interface.
A method comprising creating and storing a graph having nodes and edges that represent financial assets and accounts in which the assets are held; individuals who own the assets; or legal entities who own the assets; receiving and storing bucketing factors and column factors; traversing the graph and creating a list of a plurality of paths of nodes and edges in the graph; applying the bucketing factors to the paths to result in associating each set among a plurality of sets of the nodes with a different value node among a plurality of value nodes; applying the column factors to the paths and the value nodes to result in associating column result values with the value nodes; creating and causing displaying a table view by forming rows based on the value nodes and forming columns based on the column result values.
The present invention provides a mobile device including: a power receiver for wirelessly coupling with a power transmitter to receive power wirelessly from the power transmitter; and a function that automatically initiates upon the power receiver wirelessly coupling with the power transmitter. Also provided is a transmitter apparatus including a power transmitter for wirelessly coupling with a power receiver in a mobile device to provide power wirelessly to the power receiver, wherein, upon the power receiver wirelessly coupling with the power transmitter, data is transferred between the power transmitter and the power receiver and a function of the mobile device automatically initiates. The mobile device and transmitter apparatus together form a system for operating the mobile device. Methods and computer-readable media storing executable application programs associated with the system arc also provided.
Methods and systems for managing for migrating feedback data from one digital asset to another digital asset are disclosed. Typically, the one digital asset is available for distribution from a network-based media distribution system, but then subsequently is removed from distribution for any of a number of reasons. However, since the one digital asset has been in use at the network-based media distribution system, it has accumulated feedback data. Hence, if the another digital asset serves (e.g., due to equivalency) to replace the one digital asset, then the accumulated feedback data from the one digital asset can be transferred to the another digital asset. As a result, the another digital asset can benefit from the feedback data that was previously associated with the one digital assert.
Methods and systems for dynamically incorporating advertising content into multimedia environments, such as games, are provided. Example embodiments include a dynamic inserter, which selects content, based upon a set of criteria, to deliver to a receiving client system, such as a game client. The receiving client system typically dynamically determines locations within the game where advertisements are desirably inserted. Associated with these locations are ad tags that specify criteria for the ads including, for example ad type, ad genre, and scheduling information, which are sent by the client system to the dynamic inserter to select appropriate ads. The dynamic inserter selects ads based upon the criteria and sends them to the client system, which selects them for ad tags with conforming criteria. The client system then renders the selected ad in the appropriate location.
A compartment storage container for use in a collective objects management system with remote location of compartments containing sought objects. Each compartment has an address decoder with a unique address electrically connected to an electrical input connector which supplies compartment search signals to the container. Each compartment has an LED indicator which is activated when a compartment search signal specifies a compartment address which matches the address of an address decoder in the container. Each container has an electrical output connector which can be connected to the electrical input connector of another container so that several containers can be connected to one another. Each container can be removably installed in a cabinet drawer and electrically connected to conductive support rails in the drawer to communicate with a cabinet based collective objects management system.
In general, in one aspect, a method for developing an asset by competition includes installing and configuring a master software environment for development or testing, and saving a copy of the master software environment as a virtual image suitable for use with a virtual machine. The method also includes receiving indicia of interest in a competition from a competitor, allocating a virtual server to the competitor and configuring the allocated virtual server with a copy of the virtual image, and providing access information for the virtual server to the competitor, thereby facilitating use of the virtual server by the competitor during the competition.
The disclosure is related to systems and methods of smart packaging. In one example, a package can include an embedded data storage element that is readable at a point-of-sale terminal and includes custom data stored on the data storage element. The custom data may be associated with a specific product related to the package, such as a SIM card or phone. The custom data can include information to allow a process related to the product to be performed. The process may include allowing activation of the product only when an indicator at a server indicates the package was processed at an authorized terminal.
Method, computer program product, and system to perform an operation for a deep question answering system. The operation begins by computing a concept score for a first concept in a first case received by the deep question answering system, the concept score being based on a machine learning concept model for the first concept. The operation then excludes the first concept from consideration when analyzing a candidate answer and an item of supporting evidence to generate a response to the first case upon determining that the concept score does not exceed a predefined concept minimum weight threshold. The operation then increases a weight applied to the first concept when analyzing the candidate answer and the item of supporting evidence to generate the response to the first case when the concept score exceeds a predefined maximum weight threshold.
A computer-implemented sequence analysis process is provided for determining frequency in an n-gram hash sequence of a symbolic string, such as a series of characters. The method includes initializing a hash table, creating a matrix, reading the present value in the sequence, determining whether the present value is unknown, inserting a value index into the hash table if unknown and identifying the value index otherwise, and incrementing a cell within the array. The hash table has a plurality of levels from one to n. The matrix includes first and second indices corresponding to an array of cells. The first index corresponds to an end of a prior value, while the second index corresponds to a start of a present value. The cell corresponds to the first index for the prior value and the second index for the present value.
According to one embodiment, categorizing concept types of a conceptual graph includes receiving the conceptual graph comprising one or more concept types, one or more relationship types, and one or more arcs. Each concept type is categorized according to the relationship types and the arcs. The categorization of the each concept type is recorded.
In response to N-up instructions methods and systems analyze the sizes of printable items within full-size pages to be printed, and determine the minimum size to which each of the full-size pages can be reduced to keep all the printable items above a minimum print item or font size. Because different pages of the print/copy job can have differently sized printable items, at least two of the full-size pages can have a different minimum size to which they can be reduced. Such methods and systems automatically reduce the sizes of the full-size pages (as limited by each potentially different minimum size of each different full-size page) to produce reduced-size pages that will be combined on output pages. Again, because each different full-size page can have a different minimum size, at least two of the full-size pages can be reduced by different reduction amounts during the reduction process.
An image formation apparatus includes: media containers each of which can contain therein media, an image formation unit to form an image on one or more media based on image data; a media feed unit to feed the media from one of the media containers to the image formation unit; a computation unit configured to calculate a remaining time to complete the image-forming on the media of an instructed quantity, based on a feed time per medium and a print time per medium; and an image formation condition change detector configured to detect a change of image formation conditions. When the change of the image formation conditions is detected, the computation unit calculates the remaining time, based on the feed time per medium and the print time per medium after the change of the image formation conditions.
Methods, systems, and apparatus, including computer programs encoded on a computer storage medium, for identifying similar images. In some implementations, a method is provided that includes receiving a collection of images and data associated with each image in the collection of images; generating a sparse feature representation for each image in the collection of images; and training an image similarity function using image triplets sampled from the collection of images and corresponding sparse feature representations.
A feature extraction method for extracting a feature from an image includes receiving an image and measured acceleration data from a mobile device; obtaining a gravity vector in the image in a camera coordinate system based on the measured acceleration data; obtaining a vanishing point in the image in a vertical direction in a screen coordinate system using the gravity vector; obtaining differential vectors along two axes for each pixel in the screen coordinate system; obtaining a connection line vector connecting each of the pixels with the vanishing point; identifying a vertical edge based on determining that an angle formed by the differential vector and the connection line vector is within a certain threshold range; obtaining the sum of strengths of vertical edges and writing the sum in a predetermined variable array; extracting a keypoint based on the variable array; and calculating a feature quantity from the keypoint.
Systems, methods, and computer program products may be directed to creating an image hash. Key points can be identified at different locations within a sample image. Descriptor vectors for the key points can be identified, the descriptor vectors describing local image information around the key points, where each descriptor vector is an n-dimensional array. Key points can be generated based on hashes of data vectors that include at least one of the descriptors, where each feature is a 36×20 hash value.
A vision based pedestrian and cyclist detection method includes receiving an input image, calculating a pixel value difference between each pixel and the neighbor pixels thereof, quantifying the pixel value difference as a weight of pixel, proceeding statistics for the pixel value differences and the weights, determining intersections of the statistics as a feature of the input image, classifying the feature into human feature and non-human feature, confirming the human feature belonging to cyclist according to the spatial relationship between the human feature and the detected two-wheeled vehicle, and retaining one detection result for each cyclist by suppressing other weaker spatial relationships between the human feature and the detected two-wheeled vehicle.
Systems and methods described herein are directed to estimating the sharpness of images or photos such as document pages or scenes. The systems and methods are based on calculating a difference in grayscale values between pixels at an edge of an image. The differences may be accomplished by taking a slope of grayscale values between two pixels at an edge window, and estimating the edge sharpness based on the slope, multiple slopes, or differences in the slopes.
Embodiments provide techniques for enhancing an existing image after image acquisition. These techniques include sub-sampling the original image, identifying and/or deriving local region brightness, and using the local region brightness to enhance the contrast of pixels within these regions in the original image. Sub-sampling is generally used to reduce the number of pixels and corresponding computational load. Local region brightness is localized brightness in an image determined based on the dark and light regions within the image by, for example, using a 2-D Gaussian filter. The use of the local region brightness to enhance the image may be accomplished using a lookup table that may be configured to implement a variety of techniques, for example, contrast overlay, Alpha blending, and the like, for contrast enhancement in the dark and light regions.
Systems and methods for quantizing a local descriptor in video fingerprinting applications are provided. In one or more embodiments, local features of a video are extracted and characterized by a set of feature dimensions. The feature dimensions are then quantized to yield a quantized local descriptor for the video. To introduce a degree of pseudorandom variation in the quantization grids, a cascaded random quantization technique is employed to quantize the dimensions, wherein a quantized value for a given dimension is used to quantize a next dimension in sequence.
According to one embodiment of the present invention, a method for counting objects involves using an image sensor and a depth sensor, and comprises the steps of: acquiring an image from the image sensor and acquiring a depth map from the depth sensor, the depth map indicating depth information on the subject in the image; acquiring boundary information on objects in the image; applying the boundary information to the depth map to generate a corrected depth map; identifying the depth pattern of the objects from the corrected depth map; and counting the identified objects.
A apparatus, method, and system for reading an optical code using a multiple path image scanner. The image scanner captures a plurality of images using multiple optical image paths and a path directing device that directs the images to an image capture device. One or more of the captured images is then used to decode the optical code.
A variety of methods, systems, devices and arrangements are implemented for use with motion capture. One such method is implemented for identifying salient points from three-dimensional image data. The method involves the execution of instructions on a computer system to generate a three-dimensional surface mesh from the three-dimensional image data. Lengths of possible paths from a plurality of points on the three-dimensional surface mesh to a common reference point are categorized. The categorized lengths of possible paths are used to identify a subset of the plurality of points as salient points.
There is provided an information processing apparatus. An obtaining unit obtains positioning information from information associated with an image file. The positioning information includes positioning method information that indicates a positioning method and position information that indicates a position determined by the positioning method. A changing unit changes the position indicated by the position information. A determining unit determines whether or not an amount of change made by the changing unit is greater than or equal to a predetermined threshold. An updating unit updates the positioning method information associated with the image file, when it was determined that the amount of change is greater than or equal to the predetermined threshold.
Various systems, computer-readable media, and computer-implemented methods of providing improved data privacy, anonymity and security by enabling subjects to which data pertains to remain “dynamically anonymous,” i.e., anonymous for as long as is desired—and to the extent that is desired—are disclosed herein. Embodiments include systems that create, access, use, store and/or erase data with increased privacy, anonymity and security, thereby facilitating the availability of more qualified and accurate information. When data is authorized by subjects to be shared with third parties, embodiments may facilitate sharing information in a dynamically controlled manner that enables delivery of temporally-, geographically-, and/or purpose-limited information to the receiving party. In one example, anonymity measurement scores may be calculated for the shared data elements so that a level of consent/involvement required by the Data Subject before sharing the relevant data elements to third parties may be specified.
Various systems, computer-readable media, and computer-implemented methods of providing improved data privacy, anonymity and security by enabling subjects to which data pertains to remain “dynamically anonymous,” i.e., anonymous for as long as is desired—and to the extent that is desired—are disclosed herein. Embodiments include systems that create, access, use, store and/or erase data with increased privacy, anonymity and security, thereby facilitating the availability of more qualified and accurate information. When data is authorized by subjects to be shared with third parties, embodiments may facilitate sharing information in a dynamically controlled manner that enables delivery of temporally-, geographically-, and/or purpose-limited information to the receiving party. In one example, anonymity measurement scores may be calculated for the shared data elements so that a level of consent/involvement required by the Data Subject before sharing the relevant data elements to third parties may be specified.
A method includes receiving a first request from a first user device to access a first resource that includes data for a second user account for which access to the data is restricted to authorized users, the first request including an authorization token and associated with a first user identifier that identifies a first user; determining that the first user identifier does not identify an authorized user and in response: determining that the first user identifier identifies an authorized user based on the authorization token, and provide the first resource to the first user device; receiving a second request for access to data to the second user account, the second request associated with the first user identifier; and based on the first user identifier being determined to identify authorized user, providing access to the data to the second user account in response to the second request.
An improved key encryption system is provided for encrypting sensitive data on a shared data store. Various embodiments contemplate a system where a plurality of data clients are connected to one or more shared data stores. A secure data storage facility is provided on one or more of the shared data stores by using an encryption scheme. Encryption keys for decrypting the sensitive data are stored on the same data store as sensitive data which may be decrypted using the encryption keys in question. To provide another layer of protection, the data encryption keys are themselves encrypted using a key encryption key (KEK), which is generated by, and stored in a local persistent data store associated with the data clients.
A storage system that includes a management communication interface coupled to a storage management layer and further includes a data communication interface. Upon receiving a request for accessing the storage management layer, from the host, via the data communication interface, the management layer sends to the host, access information necessary for allowing access of the host to the storage management layer via the management communication interface; and upon receiving a management command, from the host via the management communication interface, the host is provided with access to the storage management layer, in cases where the management command conforms to the access information.
According to one embodiment, an electronic circuit is described comprising a processing circuit configured to perform a data processing including a plurality of successive operations, wherein in at least some of the plurality of operations, a predetermined input value is processed; a check value memory; a controller configured to check, for each operation of the data processing performed by the processing circuit, whether the predetermined input value is processed in the operation, and, if the predetermined input value is processed in the operation, combine the predetermined input value to the content of the check value memory and a detector configured to check, when the processing is complete, whether the content of the check value memory is equal to a predetermined value.
A method and system for controlling access of a user to a secondary system. A primary system sends a random string to a user system that is connected to the secondary system. The user is logged on the user system. The primary system receives from the user system first authentication information including an encryption of the random string by a private key of the user. The primary system generates a user-specific key consisting of the encryption of the random string.
A semiconductor device has: a first signal line formed in a first wiring layer formed on a semiconductor substrate, and disposed in a first direction; first and second shield lines formed in the first wiring layer, disposed on both sides of the first signal line in the first direction, and given a first fixed potential; and a plurality of third shield lines formed in a second wiring layer formed on the semiconductor substrate, disposed with a first wiring width and at a first wiring interval in a second direction almost orthogonal to the first direction in a manner to partially overlap with each of the first signal line and the first and second shield lines, and given the first fixed potential.
A method includes comparing one or more cells to a selection guideline and storing the cells that meet the selection guideline in a non-transient computer readable storage medium to create the cell library based on the comparing. The selection guideline identifies a suitable position of a boundary pin within a cell.
According to a method herein, a portion of an electronic circuit is identified. The electronic circuit comprises logic circuitry. The portion of the electronic circuit is designed in at least two versions. Each of the at least two versions is evaluated using a plurality of operating conditions. The current operating conditions are determined. One version of the at least two versions is identified as a selected version based on the performance under the current operating conditions. The selected version has relatively optimal performance based on at least one of clock frequency, supply voltage, and power limit. The selected version is activated for use in the portion of the electronic circuit. The remaining versions of the at least two versions are deactivated.
Aspects of the invention relate to techniques for predicting circuit performance variations due to device mismatch. Circuit simulation is performed to generate circuit simulation results based on a circuit description and information of circuit element parameters. Based on the simulation results, sensitivity information for the circuit design and current/charge deviations caused by individual circuit element parameter variations may be computed. Based on the sensitivity information and the current/charge deviations, steady-state mismatch effect information is determined. The determination may comprise first computing output parameter deviations caused by the individual variations of the circuit element parameters and then computing a total output parameter deviation based on the output parameter deviations.
One or more test results and one or more user stories are received. For each test result in the one or more test results a set of content space coordinates of the one or more test results is compared to a set of content space coordinates of the one or more user stories. Based on the comparison it is determined if one or more user stories have been tested. One or more results of the comparison are then stored.
A method for conducting a Testing In Pairs (TIPs) blood glucose (bG) test using a handheld diabetes management device carried by a user. A processing subsystem of the device implements a software module for managing the TIPs test. The software module generates a plurality of predetermined acceptance time windows corresponding to different user defined events. The processing subsystem can identify specific ones of a plurality of bG test values read by the device that are obtained during the predetermined bG acceptance time windows, and which are identified as being related pairs of accepted bG test values that correspond to specific ones of the user defined events. The related pairs of accepted bG test values can then be stored in a database.
In an information processing apparatus for storing, based on a notification sent from a monitor unit used for monitoring a state of print processing of a printing apparatus, the status item presenting the state in a storage region, or deleting the status item stored in the storage region, and for displaying the status item stored in the storage region in a storage order, a monitor unit acquires a plurality of the status items stored in the storage region, compares priority of the acquired plurality of status items and priority of a new status item stored in the storage region, and notifies a control unit to store the status items in the storage region in an order based on priority obtained as a result of the comparison.
Data records contain corresponding values of an attribute and are associated with location information. Hierarchical levels of transparency images are generated, where each of the transparency images includes corresponding pixels that represent the respective data records, and where the transparency images at different ones of the hierarchical levels correspond to different zoom levels of a geographic map. At least one of the transparency images at a dynamically-selected one of the hierarchical levels is overlaid over the geographic map according to which of the zoom levels is selected by a user in zooming of the geographic map, where the at least one transparency image is automatically selected without user input.
A method and apparatus for managing Internet content is disclosed. An apparatus that incorporates teachings of the present disclosure may include, for example, an Internet content manager (ICM) having a computing element that monitors Internet content supplied to subscribers of an Internet Service Provider (ISP) by one or more Internet content providers according to a process established by the ISP to certify said Internet content of the one or more Internet content providers. Additional embodiments are disclosed.
To address problems related to interface differences and disunity among on-line services, such as newsgroups message boards and forums, the present inventors devised systems, methods, and software for automating the posting and retrieval of content across different on-line services as well as encouraging growth of active on-line communities. One exemplary system includes a posting module, a retrieval module, and a web server. The posting module allows users to create and initiate data postings that are sent automatically to several newsgroups, message boards, and/or other on-line information sources. The retrieval module automatically retrieves replies to the postings at each of the on-line sources and presents them through the webserver for user review and further reply, eliminating the need for users to repeatedly visit posting sites in search of reply messages. In addition to the retrieved replies, the retrieval module automatically finds and retrieves content based on stored search or fitness criteria, ultimately enabling its integration into the content of one or more websites or databases for convenient user access.
When there are no evaluation values from a user who has evaluated both contents X and Z, an indirect similarity calculation unit 32 of an arithmetic processing unit 30 of an information processing center 10a indirectly calculates the similarity between the contents X and Z using evaluation values of a content Y whose evaluation value is present from a user who has evaluated both the contents X and Y and whose evaluation value is present from a user who has evaluated both the contents Y and Z. A predicted evaluation value calculation unit 33 calculates a predicted evaluation value from a user who has not evaluated either of the contents X and Z using the similarity between the contents X and Z calculated by the indirect similarity calculation unit 32 and the evaluation values of the contents X and Z. Thus, it is possible to calculate the predicted evaluation values of the contents X and Z which are not directly calculable. Therefore, it becomes possible to further expand the range of contents whose evaluation values are predictable through collaborative filtering.
System and computer program product to perform an operation for query processing based on normalized search terms. The operation begins by, responsive to receiving a query, generating a normalized search term for a concept in the query based on a first language model, of a plurality of language models each having a predefined association with a respective concept. The operation then modifies the query to include the normalized search term, and executes the modified query against an indexed corpus of evidence including a first item of evidence. The operation then, upon determining that the first item of evidence includes the normalized search term, returns the first item of evidence as responsive to the query.
Computer program products and systems, determine solutions to a problem experienced by a data processing system user. A query is received from the user. The query includes a problem description of the problem experienced by the user with respect to the data processing system. One or more keywords are extracted from the received problem description. An index of problems and associated solutions is searched using the one or more extracted keywords. The index of problems and associated solutions is created by analyzing a document collection describing problems and associated solutions with a text analytics application. One or more documents are returned that contains words or phrases that are similar to the keywords used for searching the index of problems and associated solutions. The documents relevant for the problem and associated solutions are presented to the user.
In an embodiment, a method for synchronizing browser documents is described. The method may include losing a connection to a version control server at a client device having first and second instances of a document open in first and second browser windows of a browser. The method may also include storing a first branch corresponding to the first instance of the document in local storage associated with the first browser. The first branch may indicate whether the first instance of the document is open or abandoned and one or more first changes. The method may also include the second browser window automatically determining that the first instance of the document is abandoned. The method may also include the second browser window automatically merging the one or more first changes into the second instance of the document in response to determining that the first instance of the document is abandoned.
Personalized tag ranking of images, including identifying within a reference image collection any images that are similar to an input image, identifying within a source image collection any images that have associated tags that are similar to a set of input tags associated with the input image, identifying among the images identified in the reference image collection any images that are similar to the images identified in the source image collection, and calculating a weight for each of a plurality of tag pairs, where each of the tags in each of the tag pairs is associated with a different subset of the images in the reference image collection identified as being similar to the images identified in the source image collection, and ranking the input tags of the input image in accordance with a predefined ranking function as applied to the tag pair weights.
A computing device may receive a request for a rank-specific search link corresponding to a particular search result within a list of search results. The computing device may identify one or more search parameters used by a search engine to generate the list of search results, and identify a search result rank position of the particular search result in the list of search results. The computing device may create a rank-specific search link associated with the one or more search parameters corresponding to the list of search results and the search result rank position corresponding to the particular search result. The computing device may provide the rank-specific search link in accordance with the request. Selection of the rank-specific search link may cause information, to be presented, relating to a document to the search parameters and corresponding to the search result rank position.
Methods and apparatus are presented for extracting, transforming, and loading data from one database to another database. For example, an extraction, transformation, and loading (ETL) component may access an operational log of a given database in order to detect an update to the database. Upon detecting the update, the ETL component may extract a subset of data from the operational log, where the extraction of the subset of data is based on one or more rules. Once the subset of data has been extracted, the ETL component may transform the extracted subset of data from the operational log into a format for another, target database, where the data format for the other, target database is different from a data format for the given, source database. The ETL component may then load the subset of data transformed into the data format for the other, target database into the target database.
The present invention discloses a method for implementing electronic bookmarks and a device thereof, wherein, the method for implementing electronic bookmarks includes: detecting an operation on a file; and performing a synchronous operation on the bookmark content of the file according to the operation on the file. The present invention synchronously performs processing on the bookmark content after performing an operation on the file, which can implement that the file can still be opened through the bookmark content even if the file is changed; the transformation of terminals is simple, which can be applied to various types of mobile terminals, thereby improving the usability of the mobile terminals and user experience.
The disclosed embodiments relate to a system that facilitates performing searches based on qualitative search terms. During operation, the system receives a query that applies a qualitative search term to an attribute of data items in a set of data items. While executing the query, the system processes each data item in the set of data items by extracting an attribute value from the data item and then using a concept-mapping to determine a compatibility index for the attribute value, wherein the concept-mapping associates each attribute value with a numerical compatibility index that indicates a compatibility between the attribute value and the qualitative search term. Finally, the system uses the compatibility index as a factor in determining whether to include the data item in a set of query results.
The present disclosure includes a system, method, and article of manufacture for generating an entity graph. The method may comprise determining a relationship between a first entity and a second entity based upon internal data, external data, and/or online data associated with the first entity, and generating the entity graph comprising at least two nodes and an edge connecting the at least two nodes. The method may further comprise, in various embodiments, tailoring marketing to the first entity based upon the entity graph, detecting fraud against the first entity based upon the entity graph, periodically updating the entity graph based upon new internal data and new online data, and/or adjusting the edge based upon a change in the relationship between the first entity and the second entity.
A data object submitted for storage is analyzed, and a set of values is extracted from the data object that can correspond to a set of attributes. The analysis of the data object can also identify possible new ontology terms. One or more extracted values are presented to the entity which submitted the data object for approval and feedback. This feedback can be used to characterize the data object with appropriate terms, train the extraction process for future extractions, and/or expand the set of known ontology terms.
A method, system, and computer program product for processing a stream of tuples are disclosed. The method, system, and computer program product may include receiving a stream of tuples to be processed by a plurality of processing elements. Each tuple may have an associated processing history. The stream of tuples may be segmented into a plurality of partitions, each representing a subset of the stream of tuples. The method, system, and computer program product may include estimating the contribution each partition will have on a particular processing result and processing a partition if it substantially contributes to the particular processing result.
A system for automated conversion and delivery of medical images, comprising: a communication interface; a data storage system configured to store medical image files, a list of modalities, a list of meta data fields associated with each of the modalities, and expected content for at least some of the meta data fields associated with each of the modalities; a server coupled with the data storage system and the communication interface, the server configured to: receive a medical image file via the communications interface, the medical image file comprising medical data and meta data, determine what fields are present in the meta data, correlate the determined fields with a modality in order to determine a modality associated with the medical image file, determine whether the data recorded in the fields has been altered, identify a recipient associated with the medical image file based on the meta data, and transmit a message to the recipient via the communication interface.
Methods and apparatus are presented for a morphing search tool that provides a single user interface through which a user may both modify a displayed image and perform an image similarity query based on the modified image. The morphing search tool may allow a user to repeat this process until a desired image is found and displayed. Further, the image repository to be searched may be specified by a user and the images to be modified and searched for may be any type of image. The morphing search tool may be integrated within a merchant website, an image management system, or as a stand alone application.
An in-vehicle electronic control device for diagnosing the details of an abnormality of a microcomputer appropriately is provided. A monitoring function for detecting a malfunction by monitoring input/output of a main function of a hardware part and a monitoring function for detecting an abnormality by monitoring the calculating result of a main function in a software part are provided in a microcomputer. The main function to be monitored is implemented with a different structure than the malfunction/abnormality monitoring function. Furthermore, a malfunction processing circuit for monitoring an abnormality of the microcomputer is provided outside the microcomputer.
The present disclosure relates to program flow control monitoring routines. In one embodiment, a process control apparatus is provided with a plurality of modules associated with control and/or monitoring of a given plant. Program flow control monitoring routines are provided to monitor the various modules.
Disclosed is a system and methods for data compression and decompression. The systems and methods discussed herein include an encoder, dictionary, decoder, literal string and control output. The discussed systems and methods encode data transmitted over a communications channel through the use of a dynamically compiled dictionary. Upon reviewing the characters within the transmitted data in view of the dictionary, an encoded/compressed output string is created. Such output string may also be decoded in a similar fashion via a dynamically compiled dictionary.
A computer-implemented method for duplicating backup images may include (1) identifying at least one storage device, (2) identifying a plurality of backup images to be duplicated to the storage device, (3) creating a composite image of the plurality of backup images, and then (4) storing the composite image on the storage device instead of duplicating the plurality of backup images to the storage device. Various other methods, systems, and computer-readable media are also disclosed.
Users can model changes to entities in large scale sets of data for various portfolio holdings in different respective sandbox caches. A method includes loading sets of data in a database and organizing the loaded data in entity caches according to an entity model, each entity cache corresponding to one or more entities associated with respective portfolio holdings. Further steps include creating an initial report of information drawn from the loaded data for manipulation by a user through a user-interface, storing information in the initial report in a respective sandbox cache having data organized according to the entity model, and enabling the user to manipulate the respective sandbox cache to change values in the data organized according to the entity model in the respective sandbox cache without changing values of data in other sandbox caches or in the database.
Hierarchical levels of data sets are defined. An object is provided, and the object includes a user-defined delimiter used to indicate a desired level of hierarchy for data sets. A set of rules associated with the object is used to present data sets. The object and the set of rules are employed to determine one or more data sets to be presented to a user. The presenting is based on the object and the set of rules, and the presenting presents the one or more data sets in a hierarchy defined by at least the object.
Embodiments of the present invention relate to systems, computer-implemented methods, and computer program products for managing a tiered archive. In some embodiments, a method is provided that includes: (a) providing an archive having two or more tiers for storing data, where each of the two or more tiers is assigned an image quality value, and wherein the image quality value assigned to each of the two or more tiers of the archive is different; (b) managing the archive based on a schedule for managing the data or on one or more rules, wherein managing the archive comprises: (1) storing data in a first of the two or more tiers based on the image quality value assigned to the first tier; and (2) storing data in a second of the two or more tiers based on the schedule and the image quality value assigned to the second tier.
Improved graphical user interfaces suitable for reviewing, browsing, previewing and/or purchasing media items are disclosed. The graphical user interfaces are particularly useful for a system that provides purchase and distribution of media in a client-server environment.
A method and apparatus for enabling a searchable history of real-world user experiences is described. The method may include capturing media data by a mobile computing device. The method may also include transmitting the captured media data to a server computer system, the server computer system to perform one or more recognition processes on the captured media data and add the captured media data to a history of real-world experiences of a user of the mobile computing device when the one or more recognition processes find a match. The method may also include transmitting a query of the user to the server computer system to initiate a search of the history or real-world experiences, and receiving results relevant to the query that include data indicative of the media data in the history of real-world experiences.
A database management system (DBMS) client calls an interface of a DBMS server to execute a statement that has been prepared to be executed in batch form in relation to a database managed by the DBMS server. The DBMS client provides a different batch of data to the DBMS server each time the DBMS client calls the interface. The DBMS server processes the different batch of data in accordance with the statement that has been prepared, to effectuate execution of the statement at the DBMS server on a batch basis in relation to the different batch of data. The DBMS server returns results of processing the different batch of data to the DBMS client, such that the DBMS client receives intermediate feedback as to status of processing the statement prior to the statement being completely processed.
A memory controller is provided. The memory controller may comprise a first interface configured to provide an interface for communications with a host, and a second interface configured to communicate with the host through the first interface and to provide an interface for communications with a memory. The second interface may include an emulation engine configured to generate a Direct Memory Access (DMA) setup Frame Information Structure (FIS) including ready state information for data communications with the host in response to a command transferred from the host. The second interface may include a storage engine configured to access the host to fetch a physical region descriptor (PRD) before the DMA setup FIS is received from the emulation engine.
Disclosed herein are systems and methods for navigating electronic texts. According to an aspect, a method may include determining text subgroups within an electronic text. The method may also include selecting a text seed within one of the text subgroups. Further, the method may include determining a similarity relationship between the text seed and one or more adjacent text subgroups that do not include the selected text seed. The method may also include associating the text seed with the one or more adjacent text subgroups based on the similarity relationship to create a text cluster.
A Test Access Mechanism (TAM) architecture for facilitating testing of IP blocks integrated on a System on a Chip (SoC). The TAM architecture includes a Test Controller and one or more Test Wrappers that are integrated on the SoC proximate to IP blocks. Test data and commands corresponding to input from an external tester are packaged by the Test Controller and sent to the Test Wrappers via an interconnect fabric. The Test Wrappers employ one or more test ports to provide test data, control, and/or stimulus signals to the IP block to facilitate circuit-level testing of the IP block. Test results for the circuit-level tests are returned to the Test Controller via the fabric. Test Wrappers may be configured to pass through interconnect signals, enabling functional testing of IP blocks to be facilitated via test packages and test results transmitted between the Test Controller and the IP blocks via the fabric.
A user provides an annotation, such as text or graphics, in relation to a resource available on a computer network. The annotation is automatically stored and/or retrieved without requiring separate action from the user to accomplish the storage or retrieval. An annotation interface may receive the annotation from the user. The annotation is then stored in association with the user and the network address of the resource. The user's annotation may be later retrieved and displayed to the user based on the network address of the resource. In one specific embodiment, a browser toolbar receives and displays user annotations associated with Web sites or Web pages to which the user has navigated. Preferably, the annotation interface remains available to the user throughout the time in which the resource is provided. Further controls may enable the user to make an annotation publicly available to others, and to receive annotations from others.
A test method which tests a processing device includes: obtaining a maximum number of processing units with which the processing device as a test target can simultaneously parallel process a plurality of threads; specifying a number of threads, causing the processing device as the test target to parallel process the threads, and obtaining a processing time corresponding to the number of threads; and outputting information indicating that the processing device as the test target is normal when the number of threads for which the processing time is more than or equal to a threshold matches the maximum number of processing units which can simultaneously parallel process, or outputting information indicating that the processing device as the test target is abnormal when the number of threads does not match.
Memory circuitry, a data processing apparatus and a method of storing data are disclosed. The memory circuitry comprises: a memory for storing the data; and control circuitry for controlling power consumption of the memory by controlling a rate of access to the memory such that an average access delay between adjacent accesses is maintained at or above a predetermined value; wherein the control circuitry is configured to determine a priority of an access request to the memory and to maintain the average access delay at or above the predetermined value by delaying at least some accesses from access requests having a lower priority for longer than at least some accesses from access requests having a higher priority.
Maintaining a change map of a block storage device includes intercepting a change message from an application. The change message is intercepted by a change tracking engine. The change message requests a change to a logical block of the block storage device. The change is recorded in a first copy of the change map. The change is recorded the change in a second copy of the change map.
An addition/subtraction hardware operator includes a plurality of addition/subtraction hardware modules and a plurality of transmission links between these modules, on one hand, and between inputs and outputs of the operator and these modules, on the other hand, according to a pre-determined structure for performing arithmetical calculations. At least a part of the addition/subtraction hardware modules and at least a part of the links between these modules can be configured by at least one programmable parameter, at least between a first configuration in which the operator finalizes a computation of real parts of fast Fourier transform coefficients, a second configuration in which the operator finalizes a computation of imaginary parts of fast Fourier transform coefficients, and a third configuration in which the operator carries out a computation of path metrics and survivors values of a Viterbi algorithm implementation.
A storage system that includes multiple nodes, each node comprises a SSD cache and a management module and hard disk drives that are coupled to the nodes. The management module of each node is arranged to manage a SSD cache map that comprises multiple entries for storing mappings from logical addresses to SSD cache physical addresses and to physical addresses in the hard disk drives. The mappings are related to data units stored in the SSD cache. Upon a rejoin of a certain node following a shut-down or a failure of the certain node, the certain node is arranged to: obtain from at least one other node, current mappings between logical addresses and physical addresses in the hard disk drives, and perform a validation process of the data units stored in the SSD cache in response to relationships between the current mappings and the entries of the SSD cache map.
Cache lines in a multi-processor computing environment are configurable with a coherency mode. Cache lines in full-line coherency mode are operated or managed with full-line granularity. Cache lines in sub-line coherency mode are operated or managed as sub-cache line portions of a full cache line. Communications detected on a coherence interconnect may indicate that a cache line is associated with performance-reducing events. A high-contention cache line may be placed in sub-line coherency mode. Caches accessing the cache line are notified that the cache line is in sub-line coherency mode. The cache line may be associated with a counter in a centralized detection table that is incremented based on detecting the communications. The cache line may be a high-contention cache line when the counter satisfies a high-contention criterion, such as reaching a threshold value. The cache line may be returned to full-line coherency mode when a reset criterion is satisfied.
A repair method for an abnormal-erase memory block of a non-volatile flash memory is provided. The method includes steps of: sequentially scanning bit data in a page of a block when reading data in a NAND flash; determining whether the page is an abnormal-erase page; setting logic “0” bit data in the page to logic “1” when the page is an abnormal-erase page; and re-erasing the block.
Disclosed is a device that changes a bit in a string of bits representing a character in a sting of characters defining a reserved word associated with a record containing pieces of information in response to a request for changing a piece of information in the record, and a printer configured to exclude from printing a record associated with a reserved word that has been changed by the device.
A system and method for providing predictive software upgrades is provided. Generally, the method comprising the steps of: querying a virtual vehicle application that simulates a real vehicle to determine one or more time period when the vehicle will be in an off state for long enough for updating of software to take place without the vehicle operating status being changed; transmitting a push notification to a user portable interactive communication device providing the one or more time periods determined, to the user for selection of one or more time period; receiving a selected one or more time period for upgrading of the software; transmitting a request for confirmation of a first of the one or more time period to the user portable interactive communication device at a predefined time period prior to the first of the one or more time period; and if the user confirms the first time period, instructing the upgrading of the vehicle control module by the vehicle at the first time period.
An information processing apparatus performs installation when a number of the extension applications that are installed to extend the host application is less than or equal to a maximum number of the extension applications that can be held by the host application as described in a manifest of the host application, during installation of an extension application that extends a host application.
This disclosure relates to systems, methods, and software that involve system landscape aware inter-application communication infrastructure. This inter-application communication infrastructure may implement one metamodel to describe how an application could participate in an inter-application communication. The metamodel can describe the input parameters accepted but the application and the possible output of it. Based on the metadata, which would be exposed or otherwise available for involved applications, there is a protocol defining the communication flows between applications.
A method, computer-readable medium, and system for provisioning computing resources across multiple cloud providers and/or data centers are disclosed. A graphical user interface is used to select a plurality of computing resources and at least one cloud provider and/or at least one data center for providing the plurality of computing resources. Scripts associated with the at least one cloud provider and/or at least one data center are accessed, where each script is capable of automatically setting up a computing resource on an associated cloud provider or associated data center. The scripts are then used to automatically allocate and/or configure the computing resources on the at least one cloud provider and/or at least one data center. As such, computing resources can be automatically provisioned using a generic graphical user interface and without a user having skills or credentials specific to each cloud provider and/or data center.
A method and system for processing data for database modification, include receiving a set of data, performing a processing chain including a plurality of consecutive jobs to transform the set of data into transformed data, modifying a production database with respect to the transformed data and further include the steps of setting a target processing time for the performance of the consecutive jobs, before a launch of a first job, applying an original configuration as current configuration defining a parallelization level for each of the consecutive jobs, before a launch of at least one further job after the first job, upon an actual remaining processing time being out of a range of acceptable remaining processing times, applying an adapted configuration as new current configuration defining an adapted parallelization level for each of the jobs remaining in the processing chain, the adapted configuration differing from the current configuration.
A telematics unit is provided. The telematics unit includes a non-transitory computer-readable medium and a processor, configured to execute a telematics task manager application according to processor-executable instructions stored on the non-transitory computer-readable medium. The telematics task manager application comprises a plurality of tasks. Each task includes one or more subtasks. Each subtask including subtask-specific triggering logic for execution of one or more actions based on the triggering logic. The triggering logic is based on modular condition blocks.
A computing device has one or more processors and memory storing programs executed by the one or more processors. The computing device initializes a main application on a first thread. The main application has a first synchronous connection with a target application. After the main application performs one or more operations at the target application through the first synchronous connection, the computing device initializes an assistant process on a second thread. The assistant process has a second synchronous connection with the target application and an asynchronous connection with the main application. After receiving a request from the main application through the asynchronous connection, the assistant process performs one or more operations at the target application through the second synchronous connection.
A computer readable storage medium includes executable instructions to define a processor with guest mode control registers supporting guest mode operating behavior defined by guest context specified in the guest mode control registers. The guest mode control registers include a control bit to specify a guest access blocked register state and a shared register state. Root mode control registers support root mode operating behavior defined by root context specified in the root mode control registers. The root mode control registers include control bits to enable replicated register state access and shared register state access. The guest context and the root context support virtualization of hardware resources such that multiple operating systems supporting multiple applications are executed by the hardware resources.
A mechanism is provided for migrating a software image installed on a source data-processing entity to a target data-processing entity. The target data-processing entity is booted from a preliminary bootstrap program. The software image is mounted as a remote mass memory on the target data-processing entity. A primary bootstrap program of the software image is copied onto a local mass memory of the target data-processing entity. The target data-processing entity is re-booted from the primary bootstrap program thereby loading a streaming function, and serving each request of accessing a memory block on the target data-processing entity by the streaming function. In response to the memory block missing from the local mass storage, the streaming function downloads the memory block from the software image and stores the memory block into the local mass memory. Otherwise, the streaming function retrieves the memory block from the local mass memory otherwise.
A method for processing instructions. The instructions are processed by a processor unit while using a first table in a plurality of tables to predict a set of instructions needed by the processor unit after processing of a conditional instruction. An identification is formed that a rate of success in correctly predicting the set of instructions when using the first table is less than a threshold number. A sequence of the instructions being processed by the processor unit is searched for an instruction that matches a marker in a set of markers for identifying when to use the plurality of tables. An identification that the instruction that matches the marker is formed. A second table from the plurality of tables referenced by the marker is identified. The second table is used in place of the first table.
A mechanism is described for facilitating write tracking for following data eye movements across changing thermal conditions in memory systems according to one embodiment of the invention. A method of embodiments of the invention includes monitoring movements of a valid data eye associated with a memory device of a plurality of memory devices of a memory system at a computing system. The monitoring may include initiating write commands during one or more refresh periods associated with the valid data eye. The method may include determining drifting in the movement of the data eye, and correcting the drifting based on adjusting one or more existing phase interpolator values associated with the movements of the data eye.
The present disclosure relates to a technique for varying the frequency of operation of one or more cores in a processor device capable of operating at different frequencies and voltages. A method aspect of this technique includes executing one or more tasks on the at least one processor core, wherein the tasks are grouped into groups, monitoring usage of the at least one processor core by tasks in the groups on a per group basis, aggregating the monitored usage of the at least one processor core by individual groups across the groups to derive a load parameter indicative of the combined usage of the at least one processor core by the tasks in the groups, selecting a frequency of operation based upon the load parameter, and changing the frequency of operation of the at least one processor core to the selected frequency of operation.
In an embodiment, a mobile device includes a sensor processor system, an application processor system and a power management controller that controls power being applied to the application processor system. The sensor processor system monitors sensors connected to the mobile device. The sensor processor system detects a pre-defined gestures and an environmental condition or event based on the monitoring. The pre-defined gesture corresponds to one or more actions initiated by a user of the mobile device (e.g., the user jogs with the mobile device, places the mobile device in his/her pocket or backpack, etc.). The sensor processor system selects a power profile to be applied to the application processor system based on the detection, and instructs the power management controller to apply the selected power profile to the application processor system.
A mechanism is provided for recirculating transactions within a pipeline while reordering outputs. A set of transactions associated with a block of data is received and each transaction in the set of transactions is processed via the pipeline. For each transaction processed via the pipeline, responsive to the transaction exiting the pipeline, a determination is made as to whether the transaction needs further processing. Responsive to the transaction needing further processing, the transaction is re-circulated via the pipeline forming a recirculated transaction.
A method provides a non-optimized list of elements, with some of the elements having multiple terms. A table of sub-elements is generated from the elements list, with each sub-element having one term only and with a number of times a sub-element appears in the elements list being weighted in the sub-elements table. A weighted singleton histogram table is generated using a singleton dictionary, and a total popularity score of each singleton is computed from the sub-elements table. For each element from the elements list, an elements score is generated based on the total popularity score of each singleton within the element. An optimally sorted list of the elements list is generated based on the elements scores.
A liquid submersion cooling system that is suitable for cooling a number of electronic devices in parallel using a plurality of cases connected to a rack system. The system cools heat-generating components in server computers and other devices that use electronic, heat-generating components and are connected in parallel systems. The system includes a housing having an interior space, a dielectric cooling liquid in the interior space, a heat-generating electronic component disposed within the space and submerged in the dielectric cooling liquid. The rack system contains a manifold system to engage and allow liquid transfer for multiple cases and IO connectors to engage electrically with multiple cases/electronic devices. The rack system can be connected to a pump system for pumping the liquid into and out of the rack, to and from external heat exchangers, heat pumps, or other thermal dissipation/recovery devices.
A portable electronic device (100) for detecting type and orientation of a hand of a user is provided. The device can include a housing (101), a display (106), a control circuit (108), a first sensor (115), and a second sensor (116). The first sensor can determine a type of hand of the user supporting the portable electronic device. The second sensor can determine an orientation of the portable electronic device relative to the user. The control circuit of the portable electronic device can perform a function based on the type of hand as determined by the first sensor and the orientation of the portable electronic device as determined by the second sensor.
A device having a display and a keyboard is provided. The device includes a hinge disposed intermediate of the display and the keyboard, wherein the hinge includes a housing, a friction band, and a connector. The friction band is in compression and configured to create friction against the housing. The housing is part of the connector.
A multi-display device can interface with two or more different types of docking stations. The device can determine the type of dock and change the pin outs for a connector to interface with that dock. Once docked, the device can determine a charge status for the device and the dock to present the status to the user. Further, the dock can enter one of several modes, including a call receipt mode and an entertainment mode. The modes allow for expanded functionality for the device while docked. Two particular docks, the laptop dock and the smart dock, provide special functionality with the device.
Status information representing the status of a device which performs predetermined processing is acquired from the device. The acquired status information is stored in a memory. The status information is output in response to input of a request to output the status information of the device. When the request is input after the lapse of the first time from the time corresponding to acquisition of the status information stored in the memory, status information is newly acquired from the device in accordance with the request, and the status information already stored in the memory before the input of the request is output.
In response to a request from a client for the download installation of a device driver, device informational data that has been registered in a server and an installation set, which also has been registered in the server and includes the device driver and applications related to the device driver, are downloaded from the server to the client. On the basis of the device information data that has been downloaded from the server, the device driver and the related applications are installed in the client. After installation, post-installation processing regarding the applications related to the installed device driver is executed at the client based upon the device informational data.
In one embodiment, the present invention includes a method for receiving utilization data from thread units of one or more processor cores, determining an operating frequency for a core clock signal based on the utilization data, a target utilization value, and an operating mode of the processor, and generating the core clock signal based on the determined operating frequency. Other embodiments are described and claimed.
The embodiments herein relate to data management and, more particularly, to global deduplication and encryption of data in data management systems. The user equipments (UE) are grouped under certain deduplication groups based on certain parameters such as rate of data exchange, frequency of data exchange, social closeness, work closeness, similarity of data and interests and so on, between those UEs. Further, specific deduplication and encryption parameters such as encryption method, encryption key, signature computation method, block computation method and so on are assigned to each group. Further, deduplication and encryption of data in each group is performed using the deduplication and encryption modes and parameters assigned to each group. The deduplication and encryption of data is performed in at least one of the UEs and/or a server. Further, the parameters used for deduplication and encryption are stored in specific databases and are encrypted for better security.
Compressed data is maintained in a plurality of strides of a redundant array of independent disks, wherein a stride is configurable to store a plurality of tracks. A request is received to write one or more tracks. The one or more tracks are written to a selected stride of the plurality of strides, based on comparing the number of operations required to destage selected tracks from the selected stride to the number of operations required to defragment the compressed data in the selected stride.
Workers are configured for parallel processing of deduplicated data entities in chunks. The deduplicated data processing rate is regulated using a rate control mechanism. The rate control mechanism incorporates a debt/credit algorithm specifying which of the workers processing the deduplicated data entities must wait for each of a multiplicity of calculated required sleep times.
A method of and system for managing data sets of a storage facility is disclosed. The method and system may include copying a first data set of a first unit of storage space. A second data set in a second unit of storage space may be created from copying the first data set. The method and system may include copying the second data set of the second unit of storage space. A third data set in a third unit of storage space may be created from copying the second data set. The second data set may be verified. Verification may be performed by comparing the third data set with the first data set. It may be determined whether the third data set matches the first data set. The first and third data sets may be deleted in response to the third data set matching the first data set.
A portable electronic device having a touch screen display performs a set of operations, including displaying a plurality of key icons, each having an adjustable size hit region, and receiving a sequence of individual touch points input by a user on the touch screen display. The operations performed by the device further include processing the received individual touch points by: forming a user-input directed graph for the sequence of individual touch points received so far, determining a character corresponding to a last received individual touch point in accordance with the adjustable hit regions of the displayed key icons, displaying a sequence of characters corresponding to the sequence of individual touch points, and updating sizes of the adjustable hit regions for a plurality of the key icons in accordance with the sequence of individual touch points input by the user.
A method and apparatus for controlling screen display in a touch screen terminal. The method includes determining a zoom-in region, zooming in contents belonging to the zoom-in region at a corresponding magnification, and expressing the zoomed-in contents.
The system comprises the ability to detect certain gestures made by sliding a finger or stylus on a touch sensitive screen on a handheld device, even when a so called “screen lock” is active where the gesture is used to unlock the device and trigger the desired function associates with the gesture.
Embodiments described herein pertain to a standardized set of tools for representing and exploring the components and characteristics of complex systems. In one embodiment, the tools are deployed in a computer network environment so as to engage a social network such that its members utilize the tools to collaboratively construct and maintain a dynamically evolving learning environment in which complexity is represented and explored.
Computer software allowing enhanced control of the playout of audio/video works on a computer system. In various embodiments, the software allows key events from dedicated audio/video keys, whether part of a full sized keyboard or on a hand held remote, to control the actions of an audio/video playout program without requiring the user to direct the key event focus of the operating system to the audio/video playout program. Also, the invention distinguishes between key presses from a local, full sized keyboard and key presses from a remote keyboard so that the audio/video playout program can enlarge its screen display when a key event is received from the remote keyboard. In one embodiment, the invention constantly instructs the operating system to move the focus to the audio/video playout program. In another embodiment, if the focus is received by any of various windows in a display, software associated with the window forwards to the audio/video playout program any key events received from audio/video keys. In a third embodiment, audio/video key event data is routed to the audio/video playout program by a method that does not use the key event features of the operating system, such as by using a key board wedge server program to serve key events to audio/video client programs. In a fourth embodiment, the operating system is modified so that it has two separate focuses, one for a text keyboard and a second focus for audio/video keys.
This invention relates to a mobile communications device and a method for controlling a menu on a mobile communications device having a display with an idle mode background image. The method comprises receiving a user input from a control device, relating the user input to an area of said display, determining an application which is linked to said area such that said application is executed in response to the selection of said area, and superposing an application icon associated with said application over at least a part of said idle mode background image.
A display having data lines that can be configured between a display mode and a touch mode is disclosed. The display can have sense regions for sensing a touch or near touch on the display during the touch mode. These same regions can display graphics or data on the display during the display mode. During display mode, the data lines in the sense regions can be configured to couple to display circuitry in order to receive data signals from the circuitry for displaying. During touch mode, the data lines in the sense regions can be configured to couple to corresponding sense lines in the regions, which in turn can couple to touch circuitry, in order to transmit touch signals to the circuitry for sensing a touch or near touch. Alternatively, during touch mode, the data lines in the sense regions can be configured to couple to ground in order to transmit residual data signals to ground for discarding.
The present invention relates to a method for determining an acoustic response attributed to a location of an impact, in particular a touch event, on a surface of an object including at least one transducer comprising the steps of: a) receiving an acoustic signal from at least one transducer, wherein the signal corresponds to a predetermined excitation (E) at at least one location on the surface; b) determining an acoustic response based on the acoustic signal received in step a); and c) determining the acoustic response attributed to at least one location on the surface different to the location of the predetermined excitation based on at least two different acoustic responses determined in step b).
While a display portion displays a list, a scroll operation that is an operation of moving a touch position after the touch of a touch panel portion and of thereafter cancelling the touch of the touch panel portion is performed such that the touch panel portion receives an instruction to scroll the list, and, when the scroll operation is performed on the touch panel portion, the display portion changes a scroll width at which the list is scrolled according to a scroll operation direction that is a direction in which the touch position is moved at the time of the scroll operation.
Methods and systems for providing functionality of a user interface to control directional orientations of a device are provided. An example method includes receiving an input on an interface indicating a command for a directional orientation of a robotic device, and providing an indicator on the interface representing a location of the input. The indicator may include a representation of the command for the directional orientation of the robotic device. The method may further include determining that the location of the input on the interface is within a distance threshold to a pre-set location on the interface, and repositioning the indicator on the interface to be at the pre-set location. In this manner, the indicator may snap to a location if the input is close to a pre-set location, for example.
A display device includes; a first touch sensor, a second touch sensor disposed in proximity to the first touch sensor, a shade located on the second touch sensor wherein the shade controls intensity of incident light to the second touch sensor so that the second touch sensor receives a different intensity than the first touch sensor, and a reader which receives a first signal and a second signal from the first touch sensor and the second touch sensor, respectively and which analyzes the first signal and the second signal.
Implementations disclosed herein provide systems and methods for improved processing of touch sensor data with improved scalability and reduced standby power. Touch-related algorithms may be partitioned between the touch screen controller and the application processor or host such that the system can function with low standby power and low interface bandwidth while providing a scalable solution for enhanced user experience. In some aspects, a small digital processing engine and memory remains in the analog front end (AFE) of the touch screen controller to perform imagine forming algorithms that are mostly related to noise reduction and filtering schemes.
An exemplary computer mouse which is proofed against the ingress of contaminants includes a housing, a bottom cover, a left button, a right button and a middle button bracket. The middle button bracket includes a dust-proof block and a number of elastic components. The dust-proof block includes a raised portion. A middle button hole is defined between the left button and the right button, the raised portion is received in the middle button hole, and a sidewall of the raised portion is contact with or abuts a sidewall of the middle button hole. The number of the elastic components are arranged between the dust-proof block and the bottom cover. The elastic components keep a top surface of the raised portion substantially flush with outer surfaces of the left and right buttons when no button is pressed and flush with the outer surface of the button which is pressed.
An operation input device includes a base part including a placement surface on which an inductor is placed; a displacement member including a first surface facing the placement surface and a second surface configured to receive application of a force, and configured to cause the inductance of the inductor to vary with the approach of the first surface to the placement surface due to the application of the force on the second surface; a support member configured to support the displacement member in such a manner as to allow the displacement of the displacement member; a detection part configured to detect a variation in the inductance by feeding a first pulse signal to the inductor; and a control part configured to generate a magnetic field to displace the second surface by feeding a second pulse signal different in phase from the first pulse signal to the inductor.
“Fusion” gestures that transition from air to surface or surface to air and interactions with graphical objects displayed on one or more display devices. Surface-to-air gestures are captured on a surface of a touch-based sensing device, and the gesture leaves the surface and enters a volumetric space adjacent to the surface, where a 3D gesture sensing system captures the gesture in 3D space. One or more objects displayed on the display device(s) are graphically shown to be manipulated by the gesture. Air-to-surface gestures are captured in the reverse manner. Different devices housed in separate housings can detect the different types of gestures. For example, a gaming terminal can detect surface gestures made on a single- or multi-touch sensitive surface while a portable electronic device in communication with the gaming terminal can detect air gestures made in a volumetric space in front of the gaming terminal.
The input device and the input system include a hand detection means which detects the position of the hand, a body part detection means which detects positions of user's body parts such as the face, for example, a relative position calculation means which calculates a relative position of the hand with respect to body parts from hand position information being a detection result of the hand detection means and body part position information being a detection result of the body part detection means, and a gesture recognition means which recognizes a hand gesture on the basis of a change in the hand position information being the detection result of the hand detection means, wherein when a hand gesture is recognized, the operation of the input device with respect to the user's gesture is changed according to a relative position of the hand with respect to body parts.
The present invention enables the host (presenter) to monitor and identify the current slide of the host presentation that is being displayed on a local user machine. The host is able to receive queries such as instant messages from local user's viewing the presentation and identify a particular presentation slide with contents that formed the basis for the question. The present invention generates a transcript of the local user activities that occurred during the presentation. This transcript helps the host presenter understand the contents of the activities and the basis for queries made to the host presenter.
Described herein are systems and methods for determining infrared signaling codes used for controlling various media devices. The system may determine signaling codes based on user input in response to a graphical user interface, by receiving signals transmitted by a media device remote, or a combination thereof. When determined, a media controller remote control may receive commands from a media controller using a radio frequency interface and transmit particular signaling codes using infrared emitters to allow for control of the media devices.
A compensator circuit includes a first transconductance amplifier to convert an input voltage to a first output current. A second transconductance amplifier converts the input voltage to a second output current. A buffer includes an input and an output. The input of the buffer receives the second output current. A resistance is connected between an output of the first transconductance amplifier and an output of the buffer. A capacitance connected (i) between an output of the second transconductance amplifier and a terminal at a reference potential, and (ii) between the input of the buffer and the terminal. An output voltage of the compensator circuit is based on the first output current and is a voltage across the resistance, the buffer and the capacitance.
A thermostat includes a plurality of HVAC (heating, ventilation, and air conditioning) wire connectors including a connection to at least one call relay wire. The thermostat may also include a powering circuit, including a rechargeable battery, which is configured to provide electrical power to the thermostat by power stealing from a selected call relay wire. The power stealing may comprise an active power stealing mode, in which power is taken from the same selected call relay wire that is used to call for an HVAC function, and an inactive power stealing mode in which, in which no active call is being made. The powering circuit may be configured to substantially suspend (or at least reduce the level of) power stealing for at least a first time period following each transition of the thermostat from between operating states.
A pressure reducing apparatus includes a body being equipped with a first side port through which a pressure fluid is supplied and a second side port through which the pressure fluid having been reduced in pressure is discharged. Further, a feedback passage is formed, which establishes communication between the second side port and a third diaphragm chamber that faces toward a pilot valve. Additionally, a pressure fluid that flows through the second side port is introduced through the feedback passage into the third diaphragm chamber, whereby a third diaphragm is pressed upwardly against an elastic force of a second spring into equilibrium.
An attribute about person's mobility capability is judged by a human movement attribute acquisition unit. Candidate paths for a detected person to move along are created by a human path candidate creation unit based on information about the person and a predicted time left for a collision between the autonomous locomotion apparatus and the person. A movement load for each candidate path is evaluated by a human path load evaluation unit based on an attribute of person's movement. A path which imposes a minimum movement load on the person, i.e., a path suitable for the person's mobility capability and the easiest for the person to avoid the autonomous locomotion apparatus is selected by a human path determination unit. A path for the autonomous locomotion apparatus to guide the person to the selected path is planned by a guide path planning unit.
An industrial control system is provided. The system includes two or more industrial control resources that are employed to operate a control process. This includes at least one arbitration component installed with each of the industrial control resources, where the arbitration component is employed to resolve priorities between the industrial control resources.
The present invention relates to an embedded robot control system, particularly to an embedded robot control system of a highly expandable distributed control mode. An aspect of the present invention features an embedded robot control system. In accordance with an embodiment of the present invention, the embedded robot control system, which controls a plurality of robot instruments, which have a motor and a sensor, and a robot, which is connected with the plurality of robot instruments, can include a master controller, which is installed on the robot and controls the motor and the sensor of the robot instrument, and a slave controller, which is installed on another robot, connected to the robot, or the robot instrument and receives a control signal of the motor or the sensor from the master controller and controls the motor and the sensor.
A system and method for creating and incorporating a function block within a process control system enables a user of the process control system to generate a function block by combining a plurality of files selected from a group of files provided by the manufacturer of the process control system to form a source code file associated with the function block. The user can modify the function block source code file to include a procedure, routine or algorithm that is not provided by the manufacturer and can send the modified source code file to the manufacturer for validation. If the function block source code file is validated, a security measure such as a digital signature is provided to the user that enables the user to incorporate the function block within the process control system. The function blocks can be used to incorporate anew function into a process control application or to operatively integrate a data source external to a process control application with the process control application via data mapping functions performed by the function blocks.
A personal digital ID device provides a digital identifier to a service for a predetermined duration in response to user interaction. The user interaction may include a button press. The personal digital ID device may be in the form of a bracelet, a key fob, or other form factor. The service may be provided by a mobile device, in the cloud, or elsewhere.
A collection device including: an accommodation part configured to accommodate therein collected adhering substance; and a detection part configured to detect an amount of the adhering substance in the accommodation part and including, a moving member configured to move from a first position to a second position, the accommodation part being capable of accommodating therein the adhering substance when the moving member is arranged at the first position and being full of the adhering substance when the moving member is in the second position, and a restraining member configured to restrain the moving member from moving from the first position to the second position when the moving member is arranged at the first position, and restrain the moving member from moving from the second position to the first position when the moving member is arranged at the second position.
An image forming apparatus includes a control unit, which is configured to, if a developing material image transferred to another member is formed on an image carrier, obtain a print ratio that is a ratio of the area of the formed developing material image with respect to the area of a developing material image capable of being formed on a recording material that is to be printed on, and a threshold value corresponding to a consumption amount of the developing material in a image forming unit and a number of sheets printed, and control an amount of developing material that is to be supplied to a cleaning unit in accordance with the print ratio and the threshold value.
An image forming apparatus for forming an image on a recording material includes a cartridge, detachably mountable to a main assembly of the image forming apparatus, including a memory and an image forming process member actable on an image bearing member, and a current detecting portion, provided in the main assembly, for detecting a value of current passing through the process member. The current detecting portion detects the value of the current passing through the process member when a voltage is applied to the process member, and the memory stores information for discriminating whether or not the process member is recyclable on the basis of the detected value of the current.
Provided is a fixing device, the heat generation amount of which can be obtained with a smaller amount of a microwave absorbing material. As a result, the start-up (warm-up) time for achieving a fixing temperature can be shortened without impairing characteristics such as flexibility, releasing property, and durability. The fixing device includes a heating member; a pressurizing member; and a microwave generating unit. It is configured to fix an unfixed toner on a recording material by passing the recording material through a nip formed between the heating member and the pressurizing member. The heating member includes a heat generating layer for generating heat with microwaves generated by the microwave generating unit. The heat generating layer contains a high molecular compound and a carbon fiber having an average fiber diameter of 80-150 nm, an average fiber length of 6-10 μm, and an absorption peak in a Raman spectrum resulting from a graphite structure.
An image forming apparatus includes image carriers that carry toner images; an intermediate transfer body that is brought into contact with the image carriers to carry the images before transferring them to a recording material; first transfer devices that include first transfer members and form first-transfer electric fields for transferring the images on the image carriers to the intermediate transfer body; a second transfer device that includes a second transfer member and forms a second-transfer electric field for transferring the images transferred to the intermediate transfer body to the recording material; and an adjusting device that adjusts an electric field to be formed in a second transfer area to a cleaning electric field, which is of the same polarity as and a lower intensity than the second-transfer electric field, when the images on the intermediate transfer body passes through the second transfer area without a recording material passing therethrough.
An image forming apparatus includes an application unit that applies to a holding unit a voltage that generates a potential difference between the holding unit and a photoconductor member such that a toner image is developed on the photoconductor member. The potential difference causes toner included in a two-component developer, held by the holding unit, to be transferred from the holding unit to the photoconductor member. A controller controls the application unit, subsequent to an expiration of an image quality assurance period throughout which a predetermined image quality is assured, such that the potential of the holding unit is decreased according to a decrease of a thickness of a photosensitive film.
The image forming apparatus includes a developing unit that is detachable and contains a developer, a detection member that includes an electrode to be detected and is rotatable around a rotation axis in the developing unit, an agitator that moves around the rotation axis in the developing unit; an electrostatic capacitance sensor electrode provided on an exterior of the developing unit, an electrostatic capacitance sensor that detects electrostatic capacitance between the electrode to be detected and the electrostatic capacitance sensor electrode, and outputs data on the detected electrostatic capacitance, and a CPU that determines an amount of developer in the developing unit based on the data output from the electrostatic capacitance sensor.
An image forming apparatus is provided in which, in a case where a calculated value is less than a predetermined value (for example, “low” level, or “out” level), and information indicating that a remaining toner amount is less than the predetermined value has not been acquired from a toner container, the predetermined value or a value a predetermined amount greater than the predetermined value is set as an initial value of the remaining toner amount.
A shutter that suppresses accumulation of discharge products on a photosensitive member is disposed between a grid and the photosensitive member. In this structure, to suppress corrosion of the grid due to the discharge products for a long time, first and second protective layers are provided. The first protective layer is provided on a surface of a base member of the grid that faces the discharge electrode. The second protective layer is provided on a surface of the base member that faces the shutter. The second protective layer is thicker than the first protective layer.
A blade-like charging member for charging a surface of an image bearing member. The blade-like charging member includes a charging portion for effecting electric discharge to the surface of the image bearing member and a non-charging portion. The non-charging portion can contact the image bearing member with a gap. At least a part of the non-charging portion is made of a material having a higher resistance than that of the charging portion so as to prevent electric discharge between the non-charging portion and the surface of the image bearing member. The non-charging portion is capable of sliding contact with the surface of the image bearing member over the entirety of an image forming region width of the surface of the image bearing member. The charge portion and the non-charging portion are bonded to each other by adhesive material at a connection interface.
A photosensitive layer of an electrophotographic photosensitive member includes a phthalocyanine pigment and a specific dicyanoethylene compound. Alternatively, the photosensitive layer and/or an undercoat layer of the electrophotographic photosensitive member include a specific dicyanoethylene compound, and the photosensitive layer includes the phthalocyanine pigment.
A method of fabricating an aberration monitor on a production mask used in photolithographic patterning of a semiconductor substrate is provided. The method may include placing a production mask within a nanomachine repair tool and generating, using the nanomachine repair tool, a phase shifting pattern within a region of the production mask.
A catadioptric projection optical system includes a plurality of lenses which are arranged between a first plane on which the pattern is arranged and a second plane on which the substrate is arranged. Two mirrors are arranged in an optical path of the light beam between the plurality of lenses and the second plane. A dioptric optical system is arranged in an optical path of the light beam between the two mirrors and the second plane the dioptric optical system forming the image of the pattern onto the second plane by the light beam from the two mirrors. The dioptric optical system includes a first negative lens and a second negative lens, the second negative lens being adjacent to the first negative lens along the single optical axis.
A projector includes: an external case provided with an opening through which light passes; a projection system disposed within an inside space of the external case, wherein the projection system includes a reflection member having a reflection surface capable of reflecting light received from a light source device to guide the light toward the opening, and projects the light to the outside of the external case via the opening; and a detection unit which detects a foreign material existing on the optical path of the light in the area of light exit of the opening.
A projection display apparatus comprises a lamp; a display element that modulates light emitted from the lamp according to an amplitude of the image signal, and emits the light as the image light; a light intensity controller that changes a lamp power according to a power changing operation, and, if the changed lamp power is lower than a rated power of the lamp and supplied to the lamp for a certain period of time, increases the lamp power and then reduces the lamp power to an original power, identifies an amplitude of the image signal where an intensity of the image light is constant before and after the change of the lamp power; and an image signal controller that controls the amplitude of the image signal to the identified amplitude, and supplies the display element with the image signal.
A laser probe for electrically steering a light beam includes a tubular-shaped housing, an optical waveguide, and a beam steering cell. The optical waveguide is disposed within an interior region of the housing and is configured to emit a light beam travelling in a first direction. The beam steering cell is disposed within the housing and comprises an electro-optical (EO) material. The beam steering cell is configured to receive one or more voltages and electrically steer the light beam with the OE material to a second direction. The EO element has a shape of varying thickness such that a first portion of the light beam passes through a portion of EO element having a greater thickness than a second portion of the EO element passed through by a second portion of the light beam. The laser probe may be a directional laser probe or a multi-spot laser probe.
A liquid crystal display device includes a gate electrode formed on an upper surface of an insulating substrate, a gate insulating film laminated to cover the gate electrode, a drain electrode and a source electrode formed above the gate insulating film, a semiconductor layer laminated on an upper surface of the gate insulating film, and controlling a current between the source electrode and the drain electrode by an electric field developed by the gate electrode, a common electrode having an opening portion which is formed in a region corresponding to a channel region above the semiconductor layer, and an antistatic pattern arranged at a distance from the drain electrode and the source electrode. One end and the other end of the antistatic pattern are coupled to the common electrode.
A liquid crystal display device includes a first substrate, a first alignment film formed over the first substrate, a second substrate, a second alignment film formed over the second substrate, a liquid crystal layer sandwiched between the first alignment film and the second alignment film, and a projecting portion formed over the second substrate. The first alignment film is a photo alignment film, and a thickness “d2” of the second alignment film over the projecting portion and a film thickness “d1” of a portion of the first alignment film facing the projecting portion satisfy formula (1) and (2): 0 nm
A liquid crystal display module includes a backlight unit, a liquid crystal display panel on a top surface of the backlight unit, and a thermoplastic layer on at least one lateral surface of the backlight unit and at least one lateral surface of the liquid crystal display panel, the thermoplastic layer including a solidified thermoplastic resin exhibiting viscosity of about 300 cps to about 1,000 cps at a temperature of about 120° C. to about 130° C.
Systems and methods for controlling and measuring modes possessing even and odd symmetry in a slow-light photonic crystal waveguide. An example device comprises a photonic crystal waveguide having modes possessing even and odd symmetry, and a Mach-Zehnder coupler comprising two waveguide branches one of which has a phase adjuster. Another example device, which can be used as an optical isolator, comprises two Mach-Zehnder couplers, and a photonic crystal waveguide comprising an electro-optic modulator therein. A method of measuring a group index of a mode with odd symmetry comprises: coupling light into a photonic crystal waveguide through a Mach-Zehnder coupler with a mixed even/odd symmetry, measuring insertion loss of the combined light signal after passing through the photonic crystal waveguide, determining the spacings of adjacent peaks or valleys from the insertion loss versus wavelength plot, and using the spacings to determine the group index of the odd symmetry mode.
Eyeglass assemblies including an eyeglass lens having an engaging portion. Under typical conditions of use, the engaging portion is maintained in contact with an eyeglass frame member by means of a removable bonding member (RBM). Under selected atypical ambient conditions, the RBM changes so that the engaging portion and the frame member can be separated. The engaging portion can extend from the lens, or can be a recess in the lens. The RBM can be a suitable adhesive (RBA), or a component composed of a shape memory metal (RBSMA) or a material which softens when subjected to heat or other atypical condition. The engaging portion can be shaped and treated to reduce stresses therein. Similarly, the open ends of an eyeglass rim can be maintained in contact with each other under typical conditions of use by an RBA or an RBSMA so that the rim is positioned around an eyeglass lens, but can be released under selected atypical ambient conditions.
Disclosed herein are systems and related methods for reducing speckle on display screen. More specifically, screen vibration is used to reduce speckle, and in accordance with the disclosed principles, the vibration may be achieved by using wave-based actuation (e.g., acoustic or electromagnetic waves) to vibrate the screen. In an exemplary embodiment, a speckle reducing system may comprise at least one actuating element located proximate to, but not in physical contact with, a display screen. In addition, the at least one actuating element may be configured to generate waves directed towards the display screen. When the waves impact the display screen, the waves impart vibration to the display screen.
A plural axis sun tracking system, including a base, a spatial structure assembly, and a rotating system mounted on the base for rotating the spatial structure assembly, where the spatial structure assembly includes a frame having a lower portion at a first peripheral end of the spatial structure assembly and an upper portion at a second peripheral end of the spatial structure assembly, the lower portion being more proximal to the rotating system than the upper portion, and an anchoring location for anchoring the spatial structure assembly to the rotating system, the anchoring location located at the lower portion, where the mass of the frame increasingly recedes as the distance from the anchoring location towards the upper portion increases.
A corner reflector of an armored vehicle includes a housing having a look-in aperture of a subregion extending into a vehicle interior, a look-out aperture of a subregion extending out of the vehicle and at least one prism body or deflection mirrors disposed in the housing, to provide effective shielding against sources of electromagnetic interference. Providing the corner reflector on all sides with a shield made of electrically conductive material ensures that vehicles equipped therewith or individual electronic components thereof cannot be influenced or rendered unusable by sources of electromagnetic interference.
A method and apparatus are disclosed for generating a plurality of scattered radiation patterns at an image plane of an optical microscope. The apparatus includes at least one lens element, a liquid crystal display (LCD) array, and a housing comprising a body portion supporting the LCD array and lens element in a predetermined spaced apart relationship. The LCD array comprises a plurality of pixel elements arranged in a grid layout, said array being connectable to a processing element adapted to selectively control a transmittance of each pixel in the grid layout.
According to one embodiment, a monocular head mounted display comprising an information acquisition section, an image data generation section, and an image display section. The information acquisition section acquires solid body position information on a position of a solid body located on ground around a user, and indication position information on an indication position for the user. The image data generation section generates image data including an information object to provide provision information to the user. The image display section displays an image based on the image data on one eye of the user in superimposition on a real scene. The image data generation section generates the image data so as to move the information object in the image so that the information object is superimposed on the indication position after placing the information object in the image so that the information object is superimposed on the solid body.
An optical cable connection box with an auxiliary device for gap filling and waterproofing is provided. The connection box includes a cable accessing end face, an auxiliary device for gap filling and waterproofing and an elastic shrinkable tube. The end face has a first hollow tubular column, and an optical cable to be waterproof processed by the elastic shrinkable tube passes therethrough as a dual cable after face to face bending, so that cable halfway splitting and halfway branching can be processed in the box without cutting off the cable. The auxiliary device cooperates with the optical cable in the hollow column, formerly a first waterproof structure where the auxiliary device is wrapped by the elastic shrinkable tube. At least the outside of the first hollow column and at least a portion of the auxiliary device are also wrapped by the elastic shrinkable tube forming a second waterproof structure.
A multi-tube optical fiber cable has a core with a first set of one or more optical fiber tubes, each having one or more optical fibers loosely arranged therein. The first set of tubes is constructed of a polymer having a low Young's constant modulus. The core also includes at least two strength members with a first binder arranged around the first set of optical fiber tubes and the strength members, where the first binder is substantially flat in shape such that there is no deformation of the first set of tubes, and where the strength members are offset from a central axis of the cable. The cable maintains a second set of a plurality of optical fiber tubes, each having one or more optical fibers loosely arranged therein, arranged around the outer circumference of the core.
A protective coating encapsulates bond pads disposed on a substrate of an optical communications module and extends in between the bond pads. The protective coating has characteristics that (1) increase the dielectric resistances between adjacent bond pads on the substrate, (2) protect the bond pads from moisture in the environment, and (3) prevents, or at least reduces, ion migration between adjacent bond pads. In this way, the protective coating prevents, or at least reduces, corrosion growth that can lead to impedance degradation and electrical shorts between adjacent bond pads.
An optical module, including a PCB, an optical component arranged on the PCB, and an optical fiber coupled with the optical component through an optical lens module, further including a fixed bracket, a lens bracket detachably connected with the fixed bracket, and a fiber bracket detachably connected with the lens bracket, the fixed bracket is fixed on the PCB, the optical lens module is arranged on the lens bracket, the optical fiber is arranged on the fiber bracket, and the optical component is located between the fixed bracket and the lens bracket, the fixed bracket is provided with at least two positioning parts, the lens bracket is provided with positioning parts matching respectively the positioning parts of the fixed bracket to achieve detachable connection. The optical path coupling is achieved through the mechanical fixation among multiple brackets, working process is simplified, and coupling consistency and accuracy are improved.
Methods for wavelength filtering and structures for accomplishing the same. Wavelength filtering includes forming grooves in a waveguide to define angled surfaces in a path of the waveguide; forming a reflective layer on the angled surfaces; depositing cladding material on top of the waveguide and on the angled surfaces; forming a filter layer on an active region of an opto-electronic device, which transmits a single wavelength and reflects other wavelengths used; depositing the opto-electrical device on the cladding layer such that the filter layer is aligned with a point of incidence of a light beam reflected from the reflective layer; and electrically bonding the opto-electronic device to vias in the waveguide structure.
A data center connector (DCC) system includes a receptacle connector assembly that includes a receptacle body having a plug receiving end, a panel assertion end and a plug receiving chamber at the plug receiving end that receives a plug body of a plug connector assembly. A receptacle ferrule is located in the receptacle body. The receptacle ferrule is moveable axially within the receptacle body and biased toward the plug receiving end. A plug connector assembly includes a plug body having an insertion end sized to be received within the plug receiving chamber of the receptacle body. A plug ferrule is fixed axially within the plug body that contacts the receptacle ferrule and moves the receptacle ferrule axially with the plug body being inserted within the plug receiving chamber of the receptacle body.
The invention relates a long laminated polarizing plate (PL) comprising at least one reflective linear polarizer (Pr) having a transmission axis parallel to the longitudinal direction of the film, and at least one absorptive polarizer (Pa) having a transmission axis parallel to the longitudinal direction. In this long laminated polarizing plate (PL), the reflective linear polarizer (Pr) and the absorptive polarizer (Pa) are arranged such that their transmission axes are parallel to each other. The long laminated polarizing plate of the invention is excellent in productivity and is applicable to a large-sized liquid crystal display.
There are provided an optical waveguide forming resin composition, an optical waveguide and a light transmission flexible printed board both produced by using the composition, and a production method for the optical waveguide, wherein the resin composition is superior in coatability, capable of omitting a solvent drying step in coating film formation, and suitable as a material for forming an optical waveguide which allows only a low waveguide loss and which has a higher Tg and higher flexibility. An optical waveguide forming resin composition comprises the following components (A) through (D), wherein the optical waveguide forming resin composition is free from a solid resin component and the viscosity thereof under a 25° C. environment is within the range of 10 to 20 mPa·s: (A) a liquid oxetane compound; (B) a liquid epoxy compound; (C) an alkylene glycol; and (D) a photoacid generator.
The present invention relates to light flux controlling member (140) formed by injection molding, light emitting apparatus (120) having light flux controlling member (140), surface light source apparatus (100) having light emitting apparatus (120), and a display apparatus having surface light source apparatus (100). Light flux controlling member (140) includes light control emission surface (141) configured to control light distribution of light emitted from light emitting element (130), and back face (142) opposite to light control emission surface (141). Light flux controlling member (140) is formed by injection molding by an overlap gate scheme, or by combination of the overlap gate scheme and a side gate scheme. Therefore, on back face (142) of light flux controlling member (140), there remains gate remnant (147) in such a manner to be in contact with an outer rim.
A wavelength-tunable, depletion-type infrared metamaterial optical device is provided. The device includes a thin, highly doped epilayer whose electrical permittivity can become negative at some infrared wavelengths. This highly-doped buried layer optically couples with a metamaterial layer. Changes in the transmission spectrum of the device can be induced via the electrical control of this optical coupling. An embodiment includes a contact layer of semiconductor material that is sufficiently doped for operation as a contact layer and that is effectively transparent to an operating range of infrared wavelengths, a thin, highly doped buried layer of epitaxially grown semiconductor material that overlies the contact layer, and a metallized layer overlying the buried layer and patterned as a resonant metamaterial.
To determine characteristics of a subterranean body, pressure testing is performed, where the pressure testing involves drawing down pressure in the well. Pressure data in the well is measured during the pressure testing, and a seismic surface operation is performed. Seismic data is measured as part of the seismic survey operation. The pressure data and the seismic data are provided to a processing system for processing to determine characteristics of the subterranean body.
A method and apparatus for tracking target objects includes a network of unidirectional sensors which correspond to nodes on the network. The sensors identify the presence of a target object, determine a first criteria for the relationship of the target object to the sensors and send a message to sensors neighboring the sensor. The message includes a unique identification of the target object and the first criteria. The sensors are ranked to determine which of the sensors should head a cluster of sensors for tracking the target object. Clusters are propagated and fragmented as the target object moves through a field of sensors.
A scintillation detector including one or more photomultiplier tubes, a scintillation block optically attached to the photomultiplier tubes, and a DC-coupled bleeder circuit combining outputs of dynodes of the photomultipliers to provide a DC-coupled dynode output together with a DC-coupled anode output of the photomultiplier tubes. The DC-coupled bleeder circuit includes a RF transformer. A positive high voltage supply also can be used together with a DC-coupled bleeder circuit for the anode outputs.
A solid state detector with alpha rhombohedral red boron is disclosed. The solid state detector detects neutrons, especially thermal neutrons. The detector may include a body of alpha rhombohedral red boron disposed between electrodes, a power supply for applying a voltage to said electrodes, and a detecting device that detects and measures a current pulse emitted from said body of alpha rhombohedral red boron to detect the neutrons.
A vehicular collision avoidance system comprising a system controller, pulsed laser transmitter, a number of independent ladar sensor units, a cabling infrastructure, internal memory, a scene processor, and a data communications port is presented herein. The described invention is capable of developing a 3-D scene, and object data for targets within the scene, from multiple ladar sensor units coupled to centralized LADAR-based Collision Avoidance System (CAS). Key LADAR elements are embedded within standard headlamp and taillight assemblies. Articulating LADAR sensors cover terrain coming into view around a curve, at the crest of a hill, or at the bottom of a dip. A central laser transmitter may be split into multiple optical outputs and guided through fibers to illuminate portions of the 360° field of view surrounding the vehicle. These fibers may also serve as amplifiers to increase the optical intensity provided by a single master laser.
Apparatus for calculating the location of a receiver in a satellite navigation system, the apparatus being arranged to calculate a location of the receiver by means of an algorithm that utilizes an estimate of receiver location and/or an estimate of absolute time, the apparatus being arranged to perform the calculation in such a way as to extend a convergence zone within which the algorithm is capable of generating the correct location for the receiver despite an error in the estimate(s).
The invention uses information gathered from a barometric pressure sensor, connected to a GNSS receiver, to choose an optimal acquisition strategy. In an example, the device of the invention includes a pressure sensor, which is sampled at low rate during power off phases, to store a pressure profile, and a processor programmed to detect the signature of a pressurized-cabin airliner. In this way the GPS receiver can determine if the unit has been flown during an inactivity period, and estimate the duration of the flight. The advantage lies in improving the user experience by shortening the Time to First Fix after air travel.
A method for creating an architecture to support Q-gating for launch-off-shift (LOS) scan testing using a plurality of flip-flops is provided. The method may include applying a common clock signal to each clock input of the plurality of flip-flops and applying a gated scan enable signal to each scan enable input of the plurality of flip-flops. The method may further include applying a global scan enable signal directly to each of a plurality of Q-gates corresponding to each of the plurality of flip-flops, wherein the global scan enable signal traverses a signal path that bypasses combinational logic located between any two flip-flops of the plurality of flip-flops.
A scan chain latch circuit, a method of operating a latch circuit in a scan chain, and a computer-readable medium having stored thereon a data structure defining a scan chain latch circuit for instantiation on a semiconductor die are disclosed. In an embodiment, the scan chain latch circuit comprises a first latch for holding one data value, a second latch for holding another data value, and a multiplexor. The one data value is applied to a first data input of the multiplexor and the another data value is applied to a second data input of the multiplexor. An alternating clock signal is applied to a select input of the multiplexor to control the output of the multiplexor, wherein the output of the multiplexor toggles between the two data values held in the two latches at a defined frequency.
A method for selecting the scrambling and descrambling data transmitted in a storage system containing ECC and scramble engines with a seed table is disclosed and the steps comprises: encoding a data sent from a HOST interface by an ECC encoding engine and transmitting the data to a LFSR scramble engine; scrambling the data by the LFSR scramble engine and transmitting to a storage device; creating a seed value and transmitting the seed value to a seed table by the LFSR scramble engine; receiving the seed value from the seed table and the scrambled data from the storage device by a LFSR descramble engine, and descrambling the scrambled data based on the seed value and transmitting to an ECC decoding engine; and decoding the descrambled data received from the LFSR descramble engine and then acquiring the original data sent from the HOST interface.
Aspects of the disclosure provide a testing method. The method includes supplying a power supply from a voltage regulator to a device under test (DUT). The DUT includes an adaptive voltage scaling module configured to generate a feedback signal in response to the power supply. Further, the method includes receiving the feedback signal from the DUT to the voltage regulator to regulate the power supply based on the feedback signal from the DUT, and determining whether the DUT meets a specified performance requirement while the voltage regulator regulates the power supply provided to the DUT based on the feedback signal received from the DUT.
A method on a mobile computing device for locating electromagnetic signals radiating from a buried asset is disclosed. The method includes receiving buried asset data points corresponding to a buried asset, reading a predefined value, generating, based on the buried asset data points, a two dimensional area comprising a buffer zone at an above-surface location, wherein a width of the buffer zone corresponds to the predefined value, and wherein the buffer zone corresponds to the buried asset, and iteratively executing the following four steps: a) calculating an above-surface location, b) determining whether the above-surface location is located within the two dimensional area, c) if the above-surface location is not located within the two dimensional area, displaying a first graphic in a display, and d) if the above-surface location is located within the two dimensional area, displaying a second graphic.
Methods and systems for detection and monitoring of power supply voltage and voltage reference circuitry are provided. In one embodiment of the invention, a first signal is set to be proportional to a power supply voltage in response to a determination from control circuitry that an output voltage of bandgap voltage reference circuitry is less than a first threshold voltage. The first signal is set to a logic low level in response to a determination from control circuitry that the output voltage of the bandgap voltage reference circuit is greater than the first threshold voltage, wherein the first threshold voltage is less than a bandgap reference voltage. A value of a reset signal is determined based at least in part on the first signal.
A probe conducts testing of a circuit. The probe includes a base coupled to a substrate. The probe also includes a cantilever attached to the base at a first end, the cantilever deflecting from a first position to a second position in which a second end opposite the first end is in contact with the substrate and to move between the second position and the first position based on movement of a compliant bump of the circuit, and a probe tip attached to the cantilever at the second end, the probe tip maintaining contact with the compliant bump of the circuit.
The present invention is directed to a cartridge device for a measuring system for measuring viscoelastic characteristics of a sample liquid, in particular a blood sample, comprising a cartridge body having at least one measurement cavity formed therein and having at least one probe element arranged in said at least one measurement cavity for performing a test on said sample liquid; and a cover being attachable on said cartridge body; wherein said cover covers at least partially said at least one measurement cavity and forms a retaining element for retaining said probe element in a predetermined position within said at least one measurement cavity. The invention is directed to a measurement system and a method for measuring viscoelastic characteristics of a sample liquid.
A chromatography sensor device is provided that includes a first loading chamber into which a sample fluid can be inserted, a second loading chamber into which a buffer fluid can be inserted, a diffusion column adapted to communicate with the first loading chamber and the second loading chamber and having walls lined with a chromatography stationary phase, a first high finesse optical cavity communicating with the diffusion column at a first distance from the gate, a second high finesse optical cavity communicating with the diffusion column at a second distance from the gate; and one or more lasers for generating laser frequencies for exciting the first and second high finesse optical cavities, whereby the sample fluid may diffuse into the diffusion column containing the buffer fluid and the one or more lasers and associated detectors may be used to detect a molecule of interest in the sample fluid.
A method is provided by which a reagent is provided to a living sample, including contacting a thin-film containing a porous body with a living sample containing cells or tissues, and discharging a solution containing at least one or more reagents to a non-contact side of the thin-film by ink-jet to provide the solution to the specific area of the living sample through pores on the thin-film, wherein the smaller diameter of the pores on the porous body relative to the diameter of cells in the living sample enables the reagent to be provided to each individual cell separately. According to this method, the reagent and the reaction product can be fixed while maintaining positioning information of the target substance in the living sample, as a pretreatment for analyzing with high positioning accuracy the target substance in each individual cell in the living sample.
A method that identifies the compounds contributing to a detected burnt odor from an air conditioner artificially reproduces the detected burnt odor, and prepares a corresponding burnt odor composition is provided. Through the analysis method of the present invention, the compounds that contribute to the detected burnt odor from an air conditioner are be identified and quantified. The detected burnt odor is reproduced from a combination of the compounds identified by the analysis method of the present invention. The reproduced burnt odor provides significant data required for development of an apparatus and a method for removing specific odor.
An inspection apparatus for nondestructive inspection/evaluation. The inspection apparatus may include a probe, and sensor, and a biasing spring. The probe may have a first end and a second, free end defining an opening. The sensor may be received in the opening. The biasing spring may be received in the opening in between the first end of the probe and the sensor to urge the sensor away from the first end of the probe. The probe may include a gimbal joint or ball and socket type joint and a spindle, where the joint provides for deflection of the probe relative to the spindle. A blocking pin for limiting the range of movement of the sensor retains part of the sensor in the opening. The sensor may have a position extending out of the opening, and a position where an end of the sensor is substantially flush with the end of the probe.
A method for producing a silver colloid solution of highly stable resulting colloids includes adding an aqueous solution of a hydroxylamine salt to an aqueous solution of an alkali, and then dispersing into the mixture an aqueous solution of the metal ions, the hydroxylamine salt being selected such that the anion, when combined with the said metal ions, would form a metal salt having a very low solubility in water, wherein the metal ion solution is introduced into the mixture in such a manner that the metal ions are substantially dispersed throughout the mixture within one second. A maturing period, preferably at elevated temperatures, leads to a stable state.
Disclosed is a dewpoint and icing condition detection apparatus that includes a sensor, a signal conditioner and a data acquisition device. The sensor is a carbon nanotube sensor having a resistance that varies in proportion to a change in humidity of a gas flow across the sensor.
A CT system includes a rotatable gantry having an opening for receiving an object to be scanned, an x-ray source configured to project x-rays through the opening, and a detector assembly positioned to receive the x-rays. The detector assembly includes a plurality of readout chips positioned within a cooling zone and configured to receive electrical signals from a plurality of diode arrays, and a fan positioned to blow air into the cooling zone. An air temperature within the cooling zone is controlled independent of a speed of the fan.
A test cell for analyzing residue on the surface of a microelectronic component includes a cleaning tip with an opening at one end for passing cleaning fluid into the chamber and for passing used cleaning fluid out of the chamber, and an opening at the other end to access a test area in which cleaning fluid may contact the surface of a component to be tested. A third opening for venting the cleaning tip chamber to the atmosphere may also be provided. A common cleaning/aspiration passageway communicates with the cleaning tip chamber through the first opening. A cleaning passageway provides fresh cleaning fluid to the cleaning/aspiration passageway. An aspiration passageway removes used cleaning fluid from the cleaning/aspiration passageway. An analysis chamber in fluid communication with the aspiration passageway has electrodes effective for qualitatively and/or quantitatively measuring residue removed from the microelectronic surface by the cleaning fluid.
A stage device includes a stage configured to move in an X-axis direction and a Y-axis direction, an X-axis interference reflector spaced apart from the stage in the X-axis direction, a first X-axis interferometer disposed on the stage that is configured to measure an X-axis location of the stage using the X-axis interference reflector, and an optical movable element spaced apart from the stage in the Y-axis direction that is configured to shift in the X-axis direction a path of a light beam propagating in the Y-axis direction according to movement of the stage in the X-axis direction.
A sample digester with independently controllable sample heating and ultraviolet radiation. There are two unique advantages. Because the two digestion means are independent, the user can optimize the means of digestion to suit the analytical method. A second advantage is that the ultraviolet source can be maintained at a relatively cool temperature, for which the greatest amount of light is transmitted. Since both means of digestion can be carried out simultaneously, there is a substantial saving of time and a significant improvement in digestion efficiency.
An elongation tester includes a fixed holder configured to hold an end of a tested material, a variable holder configured to hold a side of the tested material, the variable holder being formed of an elastic material and having a holding region that deforms in a longitudinal direction of the side of the tested material in accordance with deformation of the tested material, and a driver configured to reciprocate the fixed holder.
A performance evaluation method of a vehicle member includes a calculation process for performing an analysis using a partial structure CAE model modeling a module where a member of a vehicle to be evaluated and a collision test device for conducting a collision test on the member are combined, and obtaining a value of a collision performance evaluation parameter in the partial structure CAE model; a calculation process for determining a boundary condition of the partial structure CAE model; a calculation process for determining a test condition of a member collision test device based on the boundary condition of the partial structure CAE model; and a test process for conducting a collision test using a physical member collision test device and a physical member, based on the set condition of the member collision test device.
The present disclosure is generally directed to a strain sensor, system and method of fabrication and use that includes an optical fiber, an optical signal generator that transmits an optical signal through the optical fiber, at least two photonic crystal slabs within the optical fiber separated by a first segment of optical fiber, a photo-detector that detects a reflected optical signal from the at least two photonic crystal slabs, and a processor that computes a mechanical strain over the first segment of optical fiber based on the reflected optical signal detected by the photo-detector.
An arrangement for monitoring a submarine reservoir includes a number of sensor units located in an array on the seabed, and an interrogator unit for obtaining data on the reservoir from the sensor units. The interrogator unit includes a transmitter unit for sending optical signals to the sensor array and a receiver unit for receiving modulated optical signals from the array. Optical radiation from an optical source is transmitted along an uplink optical fiber which is split in a number of positions to form the array. The receiver unit includes optical-to-electrical converters for converting the optical signals to electrical signals, a phase demodulator, a multiplexer, a signal processor, and recording unit. The interrogator unit is divided into a concentrator and an interrogator hub, where signals are transmitted between the interrogator hub and concentrator along a riser cable. This enables the interrogator to be moved between a platform and the seabed.
Approaches enable a component such as a camera of a computing device to be collocated, or otherwise placed in proximity under the same cover sheet of material with an light source. A cover sheet can include a transmissive barrier positioned therein. The transmissive barrier can include at least one of a light scattering or light blocking feature. A light source and camera sensor can be positioned on a same side of the cover sheet and the transmissive barrier can be positioned between the light source and the camera such that light reflected from the light source by a portion of the cover sheet towards the camera is at least scattered, refracted, diffracted, blocked, or otherwise reduced using a determined pattern, layer, or other such feature in order to reduce an amount of light of the light source that is reflected from a surface or feature of the cover sheet and is detected by the camera.
A control unit for controlling the temperature of a spectrometer to be constant stores a first temperature coefficient indicating a proportion of a temperature change of the spectrometer to a room temperature change and a second temperature coefficient indicating a proportion of the temperature change of the spectrometer to a change in the air volume of blower means, and calculates the amount of change in the air volume of the blower means necessary to offset a change in the temperature of the spectrometer from a predetermined constant temperature, by using the first temperature coefficient and the second temperature coefficient, and controls driving of the blower means based on the calculated amount of change in the air volume.
A weighing cell based on the principle of electromagnetic force compensation. A permanent magnet system is mounted on a base part and includes an air gap within which is suspended a coil that is connected to a load receiver through a force-transmitting mechanism. The coil carries an electrical compensation current when the weighing cell is in operation. An optoelectronic position sensor is also included, and its signal corresponds to the deflection of the coil from a zero position which occurs as a result of placing a load on the load receiver. A closed-loop controller regulates the compensation current in response to the sensor signal in such a way that the coil and the load receiver that is connected to it are returned to their zero position by the electromagnetic force that is acting between the coil and the permanent magnet.
A printing device has a detecting section in which a light emitting section and a light receiving section are provided, liquid reservoirs for storing liquid in which a prism is provided to reflect light emitted from the light emitting section corresponding to a remaining state of the liquid, and a control section. The control section determines whether a process for air bubbles that is a process corresponding to an adhesion state of air bubbles in the prism is to be conducted or not based on a signal of light reception results obtained by receiving reflected light from the prism by the light receiving section.
A microwave-sending device for emitting microwaves includes electronics, a wave coupler, a waveguide, and a wave-emitting section. The electronics, the wave coupler, and the waveguide are joined by a common casting.
In a flow meter, a rotor support body carries a paddlewheel rotor in an operational position exposed to a through-flow bore of a flow meter housing. A sensor unit is operable to detect rotation of the rotor and provide output responsive to same for use by a monitoring system in determining a flow rate of fluid passing through the housing. The support body and the sensor unit are removable from the housing, for inspection, service, repair or replacement independently of the housing, with the sensor unit being removable independently of the support body for improved serviceability. The rotor is carried on a support shaft with a reduced diameter portion for contact-free rotation of the rotor around this reduced diameter portion, reducing an area of the shaft over which tight machining tolerances are required to prevent ingress of particulate matter that can lead to inaccurate flow measurements and increased wear rates.
An apparatus comprising a connector, a transceiver connected to the connector, and a processor configured to detect the connector's angular position relative to the transceiver based on a Hall voltage (VH) that corresponds to a magnetic flux passing through a Hall Effect sensor. Also disclosed is a method comprising detecting a Hall voltage (VH), calculating an angle based on the VH, and determining whether the angle is between an upper threshold and a lower threshold associated with a Specific Absorption Rate (SAR) compliance criteria.
Implementations of the present invention contemplate utilizing the communicative connections between a telematics service provider (TSP), a communication device, and a telematics unit in a vehicle parked in a multilevel parking garage to determine location information of the vehicle and to provide such information to a subscriber of the TSP. A subscriber of a TSP may transmit a request for information pertaining to the location of a vehicle parked within a multilevel parking structure from a communication device. Upon the receipt of such a request, the TSP provides the information requested by the subscriber. In various implementations, the providing of such information by the TSP may involve querying the telematics unit in the vehicle or querying a database storing location information pertaining to one or more vehicles and may further involve performing calculations to derive the information requested by the communication device. In some implementations, the information requested by the communication device includes but is not limited to a floor number, or level, of the parking garage on which the telematics-equipped vehicle is parked.
A straight-traveling/turning determination device includes a straight-traveling/turning determiner that determines whether a motorcycle is traveling straight or turning by comparison between a threshold and a rotary speed comparison value that is a value resulting from comparison between the rotary speed of a front wheel and the rotary speed of a rear wheel. The straight-traveling/turning determiner uses the rotary speed comparison value in the state in which the vehicle speed is equal to or lower than first predetermined speed and an absolute value of the vehicle acceleration is equal to or lower than predetermined acceleration and a turn signal is not being actuated as a straight-traveling rotary speed comparison value, and determines that the motorcycle is turning if a ratio or difference between the rotary speed comparison value and the straight-traveling rotary speed comparison value becomes larger than a threshold.
A steering angle sensor 17 is provided which can minimize a detection error even when a steering shaft 6 is inclined. In an annular clearance t1 defined between the steering shaft 6 and an inner cylindrical wall of a first gear 24, there is compressed an elastic O-ring 23. Due to provision of the elastic O-ring 23, inclination of the steering shaft 6, which tends to occur during handling of a steering wheel 1, is suitably absorbed by the elastic O-ring 23, and thus, generation of detection error caused by inclination of the first gear 24, which would follow the inclination of the steering shaft 6, is suppressed or at least minimized.
Strain sensing may be provided. First, a strain threshold for a circuit board may be determined. Then a strain capacitor may be selected that will fail when the circuit board is subjected to the strain threshold while the strain capacitor is mounted on the circuit board. The strain capacitor may be ceramic and may be in a commercially available size. The strain capacitor may then be mounted to the circuit board and monitored for failure.
A sensor assembly includes a carbon nanotube bundle and a controller. The carbon nanotube bundle is integrated into a host material and extends along a predetermined dimension of the host material. The controller is configured to control transmission of radio frequency energy through the carbon nanotube bundle to determine a round trip time between transmission and reception of the radio frequency energy at a proximal end of the carbon nanotube bundle responsive to reflection of the radio frequency energy at a distal end of the carbon nanotube bundle.
The device is a self-contained-defense-system. The entire unit is housed inside a blended set of athletic gloves and emits an electrical charge against an unwanted attacker. It can be utilized by men or women, both young and old, for personal safety. The electrical charge emitted is not strong enough to kill, but the voltage can be increased in order to assist the military and the police.
The disclosed embodiments describe a cost and energy efficient combined lighting and air conditioning fixture. This combined system may employ a flexible distributed air handler that can employ distributed heat exchangers to a liquid loop. The described system may be comprised of distributed dampers, heat exchangers, and air handlers that are controlled from a controller integrated into a ceiling, floor, or wall unit. The controller may also be part of a combined LED lighting drop-in ceiling fixture.
Embodiments of the present invention comprise systems and methods that clear (e.g., break-up, remove, or the like) the solidified slag (e.g., slag that is solidifying or has at least partially solidified) from the furnace, such as from the slag door as molten slag is removed from the furnace. The systems and methods of the present invention comprise utilizing an arm that is extendable and retractable into and out of a position for accessing an opening in a slag door. The system has a ram that extends and retracts, and may move in horizontal and vertical directions, to clear solidified slag from the slag door opening and other areas within a furnace. The systems and methods of the present invention provide for clearing of solidified slag from the furnace without putting workers in a dangerous environment and without the need for expensive retrofitting of the furnace or furnace deck.
An arrangement of insulation within a container to prevent heat leakage from the ambient to an apparatus located within the container that operates at a cryogenic temperature. The arrangement of insulation includes bulk insulation filling the container and an insulation layer that is located within the container, between the apparatus and the container. The insulation layer as opposed to the bulk insulation has a lower thermal conductivity. An exterior region of the apparatus is situated closer to an opposite container wall region of the container than remaining exterior regions of the apparatus. The insulation layer is sized to only insulate the exterior region of the apparatus from heat leakage from the opposite container wall region. The insulation layer can be formed of an aerogel.
A refrigeration system includes a normal refrigerant path arranged between a condenser and an evaporator, and an assist refrigerant path arranged between the condenser and the evaporator, wherein the assist refrigerant path is activated during low ambient conditions. The assist refrigerant path may include a solenoid valve and an expansion valve arranged between the condenser and the evaporator. The assist refrigerant path may be adapted to regulate the evaporator temperature.
In accordance with various embodiments, a mirror structure is provided having a first face sheet having a mirror surface and a side opposite the mirror surface and a three-dimensional ordered cellular microtruss connected with the side opposite the mirror surface of the first face sheet.
The present invention provides an LED bulb and a lamp head structure hereof. The lamp head structure includes an insulating seat, a first conducting plate, a second conducting plate and a conducting piece. The insulating seat has a first accommodating space and a second accommodating space separately arranged and an opening slot communicating with the second accommodating space. The first conducting plate is accommodated in the first accommodating space. One end of the conducting piece inserted in the first conducting plate is electrically conducted with each other, and the other end is protruded out of the insulating seat. The insulating seats could be provided for different types of LED bulb. Thus the development time will be shortened, and the production cost will be reduced.
Provided is a lighting device, comprising: a light source module comprising: at least one light source disposed on a printed circuit board; and a resin layer disposed on the printed circuit board so that the light source is embedded; a light reflection member formed on at least any one of one side surface and another side surface of the resin layer; and a diffusion plate having an upper surface formed on the light source module, and a side wall which is integrally formed with the upper surface and formed to extend in a lower side direction and which is adhered onto the light reflection member, wherein a first separated space is formed between the light source module and the upper surface of the diffusion plate, whereby flexibility of the product itself can be secured, and durability and reliability of the product can be also improved.
Embodiments of the invention provide a display. The display comprises a display screen, a frame surrounding the display screen from side portions of the display screen, a backlight module provided on a backside of display screen, and a rear cover covering side portions and a backside of the backlight module. The display further comprises a fastener, the fastener comprises a connecting part and a mating part, the mating part is connected to the backside of the display screen, the connecting part passes through the rear cover, the backlight module and the frame and then engages with the mating part to connect and fix the display screen, the frame, the backlight module and the rear cover together.
A light diffuser having a holder device and an inflatable, at least partially light-transmissive box that can be attached to the holder device. The holder device includes an adapter ring formed by a light-transmissive disc, in particular a glass disc, for fastening to a spotlight and for connecting the inflatable box in a substantially airtight manner. The end of the inflatable box can be connected to the adapter ring which is surrounded by an airtight fastening ring that can be tensioned against a radially extending sealing surface on the adapter ring by at least three quick-closures, distributed about the circumference.
A headlamp assembly includes a headlamp housing, a lens affixed to the housing, thereby defining an interior space of the assembly, and a reflector defining an aperture and arranged within the interior space. The assembly also includes a retention bracket mounted to the reflector and a first seal attached to the bracket for keeping moisture from the interior space. The assembly also includes an adapter element that can be fastened or unfastened at the bracket, and a second seal arranged between the adapter and the bracket for keeping moisture from an interface between the bracket and the adapter. The assembly additionally includes a light bulb mounted to the adapter and extending through the aperture toward the lens, and a connector establishing an electrical connection with the bulb. Furthermore, the assembly includes a third seal arranged between the connector and the adapter and configured to keep moisture from the electrical connection.
A modular light emitting diode (LED) space light including a top plate including a top plate slot; a bottom plate including a bottom plate slot; at least one module having at least one light emitting diode (LED), wherein the at least one module is adapted to fit between the top plate and the bottom plate correspondingly in the top plate slot and the bottom plate slot; and at least one passive heat sink coupled to the at least one module to dissipate heat generated by the at least one LED.
A security gate has two walls defining between them a passage through which an individual passes, for each wall, a transparent lighting window extending over at least part of the wall, for at least one of the edges of the lighting window, a light source intended to light the edge and to generate light beams that propagate through the thickness of the lighting window, and for each lighting window, at least one extraction zone provided on the lighting window and intended to transmit the light beams towards the face of the individual passing through the passage, the light beams thus transmitted forming, with respect to the plane of the lighting window from which they emanate, an angle adapted to the geometry of the security gate so as to optimize the lighting of the individual.
An LED clip light assembly includes a battery, an electrically conductive clip member operatively associated with the battery, and at least one LED connected with the clip member.
A lighting device includes a tray-like housing with a base wall, at least one light radiation source on the base wall of the housing, having electrical contact pads in an opposite position from the base wall of the housing, and a circuit board on the base wall of the housing with electrically conductive lines extending on the face of the board opposite from the base wall of the housing, with respective electrical contact pads placed in positions facing the electrical contact pads of the light radiation source. At least one optical element is provided, with a light input to collect light radiation at the light radiation source and one or more light outputs to project light radiation from the lighting device. The optical element has an electrically non-conductive base wall which urges the light radiation source or sources and the circuit board toward the base wall of the housing.
A method for operating a pneumatic lumbar support between a deflated position and an inflated position. The method includes inflating a bladder of the pneumatic lumbar support; sensing a pressure within the bladder using a pressure sensor; producing an inflation output signal from the pressure sensor, wherein the inflation output signal is a function of time; and converting the inflation output signal using an inflation-deflation transfer function.
Provided is a compressed natural gas (CNG) fuel system comprising a frame, a first container, a second container, a first manifold, a second manifold, and a casing. The frame may have: a first side; a first connecting member; and a second side. The first container may be configured to house or contain CNG and be engaged to and substantially shrouded by the first side of the frame. The second container may be configured to house or contain CNG and be engaged to and substantially shrouded by the second side of the frame. The first manifold may be engaged to and substantially shrouded by the first side of the frame. The second manifold may be engaged to and substantially shrouded by the second side of the frame. The casing may at least partially surround the frame, the first container, the first manifold, and the second manifold.
A tubular passage for poured concrete decks has an intumescent tube held in a two-part, clamshell base by a bottom clip. A first tube engages the base's top to clamp a funnel shaped, diaphragm seal to the base. The first tube has spaced, radially extending, parallel ridges at predetermined distances from the base. Longitudinal channels separate the ridges. An extension tube has inward extending lugs passing along the channels to engage various ridges when rotated to fix the passage length. The extension engages the base bottom for corrugated deck supports. A cap with repositionable, locating filaments closes either tube.
A vacuum valve includes a valve housing with first and second valve openings, which have parallel axes, a first and a second valve plate, adjustable between an open position, an intermediate position and a closed position, and a carrying unit, which carries the valve plates between the intermediate position, in which the valve plates cover over the respective valve openings, but are raised up from the valve seat, and the closed position, and each include a cylinder, having at least one cylinder space, and at least one piston, arranged in the cylinder space and has a piston rod, connected to one of the valve plates. The carrying unit has at least first and second carrier rods, to which the cylinders of the drive elements are connected. The cylinders each span an interspace located between the carrier rods, arranged on opposite sides laterally alongside the piston rods of the drive elements.
A kinetically unyielding, statically compliant (KUSC) positive return valve action. In one embodiment, a guide is pivotally mounted and rotationally abuts a limiting bench. A pin mounted slidably on the guide is linked to a poppet valve, a driver positioning the pin along the guide. With the valve seated and the driver overtraveled a deflection opens up between the guide and the limiting bench that resolves the overtravel, which deflection is opposed by a forcing spring. As the valve is initially lifted, valve-lift kinetic force is buttressed against the guide mount and the limiting bench, neither of which yields. With increasing lift the pin position passes the guide mount axis to be cantilevered on the guide at maximal valve lift against valve-return kinetic force: this also is unyieldingly buttressed. The action is adjusted by positioning the limiting bench either manually or by hydraulic lash adjuster.
An isolation manifold includes a manifold body, a process connection at a first end of the manifold body, a pressure transmitter connection at a second end of the manifold body, a passageway through the manifold body, an isolation valve, and a pressure limiting device. The process connection is for fluidly connecting the isolation manifold to a process vessel or conduit containing a process fluid. The pressure transmitter connection is for fluidly connecting the isolation manifold to a pressure transmitter. The passageway fluidly connects the process connection to the pressure transmitter connection. The isolation valve is operable to selectively block the passageway to isolate the process connection from the pressure transmitter connection. The pressure limiting device fluidly connects to the passageway between the isolation valve and the pressure transmitter connection. The manifold may preferably include a pressure snubber within the passageway to increase the flow impedance of the passageway.
A valve assembly includes a valve seat having a valve opening therein. A valve plate is configured to sealingly engage the valve seat in a closed position for closing the valve opening to thereby close a fluid path through the valve assembly, the valve plate being biased toward the closed position by a first spring. An actuator plate can include an inlet opening therein, the actuator plate being biased in a direction away from the valve plate by a second spring. A member includes a first end fixed to the actuator plate, an interior passage in communication with the inlet opening in the actuator plate, and a second end engageable with the valve plate when a portion of the member passes through the valve opening of the valve seat, wherein the valve plate is configured to open in response to direct fluid pressure when fluid is guided to the valve plate by the member or when fluid pressure on the actuator plate is transmitted to the valve plate via the member.
An elongated, flexible polymer gasket includes a body formed by a length of tubular flexible polymer material, a hollow chamber within the body extending uniformly the length of the body, and a plurality of individual openings spaced apart from one another along the length of the body. The gasket further includes a plurality of individual spring clip fasteners, each formed of a metal wire, the length of wire being bent to form an elongated, generally planar base portion with opposing major sides and an elongated, engagement portion extending transversely away from one of the opposing major sides. The maximum width dimensions of the base and engagement portions being greater than a maximum nominal dimension of the opening whereby the each individual spring clip member is captured in a separate one of the openings with the base portion within the hollow chamber and the engagement portion projecting traversely away from the base portion and the body.
A vehicle includes an engine and transmission having gear sets, an input member that is continuously connected to the engine and a gear set, a binary clutch assembly, a speed sensor, and a controller. The binary clutch assembly includes a freewheeling element holding torque in one rotational direction, and also a selectable one-way clutch (SOWC) portion holding torque in two rotational directions when applied. The controller executes a method to transmit a first binary clutch command to the binary clutch assembly and thus apply the SOWC portion at vehicle launch, and calculates, via the processor, an acceleration value of the vehicle using the measured speed. The controller also selects a shift apply point of the binary clutch assembly as a function of the calculated acceleration value, and transmits a second binary clutch command to the binary clutch assembly to release the SOWC portion at the selected shift apply point.
A power transmission device that transmits power from a motor to a wheel via a hydraulically driven friction engagement element and that includes a mechanical pump driven by the motor to produce a hydraulic pressure that is regulated by a pressure regulating valve; an electric pump that produces a hydraulic pressure; a switching mechanism that either switches an output pressure of the regulating valve or an output pressure of the electric pump to a servo of the engagement element based upon a signal pressure; a passage to supply pressure from the mechanical pump to the hydraulic servo; a check valve in the passage that allows supply of the pressure from the mechanical pump to the hydraulic servo and prohibits supply of the pressure from the electric pump to the mechanical pump, and the switching mechanism either shuts off or allows communication through the passage based upon the signal pressure.
A planet wheel carrier which includes first and second end-sections for supporting shafts of planet wheels of a planetary gear, the planet wheel carrier containing a support structure connected to the first and second end-sections and located between the first and second end-sections in the axial direction of the planet wheels and between the planet wheels in the circumferential direction of the planet wheel carrier. The first end-section is attached to the support structure so that at least part of the first end-section is non-destructively detachable from the support structure. This feature facilitates the maintenance of the planetary gear because, after removing the first end-section or its detachable part, the planet wheels can be removed and installed substantially easier than in cases where there is a traditional one-piece planet wheel carrier.
A knob body is provided for a control lever. The knob body includes a lower segment, and an upper segment. The lower segment extends out from a vertical axis of the control lever and includes a pair of upright protrusions extending out from an upper portion thereof. The protrusions define a gap therebetween. The lower segment further includes a movable switch located within the gap. The lower segment further includes a first actuation switch disposed on a sidewall of the lower segment. The upper segment is disposed about the vertical axis and is located proximate to the upper portion of the lower segment. The upper segment is in a spaced relationship relative to the protrusions. The upper segment includes a locking switch that is operable to allow selective movement of the control lever, and a second actuation switch that is provided on a sidewall of the upper segment.
A method for performing a shuttle shift with a continuously variable transmission of a work machine is disclosed. The method may generally include adjusting a swash plate angle of a hydrostatic power unit of the transmission in a first direction to reduce a travel speed of the work machine in an off-going direction, initiating a directional swap between an off-going directional clutch of the continuously variable transmission and an on-coming directional clutch of the continuously variable transmission while the work machine is traveling in the off-going direction and adjusting the swash plate angle of the hydrostatic unit in a second direction after the initiation of the directional swap to reduce slippage across the on-coming directional clutch, wherein the second direction is opposite the first direction.
An actuator system having a controlled element configured for rotary movement about a first axis relative to a reference structure; a linkage system between the element and reference structure; a first actuator and a second actuator configured to power a first degree of freedom and an independent second degree of freedom of the linkage system, respectively; the linkage system having a first link configured for rotary movement about a second axis not coincident to the first axis and second link configured for rotary movement about a third axis; the linkage system configured such that a first angle of rotation may be driven independently of a second angle of rotation between said first link and said reference structure; wherein one of the first or second actuators is configured and arranged to drive rotation of the element about the first axis when the other is operatively locked.
In the transmission of mechanical movements, a mechanical angular positioning device is provided, and applies to optical instruments to position an element like a mirror according to three predefined positions. The angular positioning device comprises a frame and two imbricated mechanical movement transmission assemblies. The first assembly comprises a first support in pivot connection with the frame according to a first axis, which is rotatable by a first motor via two connecting rods which generate two dead centers for the first support. The second mechanical assembly comprises a second support in pivot connection with the first support, according to a second axis, not parallel with first axis. This second support is rotatable by a second motor via two connecting rods which generate two dead centers for the second support. One of the dead centers of the first support can coincide with one of the dead centers of the second support.
A damper device comprises: a first shaft that outputs rotational power from a power source; a second shaft that transmits rotational power to a gear mechanism and has outer splines; a first rotational member(s) to which the rotational power of the first shaft is transmitted; a second rotational member spline-engaged with the outer splines; a damper unit that absorbs torque fluctuation between the first and second rotational members; and an inertial body having inner splines spline-engaged with the outer splines and having an annular portion. The tooth parts of the inner splines are pressed into contact with the tooth parts of the outer splines in the circumferential direction of the inertial body.
A hydraulic mount includes: a container in which a high-viscosity fluid is liquid-tightly sealed; a rubber mount that is provided on an upper side of the container; a rod that slidably penetrates through the rubber mount; a damper plate that is provided to an end of the rod; a damping force generator that is provided by a clearance between the container and the damper plate; a main fluid chamber that includes an upper fluid chamber and a lower fluid chamber provided by dividing an interior of the container by the damper plate; a volume-variable secondary fluid chamber that communicates with the main fluid chamber; and a pressurizer that generates a differential pressure between the upper fluid chamber and the lower fluid chamber during the movement of the rod.
A valve assembly of a shock absorber can achieve both an effect of varying an attenuation force according to a frequency region of vibration or shock transferred to the shock absorber during the driving of an automobile and an effect of varying an attenuation force according to an additional pressure and can increase the attenuation force in response to an instantaneous input of a large amplitude behavior. The valve assembly includes: a valve housing coupled to a piston rod having an orifice hole and a space formed therein, the space having an open lower end to communicate with the orifice hole; a frequency sensitive valve unit including a free piston configured to vertically partition the space; and a sub-valve unit coupled to the lower end of the space, wherein operation of the sub-valve unit is controlled by ascending and descending of the free piston.
A structural part dissipates energy delivered during an impact that compresses the part along an axis Z, including a web having two opposite surfaces. The part includes: a through-window extending between the opposite surfaces of the web, dividing the web into a first portion and a second portion respectively, arranged in series along the Z axis; and an energy-dissipation device, including a cutting element arranged within the window and able to cut at least one of the portions of the web into strips as a result of a compressive force exerted on the part along the Z axis, and an element for clearing away the strips thus formed.
A rotation transmission device includes coaxial input and output shafts (1 and 2), a pair of opposed bevel gears (3 and 4) rotatably mounted around the input shaft (1), and an intermediate bevel gear (5) meshing with the opposed bevel gears (3 and 4). The output shaft (2) and one of the opposed bevel gears (3) are rotationally fixed to each other. A first one-way clutch (6) is provided through which the rotation of the input shaft (1) is transmitted to the one of the opposed bevel gears (3). A second one-way clutch (7) is provided through which the rotation of the input shaft (1) in the reverse direction is transmitted to the other of the opposed bevel gears (4). Thus, the output shaft (2) can be rotated in the normal direction irrespective of whether the input shaft (1) is rotated in the normal direction or in the reverse direction.
The present invention discloses a planar torsion spring for a robot joint, including a torsion spring outer ring, a torsion spring inner ring and a plurality of elastic bodies; the elastic bodies are uniformly distributed around the circumference and connected with the torsion spring outer ring and the torsion spring inner ring respectively at their two ends; each elastic body is composed of two symmetrical elastic body units, each elastic body unit includes an outer circular hole slot, an inner circular hole slot and a connecting beam; the connecting beam connects respectively between the torsion spring inner ring and the inner circular hole slot, the inner circular hole slot and the outer circular hole slot, the outer circular hole slot and the torsion spring outer ring; a wide-angle deformation of the torsion spring is achieved through a series of elastic deformation of the inner and outer circular hole slot.
A constant velocity joint includes a constant velocity joint housing with guide grooves on the inner side of the housing, a spider disposed in the constant velocity joint housing, combined with a shaft, and having a spider journal, and spherical rollers disposed in the guide grooves of the constant velocity joint housing. Needle bearings are disposed between the spherical rollers and the spider journals, in which a plurality of needle bearing insert holes is formed in the spherical rollers, and disposed in the needle bearing insert holes.
A rotor coupling (10) including a first member (12) rotatable about a first axis of rotation (14) and a second member (16), engageable with the first member, and rotatable about a second axis of rotation (18). The rotor coupling (10) further includes at least one torque pin (24) for transmitting torque between the first and second members such that the first and second axes of rotation are allowed to respectively angularly vary during rotation of the rotor coupling.
A torque limiter in which grease passages are provided to enable better lubrication of the wearing components. A disconnect nut is also provided to readily enable release of the torque limiter even for very high release sellings to afford greasing as a part of a maintenance regimen.
A flanged bearing ring is formed of two different materials joined together as a single piece, specifically a radially inner annular insert and a flanged, radially outer lightweight body formed about the insert. The insert has one or more inner raceways and is formed of a hard material, such as bearing steel. The outer body is made of a lightweight material, such as aluminum alloy, with a higher thermal expansion coefficient higher than that of the hard material from which the inner insert is formed. A radial projection formed on the outer body extends into a radial recess or groove of the insert. The projection and the recess interlock the insert and the outer body so as to prevent relative movement.
A screw has a generally flat washer-like head. On an underside of the head are a plurality of cutters or cutting wedges arranged circumferentially around the shank of the screw. The cutters cut or carve off material when the screw is inserted into a fibrous material like wood to thereby facilitate countersinking of the screw head. The cutters may be triangular or quadrilateral wedges. One or more pockets are disposed radially inwardly of the cutters for receiving fibrous material to help lock the screw in place, i.e. to prevent the screw from loosening over time. These pockets may circularly shaped pockets disposed circumferentially around the shank. Alternatively, a single annular pocket may be provided around the shank.
A mechanical joint that resists any direction of imposed force and can be connected in set rotational increments is comprised of three elements: a plug attached to the male-side of the joint, and a receptacle and a tabbed ring attached to the female-side side of the joint. The male-side and female-side are connected by sliding the plug into the receptacle and rotating the tabbed ring a partial turn. Reversing the connecting steps separates the joint.
A clip for assembling corners of hollow members such as the rails and stiles of an extruded aluminum door. The clip has an L shape and may feature a double L shape. A portion inserts into the hollow of a first member and is attached thereto. Another portion extends into the other hollow member for attachment thereto to form a sturdy joint without welding. Pairs of clips may be used at each corner.
The present invention applies to a vacuum transfer system, and relates to an air control valve for controlling the supply of compressed air in a vacuum transfer system. More specially, the air control valve of the present invention is configured to execute a two-stage control. The two-stage control is realized by a piston operation method, in which, although the control is performed by compressed air supplied thereto, a first control unit is operated by an electronic control method, and a second control unit is operated by a pneumatic control method. In particular, the second control unit is operated by vacuum pressure supplied from the vacuum transfer system. The air control valve of this invention can realize improved operational stability, improved energy efficiency and improved operational precision.
A compact variable pitch fan has a drive fluid pitch change mechanism. A pitch change piston is constrained to follow reciprocating motion under drive fluid control within a peripheral hub from which fan blades extend outward. A pitch change sensor is mounted with the rotary union.
Embodiments of the invention provide an impeller and a method of producing the impeller. The impeller includes a first molded piece coupled to a second molded piece. The first molded piece includes impeller vanes, a motor hub, a nose, and an eye. The second molded piece includes a cover and a hole through the cover. The cover is coupled to the impeller vanes around the motor hub so that the motor hub extends through the hole.
A blower assembly for use in a vehicle is disclosed, wherein the blower assembly includes a housing and a fan wheel disposed in the housing. A scroll duct formed in the housing axially and radially expands from a scroll cutoff towards an air outlet. The fan wheel includes a hub, concentrically arranged inner and outer annular rings, and an array of spaced apart blades extending between the hub and the annular rings.
The invention relates to improvements in compressors and, in particular, to improvements in a method of controlling centrifugal compressors to maximize their efficacy. The compressor has an impeller mounted on a shaft supported by an active magnetic bearing unit and is driven by a variable speed motor at a rotational speed under normal on-load conditions at a calculated pre-surge speed for the required delivery pressure. The actual rotational speed and delivery pressure of the compressor is repeatedly measured and recorded at high frequency. The compressor is allowed to surge periodically after a preset re-calibration time and the compressor is put into a surge recovery cycle when surge is detected, during which the compressor is off-loaded and the rotational speed reduced. The compressor pre-surge speed line is recalibrated during the surge recovery cycle for the current operating conditions and reloads the compressor when the shaft speed reaches the greater of the recalibrated presurge speed line or the load speed.
Cooling apparatuses, electronic device assemblies, and cooling assemblies having a magnetic shape memory member are disclosed. In one embodiment, a cooling apparatus includes a first compliant member, a magnetic shape memory member, a magnetic field generating device, a second compliant member and a fan member. A first end of the magnetic shape memory member is coupled to the first compliant member. The magnetic field generating device is positioned proximate the magnetic shape memory member, and generates a magnetic field toward the magnetic shape memory member to cause the magnetic shape memory member to expand along a linear translation axis. Expansion of the magnetic shape memory member causes an actuated portion of the second compliant member to translate about an axis. The fan member is coupled to the actuated portion of the compliant member such that translation of the actuated portion translates the fan member.
A screw compressor includes a screw rotor, a casing and an economizer circuit. The screw rotor has a plurality of helical grooves forming a compression chamber. The casing has a cylinder portion with the screw rotor inserted in the cylinder portion. The economizer circuit ejects configured to eject intermediate pressure refrigerant into a compression chamber in the course of compression. The economizer circuit includes a branch passage configured to branch the intermediate pressure refrigerant from a portion of a refrigerant circuit, a resonance space connected to a downstream side of the branch passage to retain the intermediate pressure refrigerant, and a resonance passage having an end communicating with an interior of the compression chamber and an other end communicating with an interior of the resonance space. The refrigerant circuit circulates refrigerant and performs a refrigeration cycle.
A planetary transmission of a wind turbine includes a ring gear which has an internal toothing and at least one planetary gear which has an external toothing that meshes with the internal toothing of the ring gear. The planetary gear is rotatably supported on an axle by a bearing assembly. The bearing assembly includes at least one outer ring having a radially-outwardly-protruding radial projection and at least one set of rolling elements that roll on the outer ring. The planetary gear has a bore and a recess in the region of an axial end, which recess widens the bore. The outer ring is disposed in the bore of the planetary gear such that the radial projection of the outer ring engages into the recess of the planetary gear.
A lubrication system for a fluid turbine is provided. The system includes a supply subsystem for providing oil via an oil tank or a hydraulic accumulator to a gearbox of the fluid turbine for lubrication during at least one of idling or loss of electric grid. The system also includes a control subsystem for controlling the flow in the lubrication system.
The invention concerns a fluid rotary machine (1) with a housing (2), a shaft (3) projecting from the housing (2), and being rotatable around an axis (4) and forming part of a movement chain, and a sensor arrangement (10) comprising a transmitter (12) and a receiver (15). It is endeavored to find a simple solution for detecting the rotation of the shaft with a relatively high accuracy. For this purpose, a channel (21) is provided in the movement chain, and the transmitter (12) is connected to a transfer element (19) transferring a torque that is led through said channel (21) to a section of the movement chain that is farther away from the transmitter (12) than a transmitter-side end of the movement chain.
A pitch drive device capable of emergency operation by adjusting the rotor blade pitch of a wind or water power plant. The pitch drive device includes an inverter device and a three-phase current drive motor preferably a three-phase IPM synchronous motor. A direct current power storage device can be substantially directly connected to an intermediate direct current circuit, at least for emergency operation, between a rectifier device and the inverter device for at least briefly supplying power to the synchronous motor, so that the IPM synchronous motor can be operated under speed control when the intermediate circuit voltage UZK is falling. The device enables speed-controlled emergency operation of the pitch drive device at high torque when an intermediate circuit voltage UZK is falling in emergency operation, wherein the direct current energy storage device can, improve the efficiency as an energy buffer, and reduce current transfer via the rotor slip ring.
In a start control apparatus for an engine generator having a booster adapted to boost an output of a battery, there is provided an engine starter adapted to supply the boosted battery output to an output winding as a motor current to start the engine, and it is configured to determine whether a position of the piston is before a top dead center (TDC) when the motor current is to be supplied to the winding, and the motor current is increased by an increment when the piston position of the engine is determined to be before the TDC.
An evaporated fuel purge device integrally includes a main passage, a fuel inlet passage, a fuel outlet passage, an ejector, an air inlet passage, and an air outlet passage. Evaporated fuel flows into the main passage through the fuel inlet passage, and flow out of the main passage through the fuel outlet passage. Intake air flows into the ejector from a downstream of a turbocharger through the air inlet passage, and flows out of the ejector to an upstream of the turbocharger through the air outlet passage. At least three of the fuel inlet passage, the fuel outlet passage, the air inlet passage, and the air outlet passage are arranged to extend parallel with each other.
Propulsion systems and method for making a propulsion system include additively manufacturing a casing body into a single-piece structure having no bonded or bolted joints. The casing body defines a combustion chamber therein and is at least partially composed of a material useful as a solid rocket fuel and capable of being consumed during combustion. Other embodiments are also described.
A method is provided for operating an injection system of a motor vehicle, which injection system is designed as an adjusting system having volumetric flow rate control via a normally open inlet valve. If a fault of the inlet valve leading to undesired closing of the inlet valve is detected, the inlet valve is closed already during the suction phase of the high-pressure pump by applying current and is opened again during a part of the suction phase corresponding to a pumping demand in order to thereby control or at least reduce the flow rate of the high-pressure pump. Thus, corresponding safety measures, such as a pressure-limiting valve in the high-pressure region, can be omitted.
An injection nozzle has a nozzle needle that suppresses metering of fluid in a closed position and otherwise allows the metering of fluid. Furthermore, the injection valve has a solid-state actuator that acts on the nozzle needle. A first operating phase is performed for a closing operation in a first operating mode, during which first operating phase the solid-state actuator is discharged to a predefined part charge. Furthermore, a second operating phase is performed, during which the solid-state actuator is operated as a sensor. An operating duration of the second operating phase is predefined such that the closed position of the nozzle needle is reached during the operating duration. A third operating phase is performed, during which the solid-state actuator is discharged further to a predefined reference state. In a second operating mode, the first and second operating phases are carried out and the third operating phase is omitted.
A system according to the principles of the present disclosure includes a pump control module, an actuator control module, and a torque reserve module. The pump control module switches a water pump between on and off. The water pump circulates coolant through an engine when the water pump is on. The actuator control module controls a first actuator of the engine based on a first torque request and that controls a second actuator of the engine based on a second torque request. The torque reserve module adjusts a torque reserve before the water pump is switched on or off based on a change in engine load expected when the water pump is switched on or off. The torque reserve is a difference between the first torque request and the second torque request.
A valve assembly for an engine, the valve assembly can include a housing; an in-flow port configured for connection with a drain line; a first out-flow port configured for connection with a fuel line; a second out-flow port configured for connection with a disposal line; and a passageway that is rotatable with a handle, the passageway being operable to redirect a flow of a fluid between the fuel line and the disposal line. The handle is configured to impede an attachment of the fluid source to a water wash connection when the passageway is in a position to direct the flow of the fluid from the drain line to the fuel line.
A valve device for an internal combustion engine includes a drive unit. A drive housing in which the drive unit is arranged. A valve unit is configured to be moved by the drive unit. The valve unit comprises a valve rod and a valve closure member. A flow housing comprises a fluid inlet channel and a fluid outlet channel. A connection cross section of the fluid inlet channel and the fluid outlet channel is configured to be controlled by the valve closure member. A pressure detection chamber is fluidically connected with the fluid inlet channel. A pressure sensor is arranged in the pressure detection chamber and is integrated in the drive housing. The pressure sensor comprises a pressure detection surface arranged in a plane. A normal of the pressure detection surface is arranged so as to be perpendicular to a direction of a fluid flow into the pressure detection chamber.
A diesel particulate filter (“DPF”) system that suppresses clogging of a DPF and enhances convenience including accumulated particulate matter (“PM”) quantity estimator for estimating an accumulated PM quantity in an idle state; and a long low idle forced regeneration unit 5 that if the accumulated PM quantity estimated by the accumulated PM quantity estimation estimator exceeds a predetermined quantity, performs long low idle forced regeneration that automatically performs regeneration of the DPF, and the long low idle forced regeneration unit, when a vehicle starts moving during long low idle forced regeneration, performs automatic regeneration of the diesel particulate filter while the vehicle is moving.
A system includes a gas turbine enclosure. The system also includes a gas turbine engine disposed in the gas turbine enclosure, wherein the gas turbine engine is configured to output an exhaust flow. The system further includes an exhaust driven eductor configured to draw an air flow through and out of the gas turbine engine enclosure using the exhaust flow. The system yet further includes an exhaust stack coupled to the gas turbine enclosure, wherein the exhaust stack is configured to output a mixed flow of the exhaust flow and the air flow. The system still further includes a diffuser plate disposed within the exhaust stack, wherein the diffuser plate is configured to provide a homogenous flow distribution for the mixed flow downstream of the diffuser plate.
This gas turbine includes a turbine cooling structure of cooling a turbine by using cooling air and a filter that reduces dust in the cooling air on an upstream side of the turbine. Furthermore, the gas turbine includes a supply pipe for supplying the cooling air to the filter, a branch pipe that is branched from the supply pipe on an upstream of the filter, and a unit that calculates or estimates a circulation amount of dust in the cooling air. In this gas turbine, at a time of start-up of a turbine, the supply pipe is closed and the branch pipe is opened, and when the circulation amount of dust in the cooling air becomes equal to or less than a predetermined threshold, the supply pipe is opened and the branch pipe is closed.
Coated articles adapted to be subjected to direct and sustained mechanical contact are provided. The coated articles include a ceramic matrix composite (CMC) substrate. A solid coating is disposed directly on and adheres to the substrate during such direct and sustained mechanical contact. The solid coating is formed from a precursor comprising a liquid binder, which may be sodium silicate, a basic colloidal alumina solution, aluminum hydroxide, aluminum oxychloride, aluminum hydroxylchloride, aluminum phosphate, and phosphoric acid. The coating may also include a filler material such as solid powder, chopped fibers, and combinations thereof.Methods for improving the wear resistance of an article made from the CMC substrates are also provided. A CMC substrate is provided and covered with a slurry. The slurry includes the liquid binder and optionally, the filler material. The slurry is consolidated, for example, by annealing to form a wear-resistant solid coating on the article.
The invention relates to the use of layer structures in the production of rotor blades for wind power plants, and to rotor blades for wind power plants.
A turbine blade includes: a base portion fixed to a rotor; a platform that is fixed to the base portion and includes a cooling flow channel; a blade shape portion that extends from the platform to an outer side in a radial direction; and a fillet portion provided in a joint surface between the blade shape portion and the platform, and the turbine blade further includes: a main pipe that is branched off from the cooling flow channel and has an opening at a side end portion of the platform; and a branch pipe that is branched off from the main pipe, extends along the fillet portion so as to be close thereto on an inner side in the radial direction, and includes a film cooling hole opened on a surface of the platform.
A rotary vane type actuator includes a vane assembly for converting pressure from a pressurized medium within the actuator into rotational movement. The vane assembly has a rotatable vane and a vane seal for preventing leakage of pressurized medium through or around the vane assembly. A side-plate is attached to the rotatable vane and the side-plate has a limiting protrusion that abuts the vane to maintain a gap between the vane and the side-plate so that the seal in the gap is not extruded from between the vane and side-plate.
The present invention relates to a rib (1) for supporting and reinforcing an excavation. The invention also relates to a structure and to a method for supporting and reinforcing an excavation. The rib (1) according to the invention comprises at least a structural element (5A) provided with a tubular body (6), preferably with a circular cross section, which defines an inner cavity (9A) adapted to be completely filled with concrete after installation of the rib. The structural element is provided with a filling device (7) operatively couplable to concrete injection means.
A formation tester seal pad includes a support member and a deformable seal pad element including an outer sealing surface having a plurality of raised portions and adjacent spaces. In some embodiments, the raised portions are deformable into the adjacent spaces in response to a compressive load on the outer sealing surface. In some embodiments, the support member includes an inner raised edge and an outer raised edge to capture the deformable seal pad element. In some embodiments, a deformable seal pad element includes a volume of seal pad material above a support member outer profile and a volume of space below the outer profile. In some embodiments, the space volume receives a portion of the seal pad volume in response to a compressive load.
A system and method for sampling formation fluids is described. The system include a fluid sampling tool (200) with an elongated tool body (201). A cache of fluid containers may be disposed within the tool body. Each of the fluid containers within the cache of fluid containers may be individually deployable from the fluid sampling tool while the fluid sampling tool is positioned within a borehole. The fluid sampling tool may also include a pump in fluid communication with the cache of fluid containers.
A sensing system comprises at least one gauge disposed in a wellbore, a sensing link coupled to the at least one gauge, and a debris barrier coupled to the sensing link. The debris barrier comprises a housing coupled to the sensing link, and a barrier element configured to reduce the transport of particulates from the wellbore into the sensing link.
A well cellar high fluid level alarm includes a control box providing a water-tight enclosure and a alarm control circuitry disposed within the control box. An audible alarm indicator is operably connected to the alarm control circuitry. A visual alarm indicator is operably connected to the alarm control circuitry. A float switch is operably connected to the alarm control circuitry. An electrical power cable is operably connected to the control circuitry and provides electrical power thereto. A control switch is operably connected to the control circuitry and is operable to turn the control circuitry on and off. Operational indicator lamps are operably connected the control circuitry and operates to indicate an on or off state of the control circuitry. The control circuitry operates to operate the audible alarm indicator and the visual alarm indicator upon the float switch sensing a high fluid level.
A method of determining an optimal value for a control of a drilling operation is provided. Drilling data from a drilling operation is received. The drilling data includes a plurality of values measured for each of a plurality of drilling control variables during the drilling operation. An objective function model is determined using the received drilling data. The objective function model maximizes a rate of penetration for the drilling operation. Measured drilling data is received that includes current drilling data values for a different drilling operation. An optimal value for a control of the different drilling operation is determined by executing the determined objective function model with the measured drilling data that includes the current drilling data values for the different drilling operation as an input. The determined optimal value for the control of the different drilling operation is output.
Described herein is a system and method for controlling flow in a pipe string using a finger valve. Specifically, the disclosure describes a finger valve comprising a base pipe and a sliding sleeve. The base pipe can comprise a finger port, one or more fingers; and one or more hinges, each of the hinges connecting one of the fingers to the base pipe. The sliding sleeve can comprise a sliding sleeve having a first sleeve with in inner surface comprising a void and a depressor. The first sleeve can be positionable in a first position and a second position. In the first position, the depressor can push the one or more fingers into a closed position. In the second position, the void can rest at least one of the one or more fingers, allowing the at least one of the one or more fingers to move into an open position.
A flow control device, including a first member defining a first portion of a flow path and a second member defining a second portion of the flow path. The flow path has a cross sectional flow area defined at least partially by the first member and the second member. A length of the flow path is greater than a largest dimension of the cross sectional flow area, and the cross sectional flow area is adjustable by movement of at least a portion of the first member relative to the second member. A crush zone arranged with at least one of the first member and the second member that can change in length due to loading thereof. A method of adjusting restriction of a flow path is also included.
An apparatus for use in launching cement plugs in a well cementing operation, comprising: a cylinder (130); a piston (110) slideably received in the bore of the cylinder; and an actuator, operable by the piston, for launching a plug from the apparatus into the well; wherein the cylinder has a resiliently mounted latching member (132) positioned in the wall thereof and biased to project into the bore of the cylinder; and the piston has a profiled outer surface defining a recess (114) into which the latching member (132) can project to hold the piston in position in the cylinder.
A pipe handling system reduces the amount of physical effort required for an operator to transfer steel rotary drilling pipe sections from a storage location to and from a rotary drive unit. The system utilizes an indexing arm which removes or adds the pipe sections from the storage location, placing them in the correct position to be attached to or removed from the rotary drive unit. The index arm, unlike other systems, can remove individual pipe sections to and from the storage location directly to the rotary drive unit's centerline of drilling position. This reduces both the number of physical moves required to complete the task and the amount of weight being transferred. The indexing arm is able to lift a pipe section from the storage location and place it below the rotary drive unit's centerline, then lower away from it without additional movement of the rotary drive unit itself.
A safety door apparatus is described that includes a door with a removable and replaceable safety edge. The door defines a notch in at least one of the elongate edges of the door. The notch defines a recessed surface that conformingly mates with the resilient safety edge. A safety hinge assembly connects to the door and receives the safety edge. The recessed surface of the notch can extend partially or the full length of the elongate edge of the door. The safety edge can similarly extend partially or the full length of the elongate edge of the door. The safety door can include multiple configurations of removable and replaceable edge portions that can include a non-safety edge. A decorative molding is positionable over the connection between the safety edge and notch.
The invention describes a system for controlling a shading device with a plurality of controllable shading elements. To provide a system for controlling a shading device, which reduces direct sunlight transmission and enhances thermal comfort and lighting conditions, the system comprises at least one detector unit for providing an image signal of a shading area and a control unit (5) being configured to receive said image signal, determine from said signal, whether a characteristic pattern is present in said shading area and in case said characteristic pattern is determined, control said shading elements to reduce said characteristic pattern.
The invention relates to an unlatching device (20) for public transportation vehicles, comprising a deflection rocker (4) connected to a first rotatable shaft (6), said deflection rock being connected by means of a connecting element (5), to an unlocking element of a lock and being provided with a projecting driving pin (11), and further comprising an actuating lever (8), which is mounted on the first shaft (6) and rotatable about the first shaft (6), and a cam wheel (1) connected to a second rotatable shaft (7), said cam wheel meshing with the deflection rocker (4). A rotation of the cam wheel (1) causes a pivoting of the deflection rocker (4), and thus a movement of the connecting element (5) and unlocking of the lock. Rotating the actuating lever (8) causes the actuating lever (8) to come in contact with the driving pin (11), and to catch said driving pin and during further rotation also the deflection rocker (4), whereby the connecting element (5) is moved and the lock unlocked.
A wooden post protection system wherein a sheet metal sleeve is positioned about a portion of the post adjacent to concrete supporting the post, overlapping end segments of the post nailed to the post and an adhesive water-proof coating forming a water-tight bond between the post and sleeve and between the end segments and nails.
A device for supporting a plaster ceiling during conservation work. A plurality of the devices may be installed on a superstructure of pipes or other rigid members installed on scaffolding to provide for a network or pattern of supporting devices in some installations. The supporting device includes a screw jack and a jack base that is configured to be attached to the superstructure, which in some cases includes horizontal pipes. The jack base may, in some embodiments, be symmetrical top to bottom so as to be useable on either side of a pipe and easily rotatable to either position.
A flooring system includes a foam pad having an upper surface and a lower surface, and having a tapered section having a slope. The flooring system also includes a coating of a primer material disposed upon at least the slope of the tapered section of the upper surface of the foam pad. A coating of an adhesive is disposed upon at least the coating of the primer material. The flooring system also includes a covering where at least a portion of a surface of the covering is in contact with the coating of adhesive.
The present document describes a fastening strip for fastening a plurality of siding panels to a surface. The strip is installed on the surface perpendicularly to the length of the panels. The strip has a plurality of braces regularly spaced along the strip and extending outwardly therefrom. Each one of the siding panels fits between two consecutive braces which each have a flexible portion and an engaging portion. The flexible portion for engaging the first edge of one of the siding panels and the engaging portion for engaging the second edge of one of the siding panels thereby fastening the one of the siding panels to the surface in between two braces.
A method of reinforcing a column positioned proximate a blocking structure that prevents wrapping a sheet material completely about the column. The column includes an exterior perimeter surface portion extending between first and second intersections with the blocking structure so that the exterior perimeter surface portion is accessible from one side of the blocking structure. A first opening is formed in the column and/or the blocking structure. The first opening is located proximate the first intersection of the exterior perimeter surface portion of the column and the blocking structure. A portion of the first fiber anchor is inserted through the first opening. The first fiber anchor has at least a first end. The first end of the first fiber anchor is secured to the exterior perimeter surface portion of the column. An outer fibrous sheet is applied to the exterior perimeter surface portion.
A method for rapidly deploying and erecting a HUD-certified structure includes providing an ISO-certified container. The container includes a container frame including a horizontal floor section, an opposed horizontal roof section and first and second opposed vertical end sections, and a pair of opposed vertically-disposed floor panels. The container frame and the opposed floor panels define an interior cavity with a plurality of dwelling members disposed therein. The method further includes transporting the ISO-certified container to a desired location and forming a HUD-certified structure at the desired location, including manipulating at least some of the dwelling members.
A shower generally includes a shower enclosure, various shower systems having output devices, and a control panel having an electronic display and configured for receiving user inputs. Shower control systems and methods are provided for receiving and processing user inputs, displaying a graphical user interface on the electronic display, and controlling outputs of the various output devices.
A hydraulic control valve for a construction machine is disclosed, which can variably control the flow of hydraulic fluid that is supplied to a hydraulic cylinder to drive a working device. The hydraulic control valve for a construction machine includes a valve block in which an inlet port and an outlet port that communicates with the inlet port is formed, a check valve provided with a first throttling portion to permit the flow of the hydraulic fluid from the inlet port to the outlet port and to variably control the flow of the hydraulic fluid from the outlet port to the inlet port, and a spool provided with a second throttling portion to variably control the flow of the hydraulic fluid from the outlet port to the inlet port through the check valve that is opened when the second throttling portion is shifted by pilot signal pressure.
A loader includes a tool carrier arranged on a loader boom. The tool carrier is connected at a first pivot point to the loader boom and at a second pivot point to a pivot linkage. The pivot linkage has first and second links which are pivotably connected to one another at a first link point. The first link is pivotably connected at a second link point to the loader boom, and the second link is pivotably connected at a second link point at the second pivot point to the tool carrier. A sensor senses a pivot angle between the tool carrier and loader boom. The sensor is positioned in a cavity on the loader. An actuating device is connected to the sensor.
Oil boom for preventing dissemination of oil on an aqueous surface, comprising plate elements which by means of hinges at each side edge are arranged to be joined to a continuous wall. The are arranged to exert an angle-increasing between adjacent plate elements while an adjustable angle delimiting device is connected to every second hinge and is so arranged that the angle between the plate elements only can increase to a certain maximum angle. The plate elements are typically made in a lightweight polymer material having ballast at their lower edge.
A chute assembly may include a chute having an inlet and an outlet and an adjustment mechanism. The adjustment mechanism may be used to move the chute to adjust the outlet: forward to back with respect to a spinner disc; and/or, (2) side to side with respect to the spinner disc in order to change the spreading characteristics.
A spreader assembly may include a hopper having a receptacle for holding salt, or the like, and at least one chamber formed between the receptacle and an outer surface of the hopper. The chamber may hold a liquid used to pre-wet the salt before it contacts a ground surface. The hopper may be an insert hopper formed as a one piece plastic component in a rotational molding operation.
A wing plow post and method of manufacturing the post is disclosed. The post is intended for attaching a wing plow to vehicle for moving material, such as snow. The links of the post are parallel to the angle of the wing plow when the plow is in the plowing position to minimize stress on the post and frame of the vehicle. The post includes a float collar on the hydraulic lift cylinder to provide free floating of the toe end of the wing plow. It allows a wing plow to move over road surfaces and limit the stress on both the post itself and the frame of the vehicle to which the post is attached. Further, the present invention also allows power to be provided by a hydraulic cylinder in the downward direction to the toe end of the wing plow.
An automotive milling machine, for the treatment of road surfaces or ground surfaces includes a chassis comprising front and rear suspension axles with a total of no less than three suspension units with a machine frame supported by the chassis, with lifting columns between the suspension units and the machine frame at no less than two suspension units of a suspension axle, said suspension units being transversely offset from one another in the direction of travel, and with a working drum. The working drum is adjustable to a position for driving in travel mode with the working drum raised and, in the adjusted position of the working drum at a distance from the road surface or ground surface, the lifting columns are suitable for coupling to a spring device.
The invention relates to a clamping mechanism for securing at least one object, for example a barrier, to a rail comprising a rail web and a rail head, which clamping mechanism comprises a linkage comprising at least four rods which are pivotally interconnected via points of attachment, a short rod of which is directly connected to an upper rod and also to a bottom rod, which short rod is movable from a first position to a second position and vice versa, in which first position of the short rod the clamping mechanism can be positioned in a lateral section of the rail with some play, while in the second position of the short rod the clamping mechanism is clamped in position in the lateral section of the rail by means of the short rod.
A multifunction apparatus for processing webs of fibrous and/or pliable material includes a tubular sleeve of an elastic material, a pair of discs supporting the tubular sleeve, a fixed shaft on which the discs are mounted such that their axis is inclinable to the axis of the sleeve, the end portions of the shaft extending beyond said discs, and a system moving the disc/sleeve system relative to the shaft.
A polyester monofilament comprising a high-viscosity polyester as a core component and a low-viscosity polyester as a sheath component is provided, the polyesters having been combined together in a core-sheath arrangement. The polyester monofilament has a fineness of 3.0-13.0 dtex, a breaking strength of 6.0-9.3 cN/dtex, a strength at 10% elongation of 5.0-9.0 cN/dtex, a difference in wet heat stress in the filament-length direction of 3.0 cN or less, and a residual torque value of at most 4 turns per m. Provided is a process for producing a polyester monofilament by a direct spinning/drawing method in which two ingredients, i.e., a high-viscosity polyester as a core component and a low-viscosity polyester as a sheath component, are melt-extruded from a spinnert while being combined together in a core-sheath arrangement, and cooled and solidified, and the resultant extrudate filament is continuously drawn and wound up.
A method for forming a tantalum-containing layer on a substrate, the method comprising at least the steps of: a) providing a vapor comprising at least one precursor compound of the formula Cp(R1)mTa(NR22)2(═NR3) (I): wherein: R1 is an organic ligand, each one independently selected in the group consisting of H, linear or branched hydrocarbyl radical comprising from 1 to 6 carbon atoms; R2 is an organic ligand, each one independently selected in the group consisting of H, linear or branched hydrocarbyl radical comprising from 1 to 6 carbon atoms; R3 is an organic ligand selected in the group consisting of H, linear or branched hydrocarbyl radical comprising from 1 to 6 carbon atoms; b) reacting the vapor comprising the at least one compound of formula (I) with the substrate, according to an atomic layer deposition process, to form a layer of a tantalum-containing complex on at least one surface of said substrate.
In a non-oriented electrical steel sheet, Si: not less than 1.0 mass % nor more than 3.5 mass %, Al: not less than 0.1 mass % nor more than 3.0 mass %, Ti: not less than 0.001 mass % nor more than 0.01 mass %, Bi: not less than 0.001 mass % nor more than 0.01 mass %, and so on are contained. (1) expression described below is satisfied when a Ti content (mass %) is represented as [Ti] and a Bi content (mass %) is represented as [Bi]. [Ti]≦0.8×[Bi]+0.002 (1)
Provided is a magnesium alloy for room temperature, which is manufactured by adding CaO onto a surface of a molten magnesium alloy and exhausting the CaO through a reduction reaction of the CaO with the molten magnesium alloy. Resultantly, the magnesium alloy with CaO added has more improved room-temperature mechanical properties (tensile strength, yield strength, elongation) than magnesium alloys without using CaO. Furthermore, as the added amount of CaO increases, room-temperature mechanical properties (tensile strength, yield strength, elongation) increase as well.
Compositions and methods for the rapid and sensitive detection of a carbapenemase in a sample are provided. The compositions include novel primer and probe compositions for use in detecting the presence of this enzyme in a sample, particularly using PCR methods. These primers and probe sets can be used in amplification methods (such as PCR, particularly quantitative PCR) and packaged into kits for use in amplification methods for the purpose of detecting carbapenemase in a test sample, particularly a patient sample, particularly a direct sample. Thus, in one embodiment, the present invention provides for novel oligonucleotide primers set forth in SEQ ID NOs:1, 2, 4, 5, 7, 8, 14, 15, 17, 18, and 20, and the novel oligonucleotide probe sequences set forth in SEQ ID NOs:3, 6, 9, 16, and 19. These sequences can be used in a method of detecting carbapenemase in a sample.
Described herein are methods for differentiate human cancers comprising using one or more transcribed ultraconserved regions (T-UCR) expression profiles where the association between the genomic location of UCRs and the analyzed cancer-related genomic elements is highly statistically significant and comparable to that reported for miRNAs.
Compositions of transposome complexes for generating DNA fragments with specific 5′- and 3′-tags. Kits for generating libraries for sequencing, with transposome complexes, enzymes, oligonucleotides or other components.
Methods, compositions and articles of manufacture for assaying a sample for a target polynucleotide are provided. A sample suspected of containing the target polynucleotide is contacted with a polycationic multichromophore and a sensor polynucleotide complementary to the target polynucleotide. The sensor polynucleotide comprises a signaling chromophore to receive energy from the excited multichromophore and increase emission in the presence of the target polynucleotide. The methods can be used in multiplex form. Kits comprising reagents for performing such methods are also provided.
Methods for analyzing, selecting, characterizing or classifying compositions of a co-polymer, e.g., glatiramer acetate are described. The methods entail analysis of pyro-glutamate in the composition, and, in some methods, comparing the amount of pyro-glutamate present in a composition to a reference standard.
Ex vivo methods of detecting and analyzing circulating drug metabolites with drug interaction potential are provided. The methods include the use of clinical plasma samples from subjects who have been administered an investigational drug in vivo. The clinical plasma samples will contain both the parent drug and associated metabolites. A control plasma sample spiked directly with the drug of interest can be used as a standard reference. The plasma samples can be applied to an in vitro test system to evaluate the changes in activity or expression of drug-metabolizing enzymes and/or drug transporters in the test systems to determine circulating drug metabolites with drug interaction potential. By comparing the clinical plasma sample to the drug-spiked control, the inhibitory and/or inducing effects on drug-metabolizing enzymes and/or drug transporters can be correctly attributed to the parent drug or its associated metabolites.
The present invention relates to a process for the production of a polyamine involving the use of enzymes; in particular to a process performed in aqueous environment; to the polyamines produced by said method; as well as the use of said polyamines for manufacturing paper, for immobilizing enzymes, or for preparing pharmaceutical or cosmetical compositions. The invention also relates to a novel method for in situ regeneration of cofactors NAD(P)+.
A nucleotide leader sequence 5′-UTR comprises elements favorable to gene expression, such as repeated CAA trinucleotide elements in combination with repeated CT dinucleotide elements.
The present invention generally relates to methods for identifying nucleic acid ligands of a target molecule. In certain embodiments, the invention provides methods for identifying a nucleic acid ligand of a target molecule from a candidate mixture of nucleic acids, including contacting at least one target molecule with a candidate mixture of nucleic acids, in which the nucleic acids have different affinities for the target molecule, and separating in a single step nucleic acids that bind the target molecule with greatest affinity from nucleic acids that bind the target molecule with a lesser affinity and nucleic acids that do not bind the target molecule, thereby identifying the nucleic acid ligand of the target molecule.
The present invention provides DNA molecules that constitute fragments of the genome of a plant, and polypeptides encoded thereby. The DNA molecules are useful for specifying a gene product in cells, either as a promoter or as a protein coding sequence or as an UTR or as a 3′ termination sequence, and are also useful in controlling the behavior of a gene in the chromosome, in controlling the expression of a gene or as tools for genetic mapping, recognizing or isolating identical or related DNA fragments, or identification of a particular individual organism, or for clustering of a group of organisms with a common trait.
The present invention is directed to methods of producing recombinant functional heme-binding proteins with complete heme incorporation and purified preparations of the same. The present invention is further directed to methods of identifying agents that modulate the activity of heme-binding proteins.
Reduced genome strains of E. coli MGl 655 are described. In various embodiments, the strains have one or more of equal or improved growth rate, transformation efficiency, protein expression, DNA production, DNA yield and/or DNA quality compared to the parental strain and commercially available strains.
The present invention provides methods, compositions, and kits for storing and enhancing the activity of polymerases and particularly thermostable polymerases. The methods comprise mixing a thermostable polymerase with at least one zwitterionic or ylide surfactant that has at least one PEO group. In another aspect the polymerase is mixed with a blocker such as PLURONIC® or TETRONIC® or an amine N-oxide derivative thereof. The thermostable polymerase may be reversibly inactivated by treatment with 2-(Methylsulfonyl)ethyl 4-nitrophenyl carbonate. Compositions and kits for performing the process according to the invention are also provided.
The invention provides methods for differentiating stem cells along the pancreatic lineage as well as large scale culture methods. The present invention further provides pancreatic progenitor cells derived from stem cells to provide pancreatic cells to a subject.
Provided is a liquid concentrate for cleaning composition which could exhibit excellent environmental safety etc. by adding afterward a predetermined amount of water, and also has excellent regeneration efficiency, and provided are a cleaning composition and a cleaning method thereof. Disclosed is a liquid concentrate for cleaning composition which is used as a mixture with water and is intended for cleaning an object to be cleaned in a clouded state, with a predetermined amount of water having been added thereto, the liquid concentrate for cleaning composition including, a first organic solvent which is a predetermined hydrophobic glycol ether compound or the like, and a second organic solvent which is a predetermined hydrophilic amine compound.
A process for preparing mono-carboxy-functionalized dialkylphosphinic acids, dialkylphosphinic esters and dialkylphosphinic salts by means of alkylene oxides, characterized in that a) a phosphinic acid source (I) is reacted with olefins (IV) in the presence of a catalyst A to form an alkylphosphonous acid, its salt or ester (II), b) the resultant alkylphosphonous acid, its salt or ester (II) is reacted with alkylene oxides of the formula (V) in the presence of a catalyst B, to give a mono-functionalized dialkylphosphinic acid derivative (VI), and c) the resultant mono-functionalized dialkylphosphinic acid derivative (VI) is reacted in the presence of a catalyst C to give the mono-carboxy-functionalized dialkylphosphinic acid derivative (III), and the catalysts A and C are transition metals and/or transition-metal compounds and/or catalyst systems which are composed of a transition metal and/or a transition-metal compound and at least one ligand, and the catalyst B is a Lewis acid.
The present invention relates to yttrium aluminum garnet phosphor, a method of preparing the same and a light-emitting diode containing the same. The yttrium aluminum garnet phosphor of the present invention is represented by the following formula (I): (Y3-aMa)Al5-bSibO12 (I) wherein, 0.01≦a≦0.2, 0
The invention provides a liquid crystal (LC) composition, a LC cell thereof, and a LC device thereof. The LC composition comprises (i) a mixture of two or more nematic liquid crystals, and (ii) at least one chiral dopant. The mixture of the liquid crystals can exist in a blue phase within a temperature range of from about 12-60° C. such as 21-28° C. The LC device can be a blue phase mode liquid crystal display (BPLCD) based on such a room-temperature blue phase LC. The BPLCD requires no alignment, and it exhibits merits such as a fast switching time (e.g. sub-millisecond), a low switching voltage and a large field-induced birefringence, among others.
According to one aspect of the inventions, emulsion compositions are provided. Emulsions according to this aspect include: (a) a water-insoluble resinous material; (b) water; and (c) an emulsifier, wherein the emulsifier comprises a non-ionic, a cationic, or a zwitterionic emulsifier; wherein the continuous phase of the emulsion comprises the water; wherein a dispersed phase of the emulsion comprises the resinous material; wherein the dispersed phase is in the form of droplets having a size distribution range such that at least 50% of the droplets have a size of 0.5 micrometers-500 micrometers; wherein the resinous material of the droplets is in a concentration of at least 5% by weight of the water; and wherein the composition of the droplets has a viscosity of less than 2,000 Poise measured at 20° F. According to another aspect of the inventions, methods are provided for treating a portion of a subterranean formation. Methods according to this aspect include the steps of: (a) forming an emulsion according to the composition described above; and (b) introducing the emulsion into a portion of a subterranean formation.
The present disclosure pertains to an aqueous pigment dispersion containing a pigment as colorant, a polymeric dispersant and a hydroxyl-substituted amino acid. The present disclosure further pertains to an ink containing an aqueous vehicle and the aqueous pigment dispersion, and ink sets with at least one of the inks containing the pigment dispersion.
A photosensitive conductive paste includes an epoxy acrylate (A) including a urethane bond, a photopolymerization initiator (B), and a conductive filler (C), wherein an added amount of the conductive filler (C) is 70 to 95% by weight with respect to the total solids in the photosensitive conductive paste.
A coating composition, a method for coating a surface of a material using the same, and surface treated materials having the same are provided. The coating composition comprises a nitrogen atom-containing organopolysiloxane represented by the average siloxane unit formula (1): (R1R2R3SiO1/2)a(SiR12O2/2)b(R2R3SiO2/2)c(R2R32SiO1/2)d (1) wherein R1 is a nitrogen-free, substituted or unsubstituted, monovalent organic group of 1 to 20 carbon atoms, R2 is a monovalent organic group containing at least one nitrogen atom, R3 is an organoxy group represented by —OR1, “a” is a positive number of 0.7 to 1.3; “b” is a positive number of 2 to 500; “c” is a positive number of 0 to 10; “d” is a positive number 0.7 to 1.3: and a+d is at least 2.
A metal nanoparticle composition includes water and a water-soluble polymer having both carboxylic acid and sulfonic acid groups. Silver nanoparticles are dispersed in the water such that the weight percentage of silver in the composition is greater than 10%.
The present invention provides a novel black photosensitive resin composition, which includes: a polysiloxane, a black pigment, an alkali-soluble resin, a photopolymerizable compound, a photopolymerization initiator and a solvent. Accordingly, the black photosensitive resin composition of the present invention can meet the requirements for optical density and resistance under high temperature and is advantageous to the application in a touch panel. In addition, the present invention further provides a light-blocking layer that is manufactured from the black photosensitive resin composition.
In order to make available polymer compounds that are improved with respect to their properties compared to conventional PTFE, on the one hand, and the further high-performance polymer or polymers, on the other, it is proposed that a polymer compound has a proportion of a fully fluorinated thermoplastic polymer material as well as a proportion of at least one further high-performance polymer different therefrom, selected from the group of polyphenylene sulphide (PPS), polyphenylene sulphone (PPSO2), polyamide (PA), polyimide (PI), polyamide-imide (PAD, and polyether imide (PEI) as well as copolymers and derivatives of these polymers and copolymers, wherein the compound has a homogeneous distribution of the proportions of the polymers and the polymer material.
A molding method for obtaining a polylactic acid stereocomplex resin composition solving a limitation according to application of a typical polylactic acid resin composition. The molding method includes an environmentally-friendly material, and having excellent heat resistance and impact resistance. The polylactic acid stereocomplex resin composition includes about 40 to about 91.9 wt % of a crystalline poly L-lactic acid, about 3 to about 50 wt % of a crystalline poly D-lactic acid, about 5 to about 30 wt % of an impact modifier, and about 0.1 to about 2 wt % of a nucleating agent, and a method for molding the same.
A nucleating agent composition for increasing rigidity and toughness of polypropylene is provided. The nucleating agent composition comprises a carboxylate nucleating agent and a phosphate nucleating agent. The carboxylate nucleating agent is selected from the group consisting of sodium benzoate and hydroxyl aluminum para-tertiary butyl benzoate, and the phosphate nucleating agent is selected from any one of sodium 2,2′-methylene-di(4,6-di-t-butyl phenyl) phosphate and aluminum bis[2,2′-methylene-di(4,6-di-t-butylphenyl)] phosphate. The nucleating agent composition according to the present invention not only can significantly improve the bending modulus and thermal deformation temperature of polypropylene, but also can improve the impact strength of polypropylene.
The invention relates to composite polymer modifiers for thermo-plastic resins, and especially for polyvinyl chloride (PVC). The composite modifier is an intimate blend of mineral filler and polymeric process aid, which is formed by the co-powderization of aqueous emulsions, suspensions or slurries of one or more mineral filler(s) and process aid(s). The resulting composite modifier provides more effective modification of the thermoplastic resin than by the use of the dried components formed separately. The composite modifier may also contain other co-powderized components such as impact modifiers, for additional benefits.
Provided are compounds of the following: wherein R1 is a saturated or unsaturated cyclic hydrocarbon optionally substituted with an alkyl and/or an OXO-ester, and R2 is a C4 to C14 hydrocarbyl, preferably the residue of a C4 to C14 OXO-alcohol. Also provided are processes for making the compounds and plasticized polymer compositions containing said compounds.
The present invention provides a polyvinyl alcohol film which has a width of 3 m or more, an in-plane retardation value of 30 nm or less and a fluctuation of in-plane retardation value of 15 nm or less.
The present invention relates to a method for optimizing the sequential use of at least two ethylene polymerization catalysts to an ethylene polymerization loop reactor, comprising: transferring to a mixing vessel a first ethylene polymerization catalyst and a first diluent, thereby providing a first catalyst slurry, transferring said first catalyst slurry from said mixing vessel to an ethylene polymerization loop reactor at a concentration suitable for polymerizing ethylene, increasing the ratio of said diluent to said first ethylene polymerization catalyst in said first catalyst slurry, stopping the supply of said first catalyst slurry to said mixing vessel, stopping the supply of said first catalyst slurry to said ethylene polymerization loop reactor, stopping the supply of ethylene to said ethylene polymerization loop reactor, removing said first catalyst slurry from said ethylene polymerization loop reactor, emptying said mixing vessel, optionally rinsing said mixing vessel with fresh diluent, transferring to said mixing vessel a second ethylene polymerization catalyst and a second diluent, thereby providing a second catalyst slurry, decreasing the ratio of said second diluent to said second ethylene polymerization catalyst in said mixing vessel to obtain a concentration of said second ethylene polymerization catalyst in said second diluent suitable for polymerizing ethylene, transferring said second ethylene polymerization catalyst slurry from said mixing vessel to said ethylene polymerization reactor, restoring the supply of ethylene to said ethylene polymerization loop reactor, restarting ethylene polymerization in said ethylene polymerization loop reactor.
The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.
The present invention concerns a peptide molecule or a nucleic acid molecule, for use in medicine and, in particular, for use in preventing or treating a non-cancerous condition or relieving pain in a patient. The invention also relates to a pharmaceutical composition comprising the peptide or nucleic acid molecule of the invention and methods of treatment thereof.
Disclosed are novel immunogenic proteins derived from Staphylococcus aureus, as well as methods for their use in conferring protective immunity against S. aureus infections. Also disclosed are nucleic acid encoding the proteins and methods of use of these nucleic acids.
The present disclosure relates to antigen binding proteins, such as antibodies, that bind to HER3, polynucleotides encoding such antigen binding proteins, pharmaceutical compositions comprising said antigen binding proteins and methods of manufacture. The present disclosure also concerns the use of such antigen binding proteins in the treatment or prophylaxis of diseases associated with breast cancer, ovarian cancer, prostate cancer, bladder cancer, pancreatic, gastric, melanoma and other cancers that overexpress HER3.
The invention describes methods of treating erosive polyarthritis comprising administering a TNFα antibody, or antigen-binding portion thereof. The invention also describes a method for testing the efficacy of a TNFα antibody, or antigen-binding portion thereof, for the treatment of erosive polyarthritis.
Helicobacter pylori, one of the most common human pathogens, is associated with the development of human chronic gastritis, peptic ulcers and gastric cancer. The invention relates to a α1,6-glucan-containing Helicobacter pylori compound comprising the structure of Formula (I): wherein R is a α-DDHep-3-α-L-Fuc-3-β-GlcNAc trisaccharide substituted with an α1,6-glucan linked to an α1,3-DD-heptan, and wherein the last DD-Hep residue of α1,3-DD-heptan is capped with β-GlcNAc residue. Compositions comprising the compound, uses of the compound, and antibodies raised against the compound are also described.
A method is provided for producing motif-specific, context-independent antibodies that recognize a plurality of peptides or proteins within a genome that contain the same post-translationally modified motif. The method includes the step of immunizing a host with a degenerate peptide library antigen featuring (i) a fixed target motif containing one or more invariant amino acids including at least one modified amino acid, and (ii) a plurality of degenerate amino acids flanking the motif. Motif-specific, context-independent antibodies produced by the disclosed method are also provided. The method encompasses motifs consisting of a single modified amino acid, as well as short motifs comprising multiple invariant amino acids including one or more modified amino acids, such as all or part of kinase consensus substrate motifs, protein-protein binding motifs, or other cell signaling motifs. Methods of using the antibodies, e.g. for genome-wide profiling, are also provided.
Disclosed is a synthesis suitable for large scale manufacture of an A2A-adenosine receptor agonist, and also relates to polymorphs of that compound, and to methods of isolating a specific polymorph.
The present invention provides triazole macrocyclic compounds useful as therapeutic agents. More particularly, these compounds are useful as anti-infective, anti-proliferative, anti-inflammatory, and prokinetic agents. These compounds are represented by the following formula (I): wherein R1, R2, etc. are defined as in claim 1.
The present application relates to the compounds of formula I (I) as well as their use for inhibiting at least one of AKT-1, FAK and PKCα and in the treatment and/or prevention of metastatic diseases.
The present invention provides a new class of compounds useful for the modulation of beta-secretase enzyme (BACE) activity. The compounds have a general Formula I: wherein variables A4, A5, A6, A8, each of Ra, Rb, R1, R2, R3 and R7 of Formula I, independently, are defined herein. The invention also provides pharmaceutical compositions comprising the compounds, and uses of the compounds and compositions for treatment of disorders and/or conditions related to A-beta plaque formation and deposition, resulting from the biological activity of BACE. Such BACE mediated disorders include, for example, Alzheimer's Disease, cognitive deficits, cognitive impairments, schizophrenia and other central nervous system conditions. The invention further provides compounds of Formulas II and III, and sub-formula embodiments thereof, intermediates and methods for preparing compounds of the invention.
Novel compounds and compositions for treating patients in need of relief from HIV, AIDS and AIDS-related diseases are described. Methods for treating HIV, AIDS, and AIDS-related diseases using the compounds described herein are also described.
The present invention relates to the compound for treatment and/or prevention of one or more metabolic disorders utilizes an A-B-C tripartite structure, wherein A, B, and C are identical or non-identical structures, for example, but not limited to, heterocyclic, phenyl or benzyl ring structures with or without substitutions and are described in detail herein. Also provided are methods for the treatment and/or prevention of one or more metabolic disorders, for example, obesity or diabetes, utilizing fatostatin A and/or a derivative and/or analog thereof and/or the A-B-C tripartite compounds.
Disclosed are negative allosteric modulators of the metabotropic glutamate receptor subtype 5 (mGluR5); synthetic methods for making the compounds; pharmaceutical compositions comprising the compounds; and methods of treating neurological and psychiatric disorders associated with glutamate dysfunction using the compounds and compositions. This abstract is intended as a scanning tool for purposes of searching in the particular art and is not intended to be limiting of the present invention.
This disclosure relates to the field of preparation of 3-(3-chloro-1H-pyrazol-1-yl)pyridine and intermediates therefrom. These intermediates are useful in the preparation of certain pesticides.
The present invention provides a novel macrocyclic compound exhibiting superior odor qualities and having a musk-like aroma, a method for producing the same, and a novel flavor or fragrance composition, and food products or beverages, fragrances or cosmetics, daily necessities or household goods and oral products using the novel macrocyclic compound. The invention relates to a compound represented by the formula (1), wherein each of wavy lines represents at least one of an E-configuration of C═C double bond and an Z-configuration of C═C double bond; m represents an integer of 0 to 10; and n represents an integer of 1 to 11, and n represents an integer of 1 to 11 when m is 0 to 4 or 6 to 10, and n is an integer of 1 or 3 to 11 when m is 5.
The present invention provides an efficient method of synthesizing and purifying dianhydrohexitols such as dianhydrogalactitol. In general, as applied to dianhydrogalactitol, the method comprises: (1) reacting dulcitol with a concentrated solution of hydrobromic acid at a temperature of about 80° C. to produce dibromogalactitol; (2) reacting the dibromogalactitol with potassium carbonate in t-butanol to produce dianhydrogalactitol; and (3) purifying the dianhydrogalactitol using a slurry of ethyl ether to produce purified dianhydrogalactitol. Another method produces dianhydrogalactitol from dulcitol; this method comprises: (1) reacting dulcitol with a reactant to convert the 1,6-hydroxy groups of dulcitol to an effective leaving group to generate an intermediate; and (2) reacting the intermediate with an inorganic weak base to produce dianhydrogalactitol through an intramolecular SN2 reaction. Other methods for the synthesis of dianhydrogalactitol from dulcitol are described.
The present invention relates to a process for producing aromatic carbonyl compounds of formula I and aromatic imine compounds of formula III comprising the step of reacting a (hetero)aromatic halogen or sulfonate compound II wherein the variables are as defined in the claims and description, with a mixture of carbon monoxide and hydrogen in the presence of a transition metal complex catalyst. The invention also relates to specific compounds III, to compositions comprising them and to their use for combating invertebrate pests.
The present invention relates to novel cyclic N,N′-diarylurea—androgen receptor antagonist, anti-cancer agent, pharmaceutical composition, medicament, and method for treatment of breast cancer disease.Cyclic N,N′-diarylthioureas or N,N′-diarylureas of the general formula 1, their optical (R)- and (S)-isomers and pharmaceutically acceptable salts thereof exhibiting properties of androgen receptor antagonists have been proposed, wherein: R1 represents C1-C3 alkyl; R4 and R5 represent hydrogen; or R4 represents hydrogen, R5 represents methyl; or R4 represents methyl, R5 represents CH2R6 group in which R6 is C1-C3 alkoxycarbonyl, carboxyl, hydroxyl group optionally substituted with methyl or benzyl; or R4 and R5 together with the carbon atom they are attached to form 5- or 6-membered saturated heterocycle including at least one oxygen atom or nitrogen atom optionally substituted with methyl.
The present invention discloses methods for synthesizing 3-(substituted dihydroisoindolinone-2-yl)-2,6-dioxopiperidine and intermediates thereof, namely, the synthesis of compounds of the Formula (I), with each substitutional group defined in the patent specification. Owing to the advantages of high productivity, little influence to the environment and material accessibility, the methods of the present invention is suitable for industrial production.
There is provided novel amino acid ester compounds comprising at least one nitric oxide releasing group and pharmaceutically acceptable salts thereof, and novel compositions comprising at least one amino acid ester compound comprising at least one nitric oxide releasing group, and, optionally, at least one nitric oxide donor and/or at least one therapeutic agent. Also provided are compositions for increasing nitric oxide physiological levels in a subject, methods for increasing nitric oxide physiological levels in a subject, methods for improving a subject's muscle strength, athletic performances and/or lean body mass gain and or performance in a subject.