US09238944B2
This invention relates to a tri-cone bit for high RPM drilling applications, which comprises three head sections and three cones. Cutting elements are arranged on each cone. Upper parts of the three head sections are joined together to form a bit body, on which nozzle sockets are provided, and nozzles are installed in bores of the nozzle sockets. A bearing between the cones and the head sections is a composite roller-journal bearing which is formed by rollers and arc-shaped slides arranged in an alternating way, and a seal means for the bearing is of metal face type. The composite roller-journal bearing of the invention can withstand high RPM and high load, and also has a higher resistance to impact, thereby ensuring longer working life of the bearing under high RPM and medium-high WOB. The six-point gage protection structure enhances stability of the bit and reduces cutting element breakage caused by bit vibration. The above tri-cone bit is suitable for high RPM and medium-high WOB drilling applications and features high drilling efficiency and long service life.
US09238943B2
A floating, offshore drilling and/or production platform is equipped with a rail-mounted transport system that can be positioned at a plurality of selected positions over the well bay of the vessel. The transport system can move a drilling riser with a drilling riser tensioner system and a blowout preventer from one drilling location to another without removing them from the well bay of the vessel. Using the transport system, the drilling riser is lifted just clear of a first well head and positioned over an adjacent, second well head using guidelines. The transport system may then move the upper end of the drilling riser (together with its attached tensioner and BOP) to a second drilling location. A dummy wellhead may be provided on the seafloor in order to secure the lower end of the drilling riser without removing it from the sea while production risers are being installed.
US09238933B1
A framing element is provided. The framing element includes an F-shaped body defined via a spine, a first flange extending from the spine, and a second flange extending from the spine. The body is unitary. The first flange having a flange end portion distal to the spine. The flange end portion including a first track. The spine having a spine end portion distal to the first flange. The spine end portion including a second track. The second flange is between the first flange and the second track.
US09238932B2
A slide member for use in an automotive vehicle. The slide apparatus includes a first slide member having a slidably contacting surface. Additionally, a second slide member is provided having a slidably contacting surface which is in slidable contact with the slidably contacting surface of the first slide member. In this slide apparatus, at least one of the slidably contacting surfaces of the first and second slide members is formed of a transferable water repellent material having a water repellency and a sufficient transferability to form a transferred film of the transferable water repellent material on at least the other slidably contacting surface.
US09238928B2
The gate latching device of this invention is optionally a one piece design, although it could be constructed by interconnecting several individual components. An alley post channel blank is formed in such a manner that it has protruding slotted tabs for bolting the post bracket to the floor. This feature allows the alley post bracket to be a direct replacement of the conventional post design for updating existing applications. The formed bracket is also optionally formed from one piece of steel and is provided with appropriate mounting holes installed. The formed bracket is optionally free from protruding tabs that can cause injury to personnel and livestock. A latch security plate activates automatically when the gate is closed. As soon as the gate is closed it is secure. The latch security plate can be applied in other applications, including wall brackets, feeder brackets, back to back brackets and other similar applications.
US09238921B2
A method of building a foundation, a foundation element (2), and a foundation for an antenna mast of a wireless communication system are provided. The foundation comprises at least three foundation elements (2). Each foundation element (2) comprises an elongated body (4). The elongated body (4) comprising a first end (6). At least one bar (16) extends from the elongated body (4) at the first end (6). An attachment arrangement (18) for the antenna mast is provided on the foundation element (2). The at least three foundation elements (2) are arranged to extend substantially symmetrically from a central portion (24) of the foundation (30). A central concrete portion is cast in the central portion (24) of the foundation (30) to join the at least one bar (16) of each of the three foundation elements (2).
US09238920B1
A liftable building system includes a building structure. A foundation is configured for supporting the building structure. A substructure is disposable between the foundation and the building structure. At least one guide post is in communication with the building structure, the substructure and the foundation. The liftable building system includes a lifting system including a first end and a second end. The first end is in communication with the substructure and the second end is in communication with the foundation so that actuating the lifting system applies a force to axially displace in a substantially up and down direction the substructure with the building structure along or with the at least one guidepost relative to the foundation.
US09238919B2
A seismic isolation mechanism includes a seismic isolation apparatus which is installed at one end in a vertical direction on a superstructure and installed at another end 4 in the vertical direction on a floor serving as a foundation or a substructure to isolate the vibration of the superstructure with respect to the floor; a first attenuation damper which is connected to the superstructure and connected at another end a portion of the seismic isolation apparatus to attenuate the vibration of the superstructure with respect to the floor; and a second attenuation damper.
US09238911B2
A panel wall system includes a frame assembly adapted to support a plurality of skin assemblies in a floor-to-ceiling relationship. The panel wall system including a frame assembly having a trim member disposed thereon. The trim member includes a channel having a hollow body portion and first and second open ends disposed about a hollow middle portion. Seal members are received in the first and second open ends to seal the channel of the trim member while leaving the middle portion accessible for coupling to components of the panel wall system.
US09238910B2
A system for assembling two-sided walls on, through, and around a pre-installed structural steel grid. System wall units have an outer side and an inner side, the outer side being an outer wall surface, the inner side opposing an inner side of one or more wall units on an opposing side of the structural steel grid. Interlock elements extend through spaces in the structural steel grid and connect opposing wall units to prevent separation of the opposing wall units. Installed in courses, the wall units create a continuous void between opposing wall units, such that structural void fill material can be poured into the assembled wall at one or more openings, and the void fill material will fill the continuous void from the top of the wall to the bottom of the wall. Plumbing, electrical, and other building systems can be installed on the steel grid prior to wall assembly.
US09238908B1
A curb vent stack plunger for clearing sewer drains includes an elongated pole. A first substantially circularly shaped rubberized disc is located adjacent the bottom end of the pole and lies in a first plane perpendicular to the axis of the pole. A second substantially circularly shaped rubberized disc is secured to the pole at a distance spaced upwardly from the bottom end. The second disc lies in a second plane perpendicular to the pole axis but parallel to the first disc. A soft rubberlike semi-spherically shaped bumper is secured to the remote bottom end of the pole.
US09238905B2
A device for dispensing a predetermined, heated amount of liquid at a removal station. The latter has a liquid reservoir, a supply line from the liquid reservoir to the removal station, and an operating device for triggering a liquid removal. The supply line is adapted to the predetermined amount of liquid in regard to the internal volume of the supply line and the supply line is equipped with a heating device over the length of the supply line.
US09238901B2
A supporting mechanism supports first and second exhaust treatment devices for treating exhaust gas from an engine, and includes a sub-bracket, a base bracket, and first and second supporting members. The base bracket includes first and second connecting parts, and first and second pipe members. The sub-bracket supports the first and second exhaust treatment devices. The base bracket supports the sub-bracket. The first and second supporting members respectively support one side and the other side of the base bracket. The first and second connecting parts are respectively joined to the first and second supporting members. The first and second pipe members are installed between the first and second connecting parts. The sub-bracket is attached to the first and second pipe members, extends in the lateral direction of the first and second pipe members, and is separated from the first and second connecting parts.
US09238900B2
The front loader includes a boom actuator configured to pivotally drive a boom along a vertical direction relative to a traveling vehicle body about a first pivot axis which is oriented along a right/left direction, a bucket actuator configured to pivotally drive a bucket along the vertical direction relative to the boom about a second pivot axis which is oriented along the right/left direction, a manual controlling section for controlling operations of the boom actuator and the bucket actuator based on a manual operation of an operational tool, a boom angle detector for detecting a vertical pivot angle of the boom, a bucket angle detector for detecting a vertical pivot angle of the bucket relative to the boom, a calculating section for calculating a ground pivot angle of the bucket based on an output from the boom angle detector and an output from the bucket angle detector.
US09238892B2
A tamping tine (5) for a tamping machine consists of a tine shaft (8) and, positioned at the lower end thereof, a tine pad (9) having a pad bottom edge (10) spaced from the tine shaft (8). The tine pad (9) has pad side surfaces (11), spaced from one another in the direction of the pad bottom edge (10) and extending perpendicularly to the same, each of which connect a pad front side (12) to a pad rear side of the tine pad (9). Hardened metal plates (14) for increasing the abrasion resistance are fastened to the tine pad (9). The hardened metal plates (14) situated side by side along the pad bottom edge (10) form a common boundary line (15) both on the pad front side (12) as well as on the pad rear side. Armoring (17) in the shape of a build-up welding, standing out from a plane (16) of the pad front- or -rear side, is provided adjoining each boundary line (15).
US09238891B1
A monoblock concrete crosstie for railway tracks that achieves a high performance in operation includes a steel structure that is formed from ultra-resistant high strength steel plates embedded in a concrete element and having pre-stressed cold rolled wires with ends that form button head knots which are anchored to the steel plates. A faceted geometry allows optimal material usage and in turn increases the crosstie-ballast interlocking and stability with respect to the support surface.
US09238886B2
Disclosed is a clothes dryer having a heat pump, the clothes dryer capable of enhancing energy efficiency by recovering waste heat to the maximum in correspondence to a capacity of the heat pump, capable of enhancing reliability by preventing overheating of a compressor and a heat exchange means, and capable of shortening drying time. The clothes dryer includes a body, drum rotatably installed in the body, a suction duct installed at the body, and configured to suck external air and to supply the external air into the drum, an exhaustion duct configured to exhaust air having passed through the drum to outside of the body, and a heat pump having a heat exchange means for recovering waste heat by heat-exchanging air passing through the exhaustion duct, wherein part of the air exhausted via the exhaustion duct is heat-exchanged with the heat exchange means of the heat pump.
US09238883B2
Provided is a horizontal rotary hook for a sewing machine including: an inner rotary hook including an attracted member made of metal in an outer lower surface portion; a permanent magnet that attracts the inner rotary hook; a magnet plate that accommodates the permanent magnet and is provided with a shaft hole for mounting at a center of a diameter thereof; a non-metallic outer rotary hook that accommodates the magnet plate and has a shaft hole at a center of a diameter of an inner bottom portion thereof; and a hook supporting shaft that is inserted through the shaft hole of the magnet plate and the shaft hole of the outer rotary hook, and that includes, at an upper end thereof, a flange for rotatably supporting the outer rotary hook and the magnet plate. A rotation stopper for the magnet plate is disposed to be positioned more inward than an outer circumference edge of the permanent magnet placed in the magnet plate.
US09238874B2
A supply of metal parts are electroplated by progressively transferring the parts with a computer controlled robot into a series of open top tanks containing solutions. The tanks have submerged metal fixtures which temporarily support the parts, and each fixture in the electroplating tank is individually connected to a direct current power source through a corresponding timer switch controlled by the computer so that each part is plated for a precise time period independently of the time the part remains in the plating solution. Each fixture is coated with an insulation material and has a base with metal contact with a removable fixture member having limited metal line contact with the supporting part. A plurality of electroplating lines each include the above components, and common tanks in the lines receive an electroplating solution recirculated through a common filter and service tank where the solution is heated and controlled.
US09238873B2
The manufacturing method for high-purity Zirconium is characterized by self-propagating high temperature synthesis (SHS) of a raw material having zirconium raw ore containing ZrO2, ZrSiO4, KZr2(PO4)3, or a mixture thereof and a reducing agent that is metal powder, to prepare zirconium intermetallic compound or zirconium nitride, followed by the recovery of high-purity Zr by electrolytic refining the reaction product of the SHS.
US09238871B2
A device for high temperature electrolysis of water, including: at least one elementary electrolysis cell including a cathode, an anode, and an electrolyte intermediate between the cathode and the anode; a first device forming an electrical and fluid interconnector including a metallic part delimited by at least one plane, the metallic part including an internal chamber and plural holes distributed on the surface, approximately perpendicular to the plane and opening up on the plane and in the chamber, the plane of the first interconnector being in mechanical contact with a plane of the cathode. The device can achieve a uniform current density in each electrolysis cell and can increase steam usage ratio in each electrolysis cell.
US09238867B2
An atomic layer deposition apparatus for depositing a film in a continuous fashion is described. The apparatus includes a downwardly sloping process tunnel, extending in a transport direction and bounded by at least two tunnel walls. Both walls are provided with a plurality of gas injection channels, whereby the gas injection channels in at least one of the walls, viewed in the transport direction, are connected successively to a first precursor gas source, a purge gas source, a second precursor gas source and a purge gas source respectively, so as to create a series of tunnel segments that—in use—comprise successive zones containing a first precursor gas, a purge gas, a second precursor gas and a purge gas, respectively. The downward slope of the process tunnel enables gravity to drive the floatingly supported substrates through the successive segments, causing the atomic layer deposition of a film onto the substrates.
US09238865B2
A vapor deposition method and apparatus including at least two vessels containing a same first source chemical. A controller is programmed to simultaneously pulse to the reaction space doses or pulses of a gas from the vessels, each of the doses having a substantially consistent concentration of the first source chemical. The apparatus may also include at least two vessels containing a same second source chemical. The controller can be programmed to simultaneously pulse to the reaction space doses or pulses of a gas from the vessels containing the second source chemical, each of the doses having a substantially consistent concentration of the second source chemical. The second source chemical can be pulsed to the reaction space after the reaction space is purged of an excess of the first source chemical.
US09238858B2
A method of forming a golf club head assembly includes aligning a faceplate with a recess of a club head; welding the faceplate to the club head; then, after welding the faceplate, heating the club head and the faceplate to at least a solvus temperature of the faceplate for a predetermined amount of time; and then, after heating the club head and the faceplate, allowing the club head and the faceplate to air cool.
US09238850B2
Processes for recycling electronic components removed from printed wire boards, whereby precious metals and base metals are extracted from the electronic components using environmentally friendly compositions. At least gold, silver and copper ions can be extracted from the electronic components and reduced to their respective metals using the processes and compositions described herein.
US09238842B2
The invention provides a quick method for detecting the genus of Bacillus in samples from oil reservoirs, which comprise: collecting samples from oil reservoirs; inactivating microbes except for spore-forming Bacillus in the samples through high temperature; collecting spores from the samples; incubating the collected spores in a medium, and stimulating to resurrect Bacillus under in situ temperatures of the oil reservoirs; detecting the resurrected Bacillus in the cultures using molecular biological techniques. The present invention provides an effective method to detect the genus of Bacillus in samples from oil reservoirs, which is conducive to the discovery of the functional Bacillus for microbial enhanced oil recovery (MEOR) and to revealing the ecosystem of Bacillus in oil reservoirs.
US09238838B2
The present invention relates to methods for diagnosing, staging, prognosticating and treating melanoma based on evaluating the expression of specific patterns of oncogenic or suppressive microRNA (miR) molecules in a patient in need thereof.
US09238827B2
A biomass hydrothermal decomposition apparatus includes, a biomass feeder (31) that feeds biomass material (11) under normal pressure to under increased pressure, a hydrothermal decomposition device (41A) that allows the fed biomass material (11) to be gradually moved inside a gradient device main body (42) from a lower end thereof with a conveyor screw (43), and also allows hot compressed water (15) to be fed from an other end of a feed section (31) for the biomass material into the main body (42), so as to cause the biomass material (11) and the hot compressed water (15) to countercurrently contact with each other and undergo hydrothermal decomposition, and that transfers a lignin component and a hemicellulose component into the hot compressed water, so as to separate the lignin component and the hemicellulose component from the biomass material (11); and a biomass discharger (51) that discharges, from the upper end of the device main body (42), a biomass solid residue (17) under increased pressure to an under normal pressure.
US09238826B2
The present invention relates to a method for producing terpenes in fungi, wherein a terpene biosynthetic gene cluster having terpene biosynthetic genes and regulatory regions operably linked to said genes is activated. The invention relates also to a terpene biosynthetic gene duster and regulatory regions of such terpene biosynthetic gene cluster usable is production of terpenes, use of regulator for regulating the terpene production and use of Aspergillus nidulans FGSC A4 for producing terpenes. The method of invention provides higher yields of enriched terpene product without essential amount of side-products.
US09238825B2
Vectors and methods for the production of influenza viruses suitable as recombinant influenza vaccines in cell culture are provided. Bi-directional expression vectors for use in a multi-plasmid influenza virus expression system are provided. Additionally, the invention provides methods of producing influenza viruses with enhanced ability to replicate in embryonated chicken eggs and/or cells (e.g., Vero and/or MDCK) and further provides influenza viruses with enhanced replication characteristics. A method of producing a cold adapted (ca) influenza virus that replicates efficiently at, e.g., 25° C. (and immunogenic compositions comprising the same) is also provided.
US09238820B2
A plant comprising a modified Flowering Locus (FT) polynucleotide expressing a modified polypeptide exhibits altered flowering time, floral numbers and/or increased seed production. Different mutant sequences conferring different phenotypes are disclosed.
US09238819B2
Transgenic plants having increased growth rate and increase yield are disclosed, and methods for making the same. In one embodiment, the method comprises: transforming a plant or plant cell with a nucleic acid molecule comprising a plant kinase and/or phosphatase gene selected from NG6, NG21, NG24, NG28, and NG32, and over-expressing said kinase and/or phosphatase gene in the plant or plant cell.
US09238812B2
An RNAi molecule that can selectively and effectively suppress only the expression of a particular dominant mutant gene, while permitting the expression of the wild-type gene or a desired mutant gene, and a design method thereof is presented.
US09238804B2
Provided are hydrolases, including lipases, saturases, palmitases and/or stearatases, and polynucleotides encoding them, and methods of making and using these polynucleotides and polypeptides. Further provided are polypeptides, e.g., enzymes, having a hydrolase activity, e.g., lipases, saturases, palmitases and/or stearatases and methods for preparing low saturate or low trans fat oils, such as low saturate or low trans fat animal or vegetable oils, e.g., soy or canola oils.
US09238795B2
This invention relates to the production of populations of Smooth Muscle Cells (SMCs) of specific embryonic lineages, such as neuroectodermal and mesodermal SMCs. Pluripotent stem cells are cultured in one or more lineage induction media to produce progenitor cells of a defined embryonic lineage, which are then cultured in an SMC induction medium to produce a population of SMCs of the embryonic lineage. Populations of SMCs of defined lineages may be useful, for example, in accurately modelling vascular disease.
US09238794B2
Synthetic surfaces suitable for culturing stem cell derived oligodendrocyte progenitor cells contain acrylate polymers formed from one or more acrylate monomers. The acrylate surfaces, in many cases, are suitable for culturing stem cell derived oligodendrocyte progenitor cells in chemically defined media.
US09238790B2
An input section of an incubator accepts, from a user, a first input selecting a specified incubation container which registers an observing schedule, and a second input specifying an imaging condition of the specified incubation container in an observing sequence. A calculating section calculates, according to the above-mentioned imaging condition, an observing duration of the specified incubation container from a first data relating to a carrying period of an incubation container and a second data with regard to an imaging duration. A schedule management section extracts, based on a schedule data, a registrable time zone in which an observing sequence of the specified incubation container can be executed without overlapping with previously registered observing schedules, and outputs to display the registrable time zone for presentation to the user.
US09238788B2
Method for producing extract of Quillaja saponaria Molina saponins comprising the treatment of a commercial product of saponins from Quillaja saponaria Molina with an enzymatic pool of pectinase, protease, glycosidases and hemicellulitic enzymes, the filtering and the mixing with co-adjuvants, and the use of this extract to stabilize beer foam.
US09238787B2
A cleaning system can include a noble gas, and one or more vessels configured to convert the noble gas into a supercritical fluid, and/or receive and clean an article of manufacture with the noble gas in the supercritical fluid state. A cleaning process can include converting a noble gas into a supercritical fluid state; and cleaning an article of manufacture with the noble gas in the supercritical fluid state so as to remove one or more contaminants from the article of manufacture. A cleaning composition can include a noble gas in a supercritical fluid state, and a textile article of manufacture having one or more contaminants located in the supercritical noble gas.
US09238786B2
The present invention provides an alcohol-based stable and translucent fragrance composition containing a large amount of perfume. The fragrance composition of the present invention is a composition in which the total amount of (a) silicone oil and (b) α-olefin oligomer that is a hydrogenated trimer, tetramer, pentamer, and/or hexamer of α-olefin having 4 to 12 carbon atoms is 2 to 12% by mass in the composition, and the mass ratio of (b)/(a) is 0.1 to 0.7; the amount of (c) polyether-modified silicone with respect to (b) α-olefin oligomer is 2 to 10 times in mass; the amount of (d) perfume is 3 to 30% by mass in the composition; the amount of (e) lower alcohol having 1 to 4 carbon atoms is 50% by mass or more in the composition; the amount of (f) water is 3.5 to 15% by mass in the composition; and the L value of the composition is 70 to 95 provided the L value is a percentage (%) of strength of a transmitted light compared with a strength of an incident light.
US09238777B2
A method for producing compounds of formula (I) in which the radical R1 is selected from —NH2, —NH2-zAz, and monovalent alkyl and aryl radicals, the radicals A are selected in each case independently of one another from the phosphoryl radicals DOPO-, DPhPO- and DPhOPO-, and the indices x, y and z, in each case independently of one another, stand for 0 or 1, wherein at least one of the indices is ≠0, by reacting, in a first step, melamine or, when R1 is an alkyl or aryl radical, the corresponding alkyl or aryl guanamine, with one or more of the corresponding phosphinyl chlorides DOP-CI, DPhP-Cl and DPhOP-CI, in order to bond one or more phosphinyl radicals to the amino groups(s) of the melamine or guanamine, and in a second step oxidizing the phosphinyl radical(s) by reaction with an oxidizing agent to give the corresponding phosphoryl radical(s).
US09238774B2
A method for at least temporarily retaining moisture in a soil-based substrate includes applying an acrylamide pyranose polymer to the soil-based substrate.
US09238766B2
Provided herein are compositions useful as ink or coatings which contain novel dispersants that are capable of dispersing pigments which are traditionally difficult to disperse while maintaining acceptable levels of viscosity. Use of dispersants as taught herein enables the preparation of a wide variety of inks and coatings having high pigment loading and existing within a conventionally-useful viscosity range.
US09238760B2
A charge collection tape includes a foil substrate and an adhesive layer laminated on the foil substrate. The foil substrate is constructed of an aluminum base foil having a conductive metal coating overlying and in direct contact with a non-oxidized surface of the aluminum base foil.
US09238751B2
A polyimide precursor composition, including a polyamic acid including a repeating unit represented by Chemical Formula 1 and transparent metal oxide nanoparticles coordinated to a ligand represented by RCOOH, wherein R is a linear or branched C1-C4 alkyl or a linear or branched C2-C4 alkenyl: wherein variables Cy, A3, R31, and n34 in Chemical Formula I are described in the specification.
US09238750B2
A primer-less coating composition for facestock comprises: a binder being a water-dispersible polymer; an ethylenically unsaturated compound which is aqueous-dispersible and miscible with or bonded to said water-dispersible polymer, wherein said ethylenically unsaturated compound is able to form a covalent bond with an ink; and a crosslinker, wherein said crosslinker is suitable for binding the coating to the facestock. The coating composition may be applied to a substrate to form a printable film. A printed film in accordance with the invention may be used in a label, for example for use on a container such as a bottle.
US09238749B2
Aqueous binders for granular and/or fibrous substrates are based on polyacids and polyols.
US09238731B2
Compositions and methods for producing polymeric composites containing reinforcing additives. In one embodiment, a filler is also included in the formulation. Articles produced from the reinforcing additives and the composites of this invention are useful as building materials and automotive components.
US09238729B2
A functionalized silica product includes particles of a hydrophobated silica having a coating of a polymer. A ratio of the hydrophobated silica to the polymer is from about 0.3/1 to about 100/1. The functionalized silica product may be in the form of a friable crumb or a powder, or in the form of a bale, that may be mixed into an elastomer formulation for a rubber article, such as a tire component.
US09238728B2
A composition containing (a) at least one biodegradable/biorenewable thermoplastic material that includes poly(lactic acid) (PLA); and (b) at least one plasticizer that includes an epoxidized fatty acid alkyl ester is provided. In some embodiments, the epoxidized fatty acid alkyl ester is methyl epoxy soyate. It was found that epoxidized fatty acid alkyl esters impart a reduction in tensile modulus in compositions containing PLA. The compositions may be formed into films, such as those used in food packaging. A method that includes extruding a composition comprising PLA and at least one epoxidized fatty acid alkyl ester is provided.
US09238712B2
A polymer includes a monomeric repeat unit represented by Formula I: In Formula I, R1 is alkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, or heterocyclyl; R2 is alkyl, haloalkyl, alkenyl, alkynyl; R3 is alkyl, OH, halo, or alkoxy; R4 is alkyl, OH, halo, or alkoxy; Y is absent, C(O), C1-C4 alkylidene, or C1-C4 alkylideneamino; L is alkylidene, alkylidene-O-alkylidene, alkylidene-S-alkylidene, alkenylidene, cycloalkylidene, arylene, heteroarylene, C(O)O, or C(O)S; n1 is 0, 1, 2, 3, or 4; and n2 is 0, 1, 2, 3, or 4.
US09238700B2
Process for preparing ethylene copolymers in the presence of free-radical polymerization initiator at pressures in the range of from 160 MPa to 350 MPa and temperatures in the range of from 100° C. to 350° C. in a tubular reactor by copolymerizing ethylene, a bi- or multifunctional comonomer and optionally further comonomers, wherein the bi- or multifunctional comonomer bears at least two different functional groups, of which at least one is a unsaturated group, which can be incorporated into the growing polymer chain, and at least another functional group can act as chain transfer agent in radical ethylene polymerization, ethylene copolymers obtainable by such a process, the use of the ethylene copolymers for extrusion coating and a process for extrusion coating a substrate selected from the group consisting of paper, paperboard, polymeric film, and metal, with such ethylene copolymers.
US09238698B2
Processes and systems for the production for pressure management of a polymerization product flowing from a loop polymerization reactor to a separation vessel in a slurry polymerization system are disclosed herein. For example, a process comprises withdrawing a polymerization product slurry from a loop polymerization reactor, conveying the polymerization product slurry through a first line comprising a continuous take-off valve to yield a mixture comprising a vapor phase, wherein the mixture exits the continuous take-off valve, and conveying the mixture through a second line comprising a flashline heater so that the mixture has a Froude number in a range from about 5 to about 100.
US09238695B2
Antibodies that are agonists of sodium pump (Na+/K+ ATPase; NKA) activity are provided. In particular, antibodies that specifically bind epitopes on the beta-1 (β1) subunit of NKA are disclosed. These antibodies have the ability to increase the activity of the catalytic alpha subunit of NKA upon β1 subunit binding. Due to their activity, the antibodies also have the ability to trigger a positive inotropic effect in cardiac tissues (i.e., increase cardiac contraction). The present invention thus includes, but is not limited to, NKA β1 subunit peptide epitopes, antibodies that specifically bind the epitopes, methods of agonizing NKA activity through administration of the peptides or the antibodies, and methods of treating and/or preventing heart disease through administration of the peptides or the antibodies.
US09238687B2
The present invention provides a method capable of producing a natural or recombinant protein at low cost. The present invention relates to a method of producing a polypeptide, comprising culturing a cell which strongly expresses a taurine transporter and has a transferred DNA encoding a desired polypeptide and thereby allowing the cell to produce the polypeptide. Hamster taurine transporter, a DNA encoding the same, a recombinant vector and a transformed cell are also provided.
US09238679B2
Provided herein are nucleic acid sequences encoding hepatitis B virus (HBV) core proteins, surface antigen proteins, fragments and combinations thereof as well as genetic constructs/vectors and vaccines that express said protein sequences. These vaccines are able to induce an immune response peripherally and in the liver by recruiting both cellular and humoral agents. Also provided are methods for prophylactically and/or therapeutically immunizing individuals against HBV. The combination vaccine can also be used for particular design vaccines for particular levels of immune responses to HBV challenge.
US09238678B2
The present invention discloses a genus of insect inhibitory proteins that exhibit properties directed to controlling Lepidopteran and/or Hemipteran crop pests, methods of using such proteins, nucleotide sequences encoding such proteins, methods of detecting and isolating such proteins, and their use in agricultural systems.
US09238677B2
The invention provides novel guanylate cyclase-C agonist peptides and their use in the treatment of human diseases including gastrointestinal disorders, inflammation or cancer (e.g., a gastrointestinal cancer). The peptides can be administered either alone or in combination with an inhibitor of cGMP-dependent phosphodiesterase. The gastrointestinal disorder may be classified as either irritable bowel syndrome, constipation, or excessive acidity etc. The gastrointestinal disease may be classified as either inflammatory bowel disease or other GI condition, including Crohn's disease and ulcerative colitis, and cancer.
US09238671B2
Transposomes and oligonucleotide replacement methods to make DNA libraries that have distinct 5′ and 3′ tags, and to make directional libraries that are enriched for a desired strand.
US09238664B2
A sulfur-containing organosilicon compound having a hydrolyzable silyl group, sulfide group and amide group is shelf stable and useful as a rubber compounding ingredient. When compounded in a rubber composition, the organosilicon compound is effective for significantly reducing the hysteresis loss and improving the abrasion resistance of the rubber composition.
US09238662B2
A purpose of the present invention is to provide a polymerizable group-containing silicone compound which is liquid at room temperature, has good handling properties and compatibility with other polymerizable monomers. The present invention provides a silicone compound represented by the general formula (1) which has a structure represented by the following formula (2) or (3): wherein Rc is an alkyl group having 1 to 10 carbon atoms and Z is a radical-polymerizable group; wherein p1 and p2 are, independently of each other, positive integers such that a total number of p1 and p2 is 3 to 10, and Z is a radical-polymerizable group; and has a silicone structure bonded to the aforesaid formula (2) or (3) via a substituted or unsubstituted divalent hydrocarbon group having 1 to 10 carbon atoms. The present invention further provides a method for preparation the aforesaid silicone compound.
US09238656B2
This application relates to compounds of the Formula I as defined herein, and/or salts thereof. This application further relates to compositions and methods of using these compounds and/or salts thereof. The compounds of Formula I are useful as ALK and JAK modulators for the treatment of proliferative disorders.
US09238654B2
According to the embodiments described herein, a SUMOylation inhibitor compound comprising a singleton scaffold is provided. In some embodiments, a method for inhibiting a SUMOylation enzyme in a cell is provided. Such a method may include administering a SUMOylation inhibitor compound to the cell. In some aspects, the SUMOylation enzyme is SUMO E1 or SUMO E2. In some aspects, the method may be used to inhibit a cancer cell in vitro (e.g., grown in culture) or in vivo (e.g., as part of a tumor in a subject). In other embodiments, a method for treating a cancer, degenerative diseases and viral infection is provided. Such a method may include administering an effective amount of a pharmaceutical composition to a subject having the cancer. The pharmaceutical composition may include a singleton SUMOylation inhibitor compound. In some embodiments, the method for treating a cancer may further comprise administering one or more DNA-damaging therapy in combination with administration of the pharmaceutical composition.
US09238651B2
1H-Pyrrolo[2,3-b]pyridine compounds are inhibitors of cell proliferation/cell vitality and can be employed for the treatment of tumours.
US09238650B2
Disclosed are solid forms of 1-[(2-chloro-5-thiazolyl)methyl]-3-(3,5-dichlorophenyl)-2-hydroxy-9-methyl-4-oxo-4H-pyrido[1,2-a]pyrimidinium inner salt (Compound 1). Methods for the preparation of solid forms of Compound 1 and for the conversion of one solid form of Compound 1 into another are disclosed.Disclosed are compositions for controlling an invertebrate pest comprising a biologically effective amount of a solid form of Compound 1 and at least one additional component selected from the group consisting of surfactants, solid diluents and liquid carriers. Compositions comprising a mixture of a solid form of Compound 1 and at least one other nematocide, insecticide and/or fungicide are also disclosed.Also disclosed are methods for controlling invertebrate pests comprising applying to a plant or seed, or to the environment of the plant or seed, a biologically effective amount of a solid form of Compound 1.
US09238647B2
The subject invention relates to novel P2X3 receptor antagonists that play a critical role in treating disease states associated with pain, in particular peripheral pain, inflammatory pain, or tissue injury pain that can be treated using a P2X3 receptor subunit modulator.
US09238643B2
A compound represented by formula (I) and the pharmaceutical acceptable salt thereof are disclosed, wherein, R1, R2, R3, R4, R5 and Ar are defined as those in the specification.
US09238640B2
Disclosed are novel compounds that are useful in regulating the expression of interleukin-6 (IL-6) and/or vascular cell adhesion molecule-1 (VCAM-1), and their use in the treatment and/or prevention of cardiovascular and inflammatory diseases and related disease states, such as, for example, atherosclerosis, asthma, arthritis, cancer, multiple sclerosis, psoriasis, and inflammatory bowel diseases, and autoimmune disease(s). Also, disclosed are compositions comprising the novel compounds, as well as methods for their preparation.
US09238639B2
The present invention provides a compound having a GOAT inhibitory action, which is useful for the prophylaxis or treatment of obesity and the like, and has superior efficacy. The present invention is a compound represented by the formula (I): wherein each symbol is as defined in the specification, or a salt thereof.
US09238634B2
The purpose is to provide a compound which can overcomes the disadvantages of conventional steroid drugs and NSAID. It is found that specific epoxy monohydroxy forms of eicosapentaenoic acid, docosahexaenoic acid and docosapentaenoic acid which are independently represented by formulae [chemical formula 1], [chemical formula 5] and the like have an inhibitory activity on neutrophils. This compound can inhibit the invasion of neutrophils into tissues and the activation of neutrophils which are observed in acute inflammations.
US09238631B2
This invention relates to novel compounds suitable for labeling by 18F and to the corresponding 18F labeled compounds themselves, 19F-fluorinated analogs thereof and their use as reference standards, methods of preparing such compounds, compositions comprising such compounds, kits comprising such compounds or compositions and uses of such compounds, compositions or kits for diagnostic imaging by Positron Emission Tomography (PET).
US09238629B2
The present invention provides compounds, pharmaceutically acceptable compositions thereof, and methods of using the same.
US09238628B2
The present invention relates to phenyl amino pyrimidine compounds which are inhibitors of protein kinases including JAK kinases. In particular the compounds are selective for JAK2 kinases. The kinase inhibitors can be used in the treatment of kinase associated diseases such as immunological and inflammatory diseases including organ transplants; hyperproliferative diseases including cancer and myeloproliferative diseases; viral diseases; metabolic diseases; and vascular diseases.
US09238620B1
The invention relates to uses of the sulfur-containing compound in inhibiting activities of a factor related to cancer metastasis and/or growth. Preferably, the invention relates to uses of the sulfur-containing compound in inhibiting lung cancer metastasis and/or growth.
US09238613B2
Described herein are intermediate compounds and derivatives thereof that can be synthesized during the preparation of 2,4,5-trifluorophenylacetic acid and derivatives thereof.
US09238607B1
The invention concerns a process for the catalytic production of unsaturated aldehydes by reacting an olefin in the presence of carbon monoxide and hydrogen, a rhodium compound and organic phosphorus-containing ligands in an organic solvent as well as a co-catalyst formed from a weak organic acid and an organic amine.
US09238595B2
A method of smoothing the surface of a ceramic matrix composite part presenting a surface that is undulating and rough. The method includes forming a ceramic coating on the surface of the part, the coating being made by applying a liquid composition on the surface of the part, the composition containing a ceramic-precursor polymer and a factory solid filler, curing the polymer, and transforming the cured polymer into ceramic by heat treatment. The method further includes impregnating the ceramic coating with a liquid metallic composition.
US09238593B2
There is provided a ceramic member which is a sintered body containing enstatite and boron nitride as constituents, in which boron nitride is oriented in a single direction, a probe holder formed using the ceramic member, and a manufacturing method of the ceramic member. In the ceramic member, an index of orientation degree is not less than 0.8. In so doing, it is possible to provide a ceramic member which has a free machining property, a coefficient of thermal expansion which is close to that of silicon, and high strength, and a probe holder which is formed using the ceramic member, and a manufacturing method of the ceramic member.
US09238592B2
What are described are magnetocaloric materials of the general formula (MnxFe1−x)2+zP1−ySiy where 0.55≦x<1 0.4≦y≦0.8 −0.1≦z≦0.1.
US09238590B2
A method for the production of a mirror element (10) that has a reflective coating (10a) for the EUV wavelength range and a substrate (10b). The substrate (10b) is pre-compacted by hot isostatic pressing, and the reflective coating (10a) is applied to the pre-compacted substrate (10b). In the method, either the pre-compacting of the substrate (10b) is performed until a saturation value of the compaction of the substrate (10b) by long-term EUV irradiation is reached, or, for further compaction, the pre-compacted substrate (10b) is irradiated, preferably homogeneously, with ions (16) and/or with electrons in a surface region (15) in which the coating (10a) has been or will be applied. A mirror element (10) for the EUV wavelength range associated with the method has a substrate (10b) pre-compacted by hot isostatic pressing. Such a mirror element (10) is suitable to be provided in an EUV projection exposure system.
US09238589B2
Technologies are generally described for processes, compositions and systems for waste sludge dewatering. In an example, the process may include receiving a waste sludge including a water component and an initial content of suspended particulates. The process may include treating the waste sludge with a combination of flocculant produced by Proteus mirabilis and a flocculant including chloride. The combination may be sufficient to flocculate at least some of the suspended particulates in the water component of the waste sludge and sufficient to produce treated waste sludge. The treated waste sludge may have a water component with a reduced content of suspended particulates. The process may include separating at least some of the water component with a reduced content of suspended particulates from the treated waste sludge to produce dewatered waste sludge.
US09238581B2
An integrated circuit structure includes a triple-axis accelerometer, which further includes a proof-mass formed of a semiconductor material; a first spring formed of the semiconductor material and connected to the proof-mass, wherein the first spring is configured to allow the proof-mass to move in a first direction in a plane; and a second spring formed of the semiconductor material and connected to the proof-mass. The second spring is configured to allow the proof-mass to move in a second direction in the plane and perpendicular to the first direction. The triple-axis accelerometer further includes a conductive capacitor plate including a portion directly over, and spaced apart from, the proof-mass, wherein the conductive capacitor plate and the proof-mass form a capacitor; an anchor electrode contacting a semiconductor region; and a transition region connecting the anchor electrode and the conductive capacitor plate, wherein the transition region is slanted.
US09238580B2
A MEMS sensor includes a micro-electromechanical structure, a detection circuit, and a self-test circuit to test the health of the MEMS sensor during runtime operations. The self-test circuit is configured to inject into the micro-electromechanical structure a plurality of injected test signals that are broad-band frequency-varying frequency signals, which are based on spread spectrum based modulation. The injected test signals may a magnitude that is below an observable threshold of the sensor signal as well as a test-signal bandwidth that overlaps with a substantial portion of the sensor bandwidth, including the stimulus of interest.
US09238577B2
Dynamic radiation beam shaping methods and systems, comprising: providing a radiation source for delivering an input radiation beam; disposing a first optical element substantially adjacent to the radiation source; disposing a second optical element substantially adjacent to the first optical element; and moving one or more of the first optical element and the second optical element relative to one another such that either an output radiation beam has a variable predetermined shape or the output radiation beam maintains a predetermined shape when the input radiation beam is varied. Optionally, the first optical element and the second optical element each comprise a freeform shape and predetermined diffractive characteristics, refractive characteristics, reflective characteristics, hybrid characteristics, gradient index materials, metamaterials, metasurfaces, subwavelength structures, and/or plasmonics. The one or more of the first optical element and the second optical element are one or more of translated laterally with respect to an optic axis, rotated about the optic axis, tilted with respect to the optic axis, and separated along the optic axis.
US09238574B2
A portable beverage dispensing apparatus including a spout assembly, a handle assembly pivotally attached to the spout assembly, and a first and second pressure regulator disposed within the handle assembly.
US09238572B2
Orbital winch having: lower and upper frames; spool having upper and lower flanges with lower flange attached to lower frame; axial tether guide mounted to upper frame; secondary slewing ring coaxial with spool and rotatably mounted to upper frame, wherein secondary slewing ring's outer surface has gearing; upper tether guide mounted to inner surface of secondary slewing ring; linear translation means having upper end mounted to upper frame and lower end mounted on lower frame; primary slewing ring rotatably mounted within linear translation means allowing translation axially between flanges, wherein primary slewing ring's outer surface has gearing; lower tether guide mounted on primary slewing ring's inner surface; pinion rod having upper end mounted to upper frame and lower end mounted to lower frame, wherein pinion rod's teeth engage primary and secondary slewing rings' outer surface teeth; and tether passing through axial, upper, and lower tether guides and winding around spool.
US09238570B2
A system for tracking movable crane components to assist maneuvering the crane within a jobsite includes a computing device having a processor which calculates a 3D geospatial location and orientation of a 3D coordinate system for an upperworks that has an origin chosen along an axis of rotation between the upperworks and a lowerworks. The processor calculates a 3D position of the origin of the upperworks based on local coordinates and transforms the 3D position of the origin of the upperworks from the local coordinates to global 3D coordinates using absolute position sensing data from first and second positioning sensors attached to the crane (for instance on the upperworks and the hook, respectively) and using global 3D coordinates specific to the jobsite where the crane is located. The upperworks 3D coordinate system is useable to determine line segments in the upperworks 3D coordinate system for various movable components.
US09238569B2
Controlling the orientation of a load suspended from a bearing wire employs one master winch, one slave winch and a winch control. Each of the winches has a motor and a bi-directional rotational spool with a tagline. The winches are on the ground, the crane or the load. Each tagline is attached to the load for applying a controlled torque to the load about the bearing wire. The control system comprises tagline tension sensors and spool rotation sensors. The control system is connected to each winch motor for simultaneously rotating the winch spools, until preset tagline tensions are sensed during horizontal and/or vertical movement of the load. If necessary, the spools are rotated with rotation speeds for maintaining a desired orientation of the load, based on the determined tagline tensions. After relieving tagline tensions, the taglines are disconnected from the load.
US09238565B2
According to one embodiment, a sheet processing method of a sheet processing apparatus having a plurality of processing modes includes taking in sheets one by one from a bundle of the sheets in which a batch card having identification information, and the sheets as mediums to be inspected are piled, conveying the sheet which has been taken in, discriminating a kind of the batch card, switching the processing mode of the sheet processing apparatus based on the kind of the batch card which has been discriminated, discriminating and counting the sheets subsequent to the batch card, storing a count result of the sheets in correlation with the identification information, and sorting the sheet into a stacker based on a discrimination result of the sheet.
US09238562B2
An image forming apparatus, including a main body with a first sheet outlet tray and an image forming unit, a feed path configured to guide a sheet from the image forming unit toward the first sheet outlet tray, is provided. The feed path includes a first exit path to guide a sheet toward the first sheet outlet tray and a first duplex path diverging from the feed path to guide a sheet to return to the image forming unit. The main body is attachable with a sheet-exit unit. The sheet-exit unit includes a second sheet outlet tray, a second exit path, and a second duplex path. The second exit path guides a sheet to the second sheet outlet tray. The second exit path is connected with the first exit path when the sheet-exit unit is attached to the main body.
US09238558B2
A reciprocating placer system for selectively picking and placing articles includes a picking assembly that is moveable between one or more magazines in which the articles are each received and stored in a stacked configuration. The picking assembly can include a series of vacuum cups for engaging and selectively picking articles from one or more magazines and thereafter depositing the selected articles on a conveyor or within a receptacle. A drive system controls the transverse movement of the picking assembly with respect to the one or more magazines in order to control the movement of the picking assembly between the one or more magazines and for adjusting the position of the picking assembly, with a selected article engaged thereby, with respect to the conveyor or receptacle on which the article is to be deposited.
US09238540B2
Disclosed herein are protective inserts for sensitive devices, including devices with screen interfaces, which cases provide protection from front, back and edge impacts.
US09238539B2
A method of hydrating a human can include: providing a bicep hydration sleeve; attaching the hydration sleeve to a bicep region of the human; lifting the hydration sleeve to the mouth of the human by moving the bicep toward the chin; inserting the mouthpiece of the hydration sleeve into the mouth; and drinking from the hydration sleeve, wherein the lifting, inserting, and drinking are performed without handling the hydration sleeve with either hand of the human.
US09238537B2
An improved method and apparatus for making a multi-compartment package on a form, fill, and seal machine. Two pairs of heat sealing jaws are provided below a product delivery tube.
US09238534B2
A waterproof closure system 1 including a plate 20 having a periphery 21 and at least one closure member 30 which can be fitted around the periphery of the plate so that when they are joined the closure member forms a border around the periphery of the plate. The closure member has at least two elements 30a,30b separated by a split 41 with there being a locking means, for example having a male part 42 provided on a first element on one side of said split and a female part 44 provided on a second element on the other side of said split that can lock the two elements together o closing the split and tightening the closure member around the periphery of the plate thereby locking a mouth of a bag placed around the plate between the plate periphery and closure member.
US09238533B2
A fluid preservation device, for preserving a liquid within a container, which includes an elongated member with a proximal end and a distal end and an inner shaft and an outer shaft. The outer shaft and inner shaft are attached to an expandable sealing member. The expandable sealing member has an expanded state and a collapsed state and a state change mechanism attached to the proximal end of the elongated member to change the state of the expandable sealing member between the expanded state and the collapsed state. When the expandable sealing member is in the collapsed state, it can pass through an opening of a container and when the expandable sealing member is in the expanded state it is big enough to contact the inner surface of the container near the surface of the liquid.
US09238530B2
The present invention provides a resealable closure system that may be incorporated into a container for storing and dispensing moisture sensitive product, such as a dry wiping substrate and more preferably a dry wipe useful for facial cleansing or the application of make-up. The closure system is not only resealable, but is also substantially watertight as a result of the lid having a sealing flange and an overhang.
US09238528B2
A dual-cup assembly includes an inner cup and an outer cup in which the inner cup is inserted. Each of the inner and outer cups has flange extending from the outside thereof. A fastening unit is mounted to the two respective flanges to connect the inner cup and the outer cup together. A room is defined between the inner cup and the outer cup.
US09238524B2
A cup made of paper material having a fillable interior is provided. The cup is formed by a conical sleeve and a bottom. The bottom is attached to the sleeve at the lower end of the interior with a bottom skirt in an essentially liquid-tight way. The sleeve and/or the bottom in the area of the bottom skirt and/or the bottom skirt itself includes, at least in one area along the periphery, an outwardly projecting widening. A lower edge of the widening forms a standing surface for the cup. The widening can form a structure for holding another cup of the same type, which structure can act together with a similar cup during stacking. The cup can include a heat-insulting outer sleeve.
US09238523B1
A corrugated box container with a main component including a base section and first and second side sections. The box container additionally includes first and second side support components associated with the first and second side sections for reinforcing the first and second side support sections. The box container further includes a cover component that is capable of engagement with the main component or the first and second side support components, such that the main component and the cover component present a fully enclosed space within the box container. The box container is erected from a knockdown configuration by folding the first and second side sections until the side sections are generally perpendicular with the base section; connecting the first and second side support components with the first and second side sections respectively; and connecting the cover component with the main component or the first and second side support components.
US09238521B2
Disclosed is a synthetic resin container provided with an inverting, foldback bottom wall that can maintain a stable, self-supporting position while being able to minimize the amount of residual contents, and that can be formed by blow-molding, etc., and maintain the favorable producibility or low cost of the past. The synthetic resin container is provided with a bottom wall that forms the bottom of the container, and a drum section that is united to the perimeter of the bottom wall and forms a filling space M for contents on the inside, and is a synthetic resin container wherein a raised bottom is formed by inverting and folding back said bottom wall toward said drum section. Said drum section has a lower peripheral wall that touches or approaches the outer wall part of said bottom wall and forms a self-supporting base by the inversion and folding back of said bottom wall.
US09238517B2
A blank includes a main body; at least one support connected to the main body; and at least one support brace connected to at least one of the main body and at least one support. A packaging system includes a blank, the blank including a main body, at least one support connected to the main body, and at least one support brace connected to at least one of the main body and at least one support; and shrinkwrapping. A support may be a panel. A box may be included.
US09238515B2
A filling assembly for filling of a tube of packaging material having a seal starting at a first level, comprises a conduit arranged to lead liquid into the tube of packaging material below said first level and a passage arranged to eject gas through openings into the tube of packaging material below said first level. The filling assembly is characterized in that a gasket is arranged to provide a seal between said filling assembly and said tube of packaging material upstream said openings such that the overpressure P1 downstream the gasket may exceed an ambient pressure Pa upstream the gasket.
US09238514B2
An apparatus for loading material into a stent strut can comprise a chamber capable of maintaining an internal pressure below pressure external to the chamber. The chamber carries within it the stent and the material to be loaded into a lumen within the stent strut. Pressure within the chamber is decreased. The decreased pressure can draw the material into lumen. The decreased pressure can draw air out of the lumen so that, after a subsequent increase in pressure in the chamber, the material is drawn into the lumen.
US09238507B2
Current TAWS systems generally do not provide alerts based on structures or wire obstacles. Such structures and wire obstacles include transmission and electrical wires, and power lines, bridges, and buildings. The current system allows just such alerting. Such alerts are particularly useful for helicopter aircraft, which commonly fly at heights where such structures and obstacles are present near the normal flying altitude of the aircraft. Certain implementations of the system and method include a method of creating an obstacle for use in a terrain awareness warning system, including: receiving data about a first terminus of an obstacle; receiving data about a second terminus of the obstacle; constructing a virtual volume about the first and second termini and a volume therebetween; and storing the virtual volume, whereby a database may be constructed of virtual volumes for use in addition to terrain information to provide alerting on obstacles for an aircraft.
US09238505B2
A multilayer laminate comprising in order, a polymeric film layer capable of withstanding a temperature of at least 200 C for at least 10 min, an adhesive layer having an areal weight of from 2 to 40 gsm capable of activation at a temperature of from 75 to 200 degrees C. and an inorganic refractory layer wherein the refractory layer comprises platelets in an amount at least 85% by weight with a dry areal weight of 15 to 50 gsm and has a residual moisture content of no greater than 10 percent by weight.
US09238503B2
A transmission is structured to include a drive shaft, a counter shaft, a gear train bridged between each of a drive shaft input shaft and output shaft and the counter shaft, and a dog clutch mechanism selectively switching a high shift speed and a low shift speed in a transmission chamber. In a lower part of a lower bearing of the counter shaft in a bottom part of the transmission chamber, a lower reserve part of lubrication oil is provided, and a lubrication oil pump sending lubrication oil to respective parts of the transmission from the lower reserve part is provided.
US09238501B1
A bilge keel design for improved ship roll damping performance. The bilge keel has a porous region substantially at a forward end, and is designed to alleviate and mitigate added drag from flow misalignment due to scale effects and variation in vessel speed and loading conditions. The bilge keel design is use on both port and starboard sides of the vessel hull.
US09238490B1
An aerodynamic component in the form of, for example, a fairing is provided. The fairing is attached or otherwise positioned at the entry of or within the fender well of the vehicle. In use, the fender well fairing aims to block entry of airflow into the interior area of the vehicle as well as reduces or eliminates direct impingement against interior surfaces of the fender well. This improves air flow, thereby reducing drag.
US09238486B2
Side rail for trailer floor with a first C-beam extending adjacent to a first longitudinally extending edge. An opening of the first C-beam faces away from the first longitudinally extending edge, and a back of the first C-beam is secured to the upward extending rim of the first longitudinally extending edge. A second C-beam extends adjacent to the second longitudinally extending edge, wherein an opening of the second C-beam faces away from the second longitudinally extending edge, and a back of the second C-beam is secured to the upward extending rim of the second longitudinally extending edge. A first corrugated rail extends longitudinally within the first C-beam, wherein peaks and valleys of the first corrugated rail contact inner walls of the first C-beam, and a second corrugated rail extends longitudinally within the second C-beam, wherein peaks and valleys of the second corrugated rail contact inner walls of the second C-beam.
US09238485B2
A vehicle body lower structure includes: a floor connected to a dashboard panel, extending toward the vehicle rear side; a tunnel provided at a vehicle width direction center portion extending from the dashboard panel through the floor in the vehicle front-rear direction; a dashboard cross member joined to the dashboard panel, spanning in the vehicle width direction between a front end of the tunnel and a vehicle side section; and an under floor brace provided to a front end portion of the tunnel, extending in the vehicle width direction at the opposite side to the cabin, including both ends extending further toward the vehicle width direction outside than the front end portion of the tunnel and are fixed to the dashboard panel, the ends being located in positions facing vehicle width direction inside ends of the dashboard cross member via the dashboard panel.
US09238472B2
The wheel set shaft of a rail vehicle is protected in an effective and economical manner by a protection device. The device includes an elastomeric mat which can be easily placed on the wheel set shaft and retaining means for retaining the elastomeric mat on the wheel set shaft.
US09238468B2
Various methods and systems are provided for a system for an engine. In one example, the system includes an exhaust passage through which exhaust gas is configured to flow from the engine. The system further includes an aftertreatment system disposed in the exhaust passage, the aftertreatment system including an aftertreatment device and a bypass with a bypass control element, the bypass control element adjustable to reduce exhaust gas flow through the aftertreatment device during tunneling operation.
US09238461B1
A method for managing output bump/clunk in a neutral state in a strong hybrid vehicle includes calculating a motor torque for an electric traction motor connected to a third node of a planetary gear set. The motor torque is calculated as a product of a predetermined inertia of the electric traction motor, the calculated acceleration of the engine, and a gear ratio of the planetary gear set. The calculated motor torque is commanded from the electric traction motor via a controller in a direction opposite the calculated acceleration of the output shaft, including transmitting a motor torque command to the electric traction motor for the duration of the neutral state. The vehicle includes the engine, a damper assembly, the transmission, and the controller.
US09238457B2
Methods and systems for controlling a transmission coupled to an engine during an engine start are presented. In one example, a method adjusts a transmission tie-up force in response to an indication of transmission slip. The method may improve vehicle launch for stop/start vehicles.
US09238450B1
Exemplary methods and vehicles are disclosed. Exemplary methods may include determining that a vehicle is a fleet vehicle, establishing a presence of a configuration bit indicating the vehicle is a fleet vehicle, receiving an indication of a conclusion of a vehicle usage session as a fleet vehicle, and resetting a plurality of user-adjustable vehicle parameters to a default setting in response to the conclusion of the vehicle usage. Other exemplary methods may include installing a configuration bit into a vehicle, which indicates that the vehicle is a fleet vehicle, and providing a processor for the vehicle. The processor may be configured to reset a plurality of user-adjustable vehicle parameters to a default setting in response to the configuration bit and an indication of a conclusion of a vehicle usage associated with the vehicle.
US09238448B2
A belt retractor for safety belts of motor vehicles comprises a housing frame made of plastic for receiving a belt reel. The housing frame 10 is designed an open, U-shaped frame, on the open front face of which a reinforcing plate 59 made of plastic is fastened. In addition, a belt retractor for safety belts of motor vehicles comprises a housing frame of plastics material for receiving a belt reel. A pawl co-operating with the belt reel is mounted in the housing frame. The pivoting path of the pawl is limited by a bearing surface formed in the housing frame.
US09238442B2
An energy management system (EMS) controls the energy flows in a vehicle by adapting pricing rules. In the EMS the price (Pm, P2, PB1) of the energy is variable dependent of the momentary supply of energy in a global energy system, i.e. the vehicle. Each auxiliary system (GEN, B, C) in the global energy system has in individual price limit, above which the auxiliary system (GEN, B, C) won't purchase any more energy. Some auxiliary systems (B) have variable price limits depending of those auxiliary systems parameters. The auxiliary systems (GEN, B, C) are represented in the EMS by activation agents (CA1, CA2, CAn, BA1, BAn), which have different behavior depending of what kind of auxiliary system they represent. Said activation agents (CA1, CA2, CAn, BA1, BAn) control the energy flows in the global energy system. In the EMS the energy systems are divided into two categories; energy main system and energy auxiliary systems.
US09238435B2
The invention relates to a device for monitoring an environment of a vehicle, wherein the environment is captured by means of a plurality of image capturing units, the capture ranges (2) thereof at least partially overlapping each other and forming an overlap range (3), wherein an overall image is generated from the individual images captured by means of the image capturing units by means of an image processing unit, said overall image showing the vehicle and the environment thereof from a bird's-eye view. According to the invention, the image capturing units are designed as wafer-level cameras (1).
US09238434B2
The invention relates to an exterior mirror simulation with image data recording and a display of the recorded and improved data for the driver of a motor vehicle. The display on a display device shows the data in a way chosen by the driver or the vehicle manufacturer.
US09238414B2
A rack system is provided that includes a plurality of trays configured to hold a respective plurality of battery-powered UAVs, and a frame configured to support the plurality of trays in a vertical arrangement. Each tray of the plurality of trays includes a platform, bumper and first plurality of electrical contacts. The platform may be configured to carry a UAV of the plurality of battery-powered UAVs. The bumper may be sized and positioned on the platform to guide the UAV to a resting position on the platform. And the first plurality of electrical contacts may be connected to a battery-charging apparatus, and configured to physically and electrically contact a respective second plurality of electrical contacts connected to a respective plurality of batteries on the UAV at the resting position on the platform. A related battery-charging apparatus including a charge switching system for charging battery-powered UAVs is also provided.
US09238413B2
A charge control system of one or more batteries B is electrically connected with one or more solar panels S, so configured to obtain the maximum transfer of power from such one or more solar photovoltaic panels S and for controlling the charge of the one or more batteries B. The control system includes: at least one tracking device of the point of maximum power or MPPT 2 adapted to adjust one of its input impedance seen from panels S for a power adaptation with panel S; at least one protection circuit of the system 3 adapted to avoid damages to the charge control system caused by inverted currents, coming from such battery B and from one or more electric equipment 8 connected with it.
US09238412B2
A method of operating a vehicle having a friction braking system and a regenerative braking system is presented here. The method determines a regenerative torque capacity, calculates a desired regenerative torque amount for the braking system, detects that the desired regenerative torque amount exceeds the regenerative torque capacity by at least a threshold amount, and controls actuation of the friction braking system in response to the detecting. Another operating method determines a coastdown torque capability of the vehicle, calculates a desired coastdown torque amount, detects that the desired coastdown torque amount exceeds the coastdown torque capability by at least a threshold amount, and controls actuation of the friction braking system in response to the detecting.
US09238406B2
A motor vehicle having: prime mover means; at least first and second groups of one or more wheels; and a driveline to connect the prime mover means to the first and second groups of one or more wheels such that the first group of one or more wheels may be driven by the prime mover means when the driveline is in a first mode of operation and the second group of one or more wheels may additionally be driven by the prime mover means when the driveline is in a second mode of operation, the driveline including an auxiliary portion comprising releasable torque transmitting means operable to connect the second group of one or more wheels to a torque transmission path from the prime mover means when the driveline transitions between the first mode and the second mode, the vehicle comprising control means operable automatically to control the driveline to transition from the first mode to the second mode and from the second mode to the first mode, the control means being operable to prevent a transition from the first mode to the second mode and/or from the second mode to the first mode in dependence on a value of a prescribed vehicle operating temperature.
US09238402B2
A vehicle control apparatus for a vehicle that includes an internal combustion engine and an electric motor, and that is capable of traveling by motive power from at least one of the internal combustion engine and the electric motor includes: a control portion that causes the vehicle to travel in a travel mode of a plurality of travel modes that differ in an engine start condition for the internal combustion engine; and a determination portion that determines whether exhaust from the internal combustion engine has deteriorated, wherein the determination portion changes the deterioration determination condition for determining that the exhaust has deteriorated, according to the travel mode.
US09238398B2
An exemplary refrigeration system for cooling food or beverages may use a liquid cooling system of a vehicle. The refrigeration system may include a compartment in which the food or beverages may be placed and removed, a chilled liquid coolant system having a connection through which liquid coolant is received from the liquid cooling system of the vehicle, and a heat exchanger operationally coupled with the chilled liquid coolant system and the compartment to transfer heat from the compartment into the liquid coolant. The refrigeration system may also include a second chilled coolant system through which a second coolant flows and a second heat exchanger operationally coupled with the second chilled coolant system and the compartment to transfer heat from the compartment. The chilled liquid coolant system and the second chilled coolant system may operate together as a cascade cooling system.
US09238397B2
A motor vehicle air conditioning arrangement having a heater (H) and an evaporator (V) which are arranged in an air guiding housing (2). Each of the heater and evaporator have a plane that is traversed perpendicularly by air and have an inclined position such that the planes are each arranged at an angle of less than 40° with respect to the horizontal plane (E).
US09238395B2
A rear wheel suspension including first and second suspension devices carrying a right and left, respectively, rear wheel rotating in a wheel plane forming a toe angle with respect to a longitudinal axis and a camber angle with respect to a vertical axis. A transversal beam connects the first and the second suspension device. Each suspension device includes a wheel spindle housing, defining a wheel center, and a leading link and a trailing link connected to the vehicle body. The transversal beam permits bending for vertical loads to provide the suspension devices a deflection to adjust the toe and camber angles such that the changes of the camber angles when the wheel planes converge towards an upper point above the wheel center connect to a controlled adjustment of the toe angles such that the wheel planes converge directionally towards a rear point located rearwards of the wheel center.
US09238387B2
A pneumatic tire includes an inner liner disposed inwardly in the tire relative to a carcass ply bridged between a pair of bead portions, the inner liner being formed of a first layer disposed inwardly in the tire, and a second layer disposed in contact with a rubber layer of the carcass ply, the first layer being a thermoplastic elastomer composition mainly containing a styrene-isobutylene-styrene block copolymer, the second layer being a styrene-based thermoplastic elastomer composition, (a) at least one of the thermoplastic elastomer compositions of the first and second layers containing a tackifier by 0.1 part by mass to 100 parts by mass relative to 100 parts by mass of a thermoplastic elastomer component, or (b) the second layer containing the styrene-isobutylene-styrene block copolymer by 10 mass % to 80 mass % relative to a thermoplastic elastomer component thereof.
US09238381B2
The purpose of the present invention is to provide a sheet bundle binding processing apparatus capable of performing a binding process on a sheet bundle set at a manual setting portion and a sheet bundle set on a processing tray, respectively, with a simple structure at low cost. The present invention comprises a sheet bundle binding processing apparatus including an external casing, a manual setting portion which is integrally formed with the external casing and to which a sheet bundle is inserted, a binding device which performs a staple-binding process on the sheet bundle inserted to the manual setting portion as being movable between a binding position where the sheet bundle of the manual setting portion is bound and a staple replenishment position where staples are replenished, and an open-close cover which is arranged at the external casing at a position being different from the manual setting portion.
US09238376B2
There are provided a thermal head capable of decreasing the possibility of occurrence of layer separation in a protective layer, and a thermal printer equipped with the same. A thermal head includes a substrate; an electrode disposed on the substrate; an electric resistor connected to the electrode, part of which serves as a heat-generating section; and a protective layer disposed on the electrode and on the heat-generating section. The protective layer includes a first layer containing silicon nitride or silicon oxide; and a second layer disposed on the first layer, containing tantalum oxide and silicon oxynitride.
US09238369B2
A meeting surface between inks injected from the injection needles can be made closer to the filter by varying the timings of the ink injections from the plurality of injection needles, whereby larger pressure is applied to the filter. When pressure is applied which is larger than the ink holding force of the filter generated from the surface tension of the inks, the inks pass through the filter to fill space from an ink supply path to an ink path in a print head. In this manner, ink pressure on the filter can be appropriately controlled without increasing the amount of the ink from the injection needle above the filter. As a result, the inks pass through the filter to fill the ink path in the print head, and the inks can be prevented from leaking from ejection openings at the time of filling the inks.
US09238368B2
A piezoelectric actuator is provided, including a vibration plate, a piezoelectric layer, a plurality of individual electrodes arranged in two arrays, first and second common electrodes which have first and second facing portions facing parts of the individual electrodes and first and second connecting portions connecting the first and second facing portions respectively, and first and second wiring portions which are arranged on the vibration plate and which are connected to the first and second common electrodes respectively via first and second connecting wirings, wherein one of the first connecting wirings connects the first connecting portion and one of the first wiring portion while striding over the second connecting portion.
US09238365B1
A flex circuit board provides islands of electrically isolated material surrounding openings in the flex circuit board to preserve fluid integrity of passageways passing through an electrically insulating layer of the flex circuit board. The electrically isolated islands surround exits of the passageways through the electrically insulating material and extend the passageways through an electrically conductive layer of the flex circuit board. Consequently, fluid passing through the passageways and electrically isolated islands in the flex circuit board is not subjected to electrical current.
US09238364B2
There is provided a liquid jetting apparatus, including: a channel structure in which a liquid channel including a nozzle and a pressure chamber communicating with the nozzle is formed; a piezoelectric element including a piezoelectric body and an electrode; a driving device; and a cover member joined to the surface of the channel structure. A first wiring section connected to the electrode is formed on the surface of the channel structure, and the cover member includes a cover body section and a wiring connection section. A second wiring section is formed in the cover member. The wiring connection section is joined to the surface of the channel structure in a state that the second wiring section is electrically conductive with the first wiring section. A thickness, of the wiring connection section is thinner than a thickness of the cover body section.
US09238363B2
An electronic component moving mechanism includes a holding portion holding an electronic component, a position changing portion, a first wiring portion, a second wiring portion, a third wiring portion, and a connection line. The third wiring portion protrudes from a leading end portion of the second wiring portion toward another side in the first direction. The connection line includes a first bent portion and a second bent portion in a case where the position of the holding portion is changed to a position on the other side. The first bent portion is folded back from the other side to the one side along the leading end portion of the third wiring portion, and the second bent portion is folded back from the one side to the other side between the first bent portion and a second end portion connecting the connection line and an external circuit.
US09238361B2
The liquid ejecting head includes a printing element board having a plurality of printing elements for producing energy used to eject liquid, a contact board having a contact terminal for electrically connecting to a liquid ejection printing apparatus, and a functional element, and a plurality of lands which are provided on a face of the contact board where the functional element is mounted, and to which terminals of the functional element are connected. In addition, a wiring member connects the printing element board to the contact board, a first terminal is configured to be electrically connected to the printing element board, and a second terminal is configured to not be electrically connected to the printing element board, with both terminals disposed on one edge of the contact board. A first wiring connects the contact terminal to the first terminal, a second wiring connects at least one of the plurality of lands to the second terminal, and insulating resin covers an edge face of the second terminal positioned on the one edge of the contact board.
US09238350B2
One object is to provide a method for providing a water- and oil-repellent layer on an amorphous carbon film with excellent fixity. A method according to an embodiment of the present disclosure includes the steps of: preparing a substrate; providing, directly or indirectly on the substrate, an amorphous carbon film layer containing silicon and nitrogen in at least a surface thereof; and providing a water- and oil-repellent layer containing fluorine on the amorphous carbon film layer via a coupling agent capable of forming, with the amorphous carbon film layer, hydrogen bonds based on polarity and/or —O-M bonds (M is any one element selected from the group consisting of Si, Ti, Al, and Zr) by condensation reaction with functional groups of the amorphous carbon film.
US09238346B2
A composition made of at least 60 wt. % of a thermoplastic elastomer resin and additives that are solid at least from 0-50° C., that has a Shore A hardness that is less than about 50 bears a patterned surface, the pattern comprising at least one microfluidic channel having a cross-sectional dimension smaller than 100 microns is a substrate for forming a microfluidic device. The chief advantages of such compositions are: its ability to bond in a sealing manner to smooth surfaces of many different compositions, its ease of manufacture and microstructure patterning, and its general impermeability to liquids.
US09238344B2
Laminated articles that include a first textile and a functional film layer bonded together by an adhesive layer having a non-uniform adhesive pattern is provided. The non-uniform adhesive pattern creates regions free or substantially free of adhesive that permits the laminate to preferentially bend in those regions. The adhesive regions, together with the non-adhesive regions, create a visible pattern on the surface of the laminate. A second textile may optionally be bonded to the functional film layer opposing the first textile by an adhesive. The first textile or the film layer may be elastic, shrinkable, or expandable. In such embodiments, raised portions of the laminate corresponding to the non-adhesive regions and curled portions corresponding to the adhesive regions are visible. The laminated article is waterproof, liquid-proof, breathable, and aesthetically pleasing and demonstrates a reduction in stiffness, improved insulation properties, and a reduction of noise associated with bending the article.
US09238339B2
A hybrid fastener comprises a composite body having a tip, and a metal sleeve surrounding and locked to the tip.
US09238333B2
A method for manufacturing a fiber-containing element, said method comprising the steps of: providing fibers, at least some of which are first fibers, such as mineral fibers, polymer fibers, cellulose fibers, or other types of fibers, in an amount of from 3 to 98 wt % of the total weight of starting materials in the form of a collected web, providing a binder in an amount of from 1 to 30 wt % of the total weight of starting materials, subjecting the collected web of fibers to a disentanglement process, suspending the fibers in a primary air flow, mixing the binder with the fibers before, during or after the disentanglement process, providing a filler, such as a fire retardant, in an amount of 1 to 55 wt % of the total weight of starting materials, adding the filler at any suitable step of the method, such as before, during or after the disentanglement process, collecting the mixture of fibers, filler and binder and pressing and curing the mixture to provide a consolidated composite with a density of from 120 kg/m3 to 1000 kg/m3. With this method homogeneous composites can be produced.
US09238329B2
A print head assembly that includes a receptacle supported from a carriage frame and configured to receive a print head, and a toggle mechanism configured to move the receptacle relative to the carriage frame.
US09238328B2
A method for producing an adhesive connection between a workpiece having a metal surface and a workpiece having a plastic surface with the steps of providing a workpiece having a metal surface that has a coating which includes a thermoplastic, at least at a melt surface; providing a workpiece having a thermoplastic surface; placing the melt surface of the first workpiece having the metal surface and the workpiece having the thermoplastic surface against each other; and welding the workpiece having a metal surface and the non-metallic workpiece having the thermoplastic surface at the melt surface by exposure to ultrasonic.
US09238320B2
A composite and process for the production of a composite component, comprising a) a support of a thermoplastic composition, and b) at least one polyurethane layer in direct contact with the support.
US09238312B2
A plastic injection mold which allows extracting the air from inside it during the injection process, and an extraction method, where the mold includes closing means, one or more injection cavities provided with at least one injection nozzle for introducing the hot material in a liquid state and at least one ejector device formed by a housing for an ejector pin responsible for extracting the part already molded, where an air duct connected to a vacuum pump or a suction device intercepts the housings of the ejector pins causing a suction of the air from inside the mold.
US09238300B2
A container for storing multiple saw blades includes: a base, a cover and a plurality of positioning units. The cover has one side pivotally fixed to the base, another side clasped to the base by a clasp, and a covering portion between the two sides of the cover. The covering portion is smaller than the base. The positioning units each include a stop piece and a central positioning block which are disposed on the base in a spaced manner. The stop pieces are located at different distances from the peripheral wall and have different heights with respect to the bottom of the base, the heights of the saw blades are proportional to the distances of the stop pieces to the peripheral wall of the base, and the central positioning blocks are disposed on the covering portion or the base.
US09238296B2
A multilayer chemical mechanical polishing pad stack is provided containing: a polishing layer; a rigid layer; and, a hot melt adhesive bonding the polishing layer to the rigid layer; wherein the polishing layer exhibits a density of greater than 0.6 g/cm3; a Shore D hardness of 5 to 40; an elongation to break of 100 to 450%; and, a cut rate of 25 to 150 μm/hr; and, wherein the polishing layer has a polishing surface adapted for polishing the substrate.
US09238291B2
A machine for smoothing or polishing slabs of stone material, such as natural and agglomerated stone, ceramic and glass, comprises a longitudinal bench (12) over which the slabs to be machined move, at least one pair of opposite bridge support structures (20, 22) arranged astride the bench, and at least one beam (24) transversally movable and supported by said bridge structures. At least one vertical-axis and vertically movable mandrel (40) is mounted eccentrically on a mandrel supporting structure (30) which rotates about its vertical axis (Z1) and is supported on said beam (24). The mandrel has, mounted on its bottom end, a device carrying the smoothing or polishing tools and rotating about the axis of rotation of said mandrel. In this way, the tool carrying device performs a movement composed of the rotation about the axis of rotation of the mandrel, a revolving movement about the axis of rotation of the mandrel carrying structure and a translation movement due to the movement of the beam.
US09238288B2
In a method for processing a plate object, etching is performed for a flat plate object by a predetermined etching method and the shape of the plate object after the etching is grasped in advance. In a grinding step, the plate object is ground into a grinding-finished shape that is a non-flat shape obtained by inverting the shape of the plate object after the etching to the reverse shape. When subsequent etching by the predetermined etching method is performed for a grinding-target surface, the plate object is formed into a flat shape with a uniform thickness.
US09238275B2
In this brazing method, which brazes an insulating substrate and a top plate that configure an HV inverter cooler, the insulating substrate is disposed on the top plate with a brazing material layer therebetween, and then, by means of laser irradiation, laser welding is performed at an arbitrary plurality of positions at the joining section between the top plate and the insulating substrate, thus provisionally affixing the insulating substrate to the top plate. Thereafter, by means of heating and melting the brazing material layer, the insulating substrate is brazed onto the top plate with the plurality of laser-welded positions as the brazing start points. After brazing, a power semiconductor is joined onto the insulating substrate corresponding to the center portion of the region surrounded by the plurality of brazing start points.
US09238271B2
A diaphragm chuck for a machine tool has a first clamping diaphragm and a second clamping diaphragm which is offset relative to the first clamping diaphragm along an axial direction. The first clamping diaphragm has multiple first chuck jaws and the second clamping diaphragm has multiple second chuck jaws, and the first and the second clamping diaphragms are detachably connected to one another.
US09238267B2
Cutting insert made of hard metal, cermet or ceramic substrate body with multi-layer coating applied thereto by CVD methods. The coating has a total thickness of 5 to 40 μm and, starting from the substrate surface, has one or more hard material layers, an alpha aluminum oxide (α-Al2O3) layer of a layer thickness of 1 to 20 μm and optionally at least portion-wise over the α-Al2O3 layer one or more further hard material layers as decorative or wear recognition layers. The α-Al2O3 layer has a crystallographic preferential orientation characterized by a texture coefficient TC (0 0 12)≧5 for the (0 0 12) growth direction.The α-Al2O3 layer has an inherent stress in the region of 0 to +300 MPas, and the substrate within a region of 0 to 10 μm from the substrate surface has an inherent stress minimum in the region of −2000 to −400 MPas.
US09238263B2
The invention relates to a method of manufacturing a spring for a timepiece, including the following steps: (a) forming a body using first and second metallic materials secured to each other; (b) decreasing the section of the body; and winding the body to form the spring. The invention also relates to the spring obtained via the method. The invention concerns the field of regulating members for timepieces.
US09238261B2
A sheet loading system is provided for consecutively loading sheets onto a multi-step process press machine such that a plurality of workpieces loaded respectively on a plurality of workstations is simultaneously processed by one stroke. The sheet loading system includes a conveyor, a sheet loader, a first sheet transfer feeder, and a second sheet transfer feeder.
US09238253B2
A processed DRI material having an average surface roughness (Ra) of less than 1.5 μm is disclosed. A method and system for making processed DRI are also disclosed. One embodiment of the method and system may include assembling a rotatable chamber having an internal screen capable of supporting DRI during tumbling, with at least one opening in the chamber to permit fines to exit the chamber during tumbling, and delivering DRI into the chamber to tumble the DRI on the screen to remove fines from the DRI. Another embodiment of the method and system may include assembling a rotatable chamber having a feed end and an exit end, and having a screen therein capable of supporting DRI as the DRI moves through the chamber, and delivering DRI to the chamber and rotating the chamber to tumble the DRI while removing fines.
US09238246B2
An illuminated handle assembly for attaching to a paint roller includes a top handle that is removably coupled to the paint roller. A primary handle is coupled to the top handle so the primary handle is coupled to the paint roller. A plurality of light emitters is each coupled to the primary handle. The plurality of light emitters directs a beam of light toward the paint roller. Each of the plurality of light emitters is operationally independent from one another. An actuator is coupled to the primary handle. The primary actuator is operationally coupled to each of the plurality of light emitters. The actuator selectively actuates the plurality of light emitters.
US09238244B2
A discharge apparatus 1 comprises a feeder part 41 which is provided on a flow path of a discharge material from a supply part 10 to a nozzle 50 and feeds the discharge material in the flow path at a predetermined flow rate from the supply part 10 toward the nozzle 50 and a plurality of pressurizers 31, 32 provided in parallel to each other on the flow path and each having a function of temporarily storing the discharge material in a storage space and a function of pressurizing the discharge material stored in the storage space and feeding the discharge material under pressure to the feeder part 41. The plurality of pressurizers 31, 32 operate complementarily manner, thereby a constant pressure is applied to the discharge material fed to the feeder part 41.
US09238242B2
A device for calibrating a spray gun and an associated method are provided. The spray gun has a nozzle that is opened and closed by moving an internal needle out of and into sealing engagement with the nozzle. A virtual position of the needle is tracked and recorded by the control system. The control system is recalibrated when the virtual position and the actual position of the needle do not correspond. The device includes a sensor structured to detect characteristics of the current used to power the solenoid, and to identify an anomaly in solenoid current characteristics associated with an actuator member seating against said solenoid. During calibration, the solenoid is placed in a calibration configuration and the identifiable anomaly is detected. When the identifiable anomaly is detected, the spray gun is returned to an initial configuration and the virtual needle position is reset.
US09238234B2
Device (5) and method or removing suspended-material particles, more particularly fine and ultra-fine particles from a water flow containing suspended-material particles in a pressurised water line (3) of a hydroelectric power plant (2), whereby a tubular element (6) forming a flow channel (7) is provided in the pressurised water line (3), whereby the flow channel (7) essentially extends in the axial direction of the pressurised water line (3), and in the flow channel (7) a stationary swirl-generating device (11) is arranged for stimulating a flow component of the water flow which runs perpendicularly to the main flow direction (9), and in the flow direction after swirl-generating device (11) a separating device (13) is provided for removing the suspended-material particles carried radially outwards due to the effect of centrifugal force.
US09238232B2
A system for treating tar sand involving a centrifuge where under centrifugal force solvent treated tar sand and water form a three layer system of wet sand, water, and petroleum, where solvent solubilized hydrocarbons are stripped from the wet sand layer, passed through the water, and into the petroleum layer. The hydrocarbons are skimmed from the hydrocarbon layer and recovered.
US09238228B2
A cone crusher having a frame, an outer blade adapted to be locked to the frame, an inner blade eccentrically and vertically movable relative to the outer blade, and the inner blade and the outer blade define there between a crushing chamber, a main shaft which is stationary relative to the frame, an eccentric bearing-mounted on the main shaft, a support cone on which the inner blade is arranged, and an adjustment shaft by means of which the support cone is vertically movable from below. A hollow space is arranged inside the main shaft, the adjustment shaft is arranged to the hollow space, a load cylinder is arranged to a lower end of the main shaft which load cylinder comprises an adjustment piston acting to a lower end of the adjustment shaft, a pressure medium supply is arranged to a pressure volume under the adjustment piston for moving vertically the adjustment shaft, and a lubricant supply is arranged above the adjustment piston for directing lubricant via the hollow space to targets to be lubricated. The main shaft is fixed stationary to the frame such that the lower end of the main shaft extends outside the frame under the frame and that the lubricant supply is arranged from outside to the outside extending part of the main shaft and through the main shaft to the hollow space.
US09238223B2
The technology described herein generally relates to microfluidic cartridges configured to amplify and detect polynucleotides extracted from multiple biological samples in parallel. The technology includes a microfluidic substrate, comprising: a plurality of sample lanes, wherein each of the plurality of sample lanes comprises a microfluidic network having, in fluid communication with one another: an inlet; a first valve and a second valve; a first channel leading from the inlet, via the first valve, to a reaction chamber; and a second channel leading from the reaction chamber, via the second valve, to a vent.
US09238218B2
The present invention is related to a new metal powder catalytic system (catalyst) comprising a Fe-alloy as a carrier, its production and its use in hydrogenation processes.
US09238213B2
An ozone generating apparatus which is provided with a discharge suppressing member formed of a metal plate and covering an outer circumferential surface of a portion of a dielectric tube facing to a tube sheet, the discharge suppressing member being electrically in contact with a metal tube or the tube sheet, wherein the discharge suppressing member is formed by curling the metal plate longer than a circumferential length of the dielectric tube into a circular shape so as to have an overlapping portion, and by joining together, in the overlapping portion, a part of the metal plate placed outside and a part of the metal plate placed inside, at a near-end portion of the metal plate placed outside in the overlapping portion, and wherein the discharge suppressing member has, on the part of the metal plate placed outside in the overlapping portion, a spring portion.
US09238193B2
Disclosed are systems and methods which provide a process stream comprising a gaseous component, capture the gaseous component from the process stream by an ionic liquid solvent of a separator, and recover a captured gaseous component from the ionic liquid solvent in a regenerator. A second gaseous component from the process stream may be captured by the ionic liquid solvent of the separator, and the second gaseous component may be recovered from the ionic liquid solvent in the regenerator. Alternatively, the second gaseous component from the process stream may be uncaptured by the ionic liquid solvent, and the uncaptured second gaseous component may be recovered from a membrane unit.
US09238192B2
An apparatus and method for processing of a source gas and for removal of a target gas therefrom. The apparatus has an absorption system having a first containment structure defining a first process volume for containment of a gas phase and an absorbent liquid phase and a regeneration system fluidly downstream of the absorption system having a second containment structure defining a second process volume for containment of a gas phase and an absorbent liquid phase including a heating means to heat the liquid phase. An ultrasound transducer system is provided in association with one or both of the first or second containment structure to apply in use ultrasonic vibration to a part of the said first and/or second containment structure and thus to apply in use ultrasonic vibration to the contents of a part of the first and/or second process volume as the case may be.
US09238184B2
An apparatus for refining a process liquor that includes solids, which apparatus includes a vessel having a base and a side wall that define an internal volume for containing the process liquor and for allowing gravity settling of the solids in the liquor, whereby to produce a refined liquor toward a top of the internal volume and a slurry toward a bottom of the internal volume, the apparatus further includes solids displacement elements disposed within the internal volume for directing settled solids and/or settling solids in the vicinity of the side wall or of the base toward a flow path of the slurry being extracted from the slurry outlet. A processing plant including the above refining apparatus and a method for refining a process liquor.
US09238174B2
The present invention relates generally to the field of computer and network software, and more particularly it relates to a method and apparatus for providing virtual goods and/or on-line services based on a user's virtual location while surfing the web. According to certain aspects, the invention allows interactive objects, virtual goods and on-line services to be automatically provided to users when they visit predetermined partner sites or perform some predetermined on-line activity. According to other aspects, the invention automatically provides parallel destinations for predetermined partner sites that only users of the system can visit, and where such users can receive virtual goods and on-line services, among other content.
US09238173B2
An example information processing device calculates an attitude of an input unit having a magnetic sensor. The information processing device repeatedly obtains detected magnetic vectors detected by the magnetic sensor. The information processing device stores the detected magnetic vectors in a storage unit where each detected magnetic vector is classified based on a direction from a reference position to the end point position of the detected magnetic vector. The information processing device repeatedly estimates a center position of a spherical body having a curved surface which is estimated based on the end point positions of detected magnetic vectors obtained by extracting, from among the classified detected magnetic vectors, at least one detected magnetic vector for each class. The attitude of the input unit is calculated based on a direction vector representing a direction from the center position to the end point position of the detected magnetic vector.
US09238169B1
A multi-functional combinatorial game apparatus, which includes a base provided with a protruding seat and a recess on the top thereof, and a groove is provided inside the recess. When two adjacent bases are combined together, the inserting groove on the bottom portion of the upper layer base inserts onto the protruding seat or the recess of the lower layer base, thereby enabling a tactile path to be created having undulating ups and downs. In addition, soybeans, sand, small stones, and other tactile objects can be placed inside the grooves on the bases to provide children with different tactile feelings when they are walking and treading on the path.
US09238160B2
A method and golf ball incorporating a surface penetrating color composition comprising a colorant (e.g. dyes, tints, color effects, etc.) in a portion (surface or region) of a golf ball component or coating (substrate). The substrate is formed from a homogenous composition having a color C1 which may comprise any color within the spectrum of visible light, or be clear colorless, and alternatively, may also be opaque, translucent, or clear colored, for example. An outer surface of the substrate is treated with or otherwise exposed to a surface penetrating color composition having a C2 that is different than C1 in some respect such as hue, chroma, saturation and/or opacity. The surface penetrating color composition penetrates the golf ball substrate surface to a target depth and becomes embedded within the surface, thereby forming a surface penetrating color composition-treated component or coating having a treated region and an untreated region.
US09238156B2
A personal fall limiter arrangement having a user connection arrangement, including: a body attached to at least a portion of the frame and having a recess configured to receive at least a portion of a user connector; at least one tab pivotally attached to a first portion of the body; and at least one biasing member engaged with the at least one tab and configured to urge the at least one tab towards a locked (or closed) position; wherein, in operation, the at least one tab is pivotal between: (1) an open position to permit passage of at least a portion of the user connector into or out of the recess; and (2) the locked position to prevent passage of at least a portion of the user connector out of the recess.
US09238154B2
A power door opener including an actuator having a housing with an electrically powered actuator shaft that can be extended from a closed to an extended position. In one embodiment, a movable push plate is affixed to the actuator shaft and a fixed push plate is fixed in its position with respect to the housing. In the closed position of the actuator shaft, the fixed and movable push plates are aligned to form a combined edge for insertion into the space between a door and door jamb. The actuator shaft extends to move the movable push plate apart from the fixed push plate to spread the space and release the door from the door jamb. Alternatively, a double ended power door opener is located between opposite door jambs and the extending of the actuator shaft forces the door jambs apart to release the door from the door jamb.
US09238142B2
The present invention relates to methods for remotely and intelligently tuning movement disorder of therapy systems. The present invention still further provides methods of quantifying movement disorders for the treatment of patients who exhibit symptoms of such movement disorders including, but not limited to, Parkinson's disease and Parkinsonism, Dystonia, Chorea, and Huntington's disease, Ataxia, Tremor and Essential Tremor, Tourette syndrome, stroke, and the like. The present invention yet further relates to methods of remotely and intelligently or automatically tuning a therapy device using objective quantified movement disorder symptom data to determine the therapy setting or parameters to be transmitted and provided to the subject via his or her therapy device. The present invention also provides treatment and tuning intelligently, automatically and remotely, allowing for home monitoring of subjects.
US09238138B2
A method, electrical tissue stimulation system, and programmer for providing therapy to a patient are provided. Electrodes are placed adjacent tissue (e.g., spinal cord tissue) of the patient, electrical stimulation energy is delivered from the electrodes to the tissue in accordance with a defined waveform, and a pulse shape of the defined waveform is modified, thereby changing the characteristics of the electrical stimulation energy delivered from the electrode(s) to the tissue. The pulse shape may be modified by selecting one of a plurality of different pulse shape types or by adjusting a time constant of the pulse shape.
US09238136B2
An exemplary method includes performing a capture threshold assessment using a bipolar electrode configuration, deciding if capture occurred for a maximum energy value of the capture threshold assessment and, if capture did not occur, then performing a lead impedance test for the lead associated with the bipolar electrode configuration. Such a test may aim to detect an insulation defect and/or a conductor defect. Other exemplary methods, devices, systems, etc., are also disclosed.
US09238127B2
The present invention comprises systems, methods and devices for the delivery of compositions for diagnosing or treating conduits. The delivery system is positioned to allow for placement of the composition into the body conduit. Use of delivery systems, methods and devices for delivering to a body conduit are also included.
US09238123B2
The present invention is related to a polymeric vehicle for delivery of bioactive agents, and preferably, for the delivery of one or more bioactive agents. The invention is also directed to a percutaneous device securing and drug delivery device comprising, as a component thereof, a material which delivers antimicrobial and/or other wound-healing factors at the site of the insertion of the catheter into the body. The device, when applied as described herein, provides complete anti-microbial coverage around the entry point of a percutaneous device and, preferably for a length greater than the diameter of the device. The present invention is also directed to methods for using such devices in combination with percutaneous devices primarily to reduce site infections.
US09238120B2
The present invention provides, among other things, a tubing apparatus that allows for better organization of tubes within a system by permanently coupling medical tubes. Generally, this invention comprises a primary tube and a secondary tube, wherein the secondary tube is permanently coupled to the primary tube at least partially along the secondary tube's length. The primary tube comprises at least one coupling port to which one end of the secondary tube fluidly couples.
US09238119B2
Fluid infusion systems and fluid couplings are described herein. The infusion systems may include one or more fluid couplings used to make fluidic connection between a supply line and delivery tubing. The fluid couplings separate the functions of providing a seal around a delivery tube and retaining the delivery tube within the fluid coupling. The seal provided around the delivery tube prevents leakage around an exterior surface of a delivery tube such that fluid passing through the coupling must pass through the delivery tube rather than leak around the delivery tube. The structure used to retain the delivery tube in the fluid coupling prevents ejection of the delivery tube from the coupling due to the fluid pressures present in the coupling. The separate functions are performed by different structures within the fluid couplings.
US09238115B2
Embodiments of the present invention provide systems and methods for delivering respiratory treatment to a patient. For example, a treatment system may include a mechanism for delivering a positive pressure breath to a patient, and one or more limb flow control assemblies which modulate gas flow to and from the patient. Exemplary treatment techniques are embodied in anesthesia machines, mechanical ventilators, and manual ventilators.
US09238089B2
An absorbent structure including a composite absorbent laminate is disclosed, with the structure suitable for use in disposable absorbent products such as for infant or incontinence care. Notably the laminate comprises discrete acquisition cells each comprising particles of preferably cellulosic absorbent material. The absorbent structure further comprises particulate superabsorbent polymer which can either be blended with the particulate discrete acquisition cells in the absorbent laminate, or provided in a separate absorbent layer of the absorbent structure. The discrete acquisition cells desirably generate free volume for rapid capillary absorption in an ultra-thin absorbent structure.
US09238086B2
The present invention provides a spill-resistant air freshener canister that includes: a supply vessel filled with aromatic liquid that has a threaded mouth sealed with a puncturable foil/polyethylene membrane; a cylindrical inner sleeve incorporating a socket that sealably engages the threaded mouth of the supply vessel, the sleeve also having a cylindrical axial aperture at the bottom of the socket, and at least one seepage aperture at the very bottom of the socket which enables liquid from inside the supply vessel to escape in a radially outward direction to the exterior of the cylindrical inner sleeve; a cylindrical wick surrounding the cylindrical inner sleeve; and an evaporator cage into which the cylindrical inner sleeve is inserted, the evaporator cage having a fully-enclosed bottom portion containing a central projecting blade that fits through the axial aperture at the bottom of the socket. The bottom portion is ultrasonically welded to the bottom of the cylindrical inner sleeve.
US09238084B2
Described herein are compositions and methods of use of anti-pancreatic cancer antibodies or fragments thereof, such as murine, chimeric, humanized or human PAM4 antibodies. The antibodies show novel and useful diagnostic characteristics, such as binding with high specificity to pancreatic and other cancers, but not to normal or benign pancreatic tissues and binding to a high percentage of early stage pancreatic cancers. Preferably, the antibodies bind to an epitope located within the second to fourth cysteine-rich domains of MUC5ac (amino acid residues 1575-2052) and are of use for the detection and diagnosis of early stage pancreatic cancer. In more preferred embodiments, the anti-pancreatic cancer antibodies can be used for immunoassay of serum samples, wherein the immunoassay detects a marker for early stage pancreatic cancer in serum. Most preferably, the serum is extracted with an organic phase, such as butanol, before immunoassay.
US09238083B2
A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ ID NO. 1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2 (1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.
US09238077B2
The invention relates to fatty acid niacin conjugates; compositions comprising an effective amount of a fatty acid niacin conjugate; and methods for treating or preventing an metabolic disease comprising the administration of an effective amount of a fatty acid niacin conjugate.
US09238066B2
The present invention is directed to reagents useful for generating immune responses to Mycobacterium tuberculosis and for diagnosing infection and disease in a subject that has been exposed to M. tuberculosis.
US09238057B2
Methods are provided for the treatment of ocular neovascularization by increasing, in an individual afflicted with ocular neovascularization, in vivo concentrations of an endostatin protein in the ocular tissues of the individual to an ocular neovascularization inhibiting effective amount, where the endostatin protein has anti-ocular neovascularization activity in vivo.
US09238049B2
A formula of suppressing viability of tumor cells is disclosed. The formula comprises 27.3-50.0 wt % of Taiwanofungus camphorates, 27.3-40.0% of Ganoderma lucidum and 16.7-45.4% of Glycyrrhiza uralesis Fisch.
US09238048B2
An object of the present invention is to improve the milk yield and/or milk quality of a ruminant for milk production, to prevent or treat a perinatal disease of a ruminant, and to improve the reproductivity of a ruminant. In order to solve the above-mentioned problem, the following is provided. An agent for improving at least one of milk yield and milk quality of a ruminant, comprising at least one of cashew nut shell liquid, heat-treated cashew nut shell liquid, anacardic acid, cardanol, and cardol. An agent for preventing or treating a perinatal disease of a ruminant, comprising at least one of cashew nut shell liquid, heat-treated cashew nut shell liquid, anacardic acid, cardanol, and cardol. An agent for improving reproductivity of a ruminant, comprising at least one of cashew nut shell liquid, heat-treated cashew nut shell liquid, anacardic acid, cardanol, and cardol.
US09238047B1
Bone graft compositions and methods are provided for promoting cellular recruitment bone regeneration. The novel bone graft includes at least one of: fluorapatite nano-crystalline coated non-ceramic hydrophilic hydroxylapatite crystals; and a combination of fluorapatite nano-crystalline coated non-ceramic hydrophilic hydroxylapatite crystals and fluorapatite nano-crystalline coated hydroxylapatite crystal clusters. Methods include treating cells at a bone defect site with the novel bone graft, wherein fluorapatite crystallites from the fluorapatite nano-crystalline coating immediately and continuously release fluorapatite to the cellular environment over the course of treating the cells. The compositions and methods promote cell differentiation, migration, and proliferation. Through the use of compositions and methods provided herein, inhibition of the migration of connective tissue and epithelial cells to bone defect sites is realized for better bone restoration by osteoblast cells. Moreover, inhibition of inflammatory cells and bacteria at the surgical site are realized, further enhancing bone restoration.
US09238034B2
The present disclosure is directed to methods of using fibroblast growth factor-inducible 14 (Fn14) antagonists to modulate activity at a TNF-like weak inducer of apoptosis (TWEAK) binding site on a cysteine-rich domain (CRD) of Fn14. The present disclosure also provides pharmaceutical compositions comprising synergistic combinations Fn14 antagonists and chemotherapeutic agents.
US09238028B2
The disclosure relates to diseases in the peripheral nervous system, particularly hereditary neuropathies, such as Charcot-Marie-Tooth (CMT) disease. It is shown that this disease is associated with decreased acetylated tubulin levels, which can be overcome by inhibition of histone deacetylases (HDACs). Using HDAC inhibitors, it is shown herein that the symptoms of the CMT phenotype can be overcome both in vitro and in vivo. Also provided herein are two different mouse models of CMT disease.
US09238023B2
Embodiments of the invention generally relate to methods and supplements for improving the health of human beings.
US09238018B2
Disclosed are pharmaceutical compositions comprising, bucillamine, including bucillamine and allopurinol or colchicine, or pharmaceutically acceptable salts or solvates thereof, together with one or more pharmaceutically acceptable carriers, diluents and excipients. Methods for use of the said compositions in the treatment of gout and metabolic syndrome are also disclosed.
US09238009B2
A method for preparing fat-soluble active ingredients, including the steps of preparing an oil-in-water emulsion including 8 to 20% of at least one protein, 5 to 15% of at least one sugar, 0.5 to 3% of at least one inorganic salt, 10 to 22% of at least one fat-soluble active ingredient in an oily form and/or dissolved in an edible oil, and qsp % of water, shaping of particles in a substantially spherical shape by the dispersing the oil-in-water emulsion obtained at the end of step a) in a fluid, adding at least one agent for cross-linking of the at least one protein to the dispersion obtained at the end of step b), and the active ingredients are recovered with the substantially spherical shape.
US09238005B2
The present invention is directed toward respirable dry particles for delivery of divalent metal cation salts and/or monovalent cation salts to the respiratory tract and methods for treating a subject having a respiratory disease and/or infection.
US09237993B2
The disclosure relates to a method for gradually coloring hair comprising the steps of: a) applying an air oxidation haircolor composition to hair; b) removing the air oxidation haircolor composition from the hair directly after application; and c) repeating a set comprising the steps a) and b) in multiple spaced intervals. The air oxidation haircolor composition can include: 1) at least one primary oxidation dye intermediate; 2) at least one aromatic triol; and 3) water.
US09237990B2
Polymerizable isocyanurate monomers and dental compositions are described. A hardenable dental composition is described comprising at least one isocyanurate monomer that is a stable liquid at about 25° C. The isocyanurate monomer comprises at least one divalent linking group bonded to a nitrogen atom of a trivalent isocyanuric acid ring, wherein the divalent linking group comprises a moiety selected from ester, thioester, ether, or thioether, and combinations of such moieties and a terminal ethylenically unsaturated polymerizable group.
US09237982B2
A high frequency chest wall oscillation (HFCWO) apparatus for the purpose of lung airway clearance of people includes an inflated vest type garment worn around the chest of a person. An oscillating pressure generator with reduced power requirements and a power source is integrated with the garment so that the complete apparatus is wearable by the person. Improvements in pressure waveforms, safety and compliance to prescribed use are disclosed.
US09237981B1
A therapeutic massage device, specifically a manual scalp massager that can both provide a soothing sensation to the user and also stimulate the sebaceous glands and hair follicles of a person's scalp, resulting in a healthier scalp and better looking hair. The device should efficiently, and without harm or discomfort to the user, be able to pinch the tightly drawn scalp of the user, thereby squeezing the sebaceous glands and improving oil production. The device should also be easy to use and should not require an inordinate amount of effort by the operator. In operation, the device can massage one's scalp by alternating between constricting and releasing the skin.
US09237980B2
A medical compression suit has first and second elongate openings and first and second fasteners for releasably closing the first and second elongate openings respectively such that releasing the fasteners allows the openings to be opened, facilitating the donning and doffing of the suit by a wearer, the first and second openings being provided on the front or the rear of the suit.
US09237979B2
A gas delivery system for a patient room may include a centralized gas distribution system that provides a source of gas and a manifold for distributing the gas in the patient room. The gas delivery system may include a gas outlet coupled to a wall of the patient room and line connecting the gas outlet to the manifold.
US09237976B2
Embodiments of a fluid absorption and distribution enhancement (FADE) product comprises at least one flow media layer, and at least one superabsorbent polymer layer.
US09237973B2
A personal care article comprising a nonwoven fluid permeable topsheet having a body-facing surface and an opposing backside surface, a fluid impermeable backsheet and at least one intermediate layer disposed therebetween, wherein said fluid permeable topsheet comprises apertured holes wherein at least 10% of the aperture holes are treated with a hydrophilic treatment agent.
US09237968B1
An ear plug provides, in the exemplary embodiment, an ear plug body adapted to fit against a cavum conchae of the ear and defining an outwardly opening main cavity therewithin. An inner end of the ear plug body is sized and configured for fitting into an ear canal of the ear, while a base of the main cavity defines a sound hole that extends down through each of the base and inner end. A chamber wall is positioned within and extends across the main cavity, forming a hollow air chamber in fluid communication with the sound hole capable of selectively clearing any water droplets that may enter the main cavity and obstruct the sound hole. In an alternate embodiment, the base of the main cavity provides an upwardly protruding sound hole body configured for elevating an opening of the sound hole a distance above the base.
US09237954B2
Dimensionally adjustable spinal prostheses are adjustable in an axial or superior to inferior dimension such that spinal prostheses may assume variations in height. The height adjustable spinal prostheses are characterized by first and second portions that are configured for adjustable coupling with one another. Spatial adjustment between the first and second portions is provided by an adjustment assembly. The adjustment mechanism preferably, but not necessarily, provides infinite adjustment over a minimum prosthesis height to a maximum prosthesis height. In one form, first and second ends of the height adjustable spinal prostheses are configured to receive an endplate. The endplates aid in attachment and/or anchoring of the spinal prosthesis within the spine. The endplates may be fashioned in various configurations such as circular or anatomical. In one form, the adjustment assembly utilizes rotational motion for varying the axial position of one prosthetic portion relative to the other prosthetic portion. Rotational movement of an adjustment mechanism of the adjustment assembly is translated into axial movement of one prosthetic portion relative to the other prosthetic portion. In another form, the adjustment mechanism is a screw and gearing assembly. In yet another form, the adjustment mechanism is a rack and pinion assembly.
US09237950B2
A method of manufacturing a joint implant for a joint of a specific patient includes obtaining a three-dimensional image of a bone of the joint of the specific patient from medical imaging scans of the bone of the patient and determining on the three-dimensional image a resection plane for contacting a corresponding planar surface of the joint implant for the specific patient. The method includes determining a three-dimensional image of a porous structure of a bone layer along the resection plane from the medical imaging scans of the patient. The joint implant is manufactured with a layer of a patient-specific porous construct attached to the planar surface of the joint implant. The layer of the patient-specific porous construct substantially replicates the porous structure of the bone layer of the specific patient.
US09237947B2
A method of loading an IOL having an optic and a leading haptic into a cartridge, comprising folding the leading haptic radially inward relative to the optic as the IOL moves into a lumen of the cartridge, by using a proximal end feature of the cartridge.
US09237944B2
A gastrointestinal implant device is anchored in the duodenum and extends beyond the ligament of Treitz. All food exiting the stomach is funneled through the device. The gastrointestinal device includes an anchor for attaching the device to the duodenum and an unsupported flexible sleeve. The anchor can include a stent and/or a wave anchor and is collapsible for catheter-based delivery and removal.
US09237943B2
The present invention relates to a brush head attachment, in particular for an electric sonic toothbrush, comprising a shank member carrying a bristle bundle, and a coupling member (1) provided on the fastening-side end of said shank member with at least one connection surface for a drive shaft of said handpiece which, when a brush head attachment is mounted on a handpiece, protrudes into said coupling member (1), a spring element that can be operatively connected with said drive shaft for securing said drive shaft to said brush head attachment and/or transferring a drive motion of said drive shaft to said brush head attachment, and a metal ring (4) disposed in a widened fastening foot (2) formed by said coupling member (1). In this inexpensively manufactured brush head attachment according to the present invention, said metal ring (4) is a die-cast member.
US09237941B2
An orthodontic appliance and system are provided for adjusting the relative positions of mandibular and maxillary arches. The orthodontic appliance includes a telescoping assembly including a plurality of telescoping members, and at least a first end member supportably retaining at least a portion of a spring member. The end member is adapted to slidably receive an end of a first telescoping member for selectively interconnection and disconnection therebetween. When interconnected, the spring member extends into an open end of the first telescoping member and is operative to apply spring-force to a second telescoping member. A plurality of interchangeable end members may be provided for use with the telescoping assembly, wherein the different end members have different spring-force delivery attributes. The orthodontic appliance may be installed utilizing an attachment device selectively interconnectable to and disconnectable from orthodontic archwires.
US09237935B2
A fatigue testing system provides simultaneous cycle testing for a plurality of prosthetic devices under simulated physiological loading conditions. A plurality of sample holders containing test samples of prosthetic devices is positioned between a distribution chamber and a return fluid chamber to form an integrated test chamber. A reciprocating linear drive motor operates a rolling bellows diaphragm to cyclically pressurize fluid within the test chamber and drive the pressurized fluid through the prosthetic devices being tested. The test chamber defines a return flow conduit in fluid communication with each of the sample holders, the return fluid chamber, and the distribution chamber. Compliance chambers and throttle valves associated with each of the sample holders regulate the pressure gradient and back pressure across the prosthetic devices being tested.
US09237933B2
A universal arm has a proximal end, a distal end and a middle portion therebetween. The middle portion has a plurality of interconnected ball and socket pieces. A plurality of clamps are selectively fixedly connected to the distal end of the universal arm by a connection that permits the selective rotation of each one of the plurality of clamps by 360° with respect to the distal end of the universal arm.
US09237932B2
A device for assisting robotic surgery of soft tissue, that comprises a shell with a flexible sealing rim, instrument ports, and a vacuum port. The flexible sealing rim seals the shell around a surgical area and allows for the application of negative pressure via the vacuum port. The negative pressure manipulates soft tissue to allow a surgeon to perform an incision with a robotic surgery apparatus.
US09237928B2
Mobile functional hospital unit (1) for the temporary distribution of medical fluids, comprising at least one rear outlet (5, 25; 30) for tapping off medical fluid designed and able to be connected to a medical fluid distribution network arranged within a hospital building and associated with the rear wall (6) of the cabinet (2), at least one side outlet (21, 22, 23, 24; 17) for tapping off medical fluid associated with at least one side wall (27, 28) of the cabinet (2), and at least one connecting line (9) fluidically connecting at least one gas cylinder (3, 4; 7, 8) to at least one of the rear (5, 25) and side (21, 22, 23, 24) gas tapping outlets in order to supply at least one of the rear (5, 25) and side (21, 22, 23, 24) outlets with gas delivered by at least one gas cylinder (3, 4; 7, 8).
US09237924B2
Methods and devices for treating nasal airways are provided. Such devices and methods may improve airflow through an internal and/or external nasal valve, and comprise the use of mechanical re-shaping, energy application and other treatments to modify the shape, structure, and/or air flow characteristics of an internal nasal valve, an external nasal valve or other nasal airways.
US09237913B2
Method of stabilizing a sternum with a fastening member defining a plurality of cleats. In the method, the fastening member may be disposed on a sternum having a discontinuity, with the fastening member spanning the discontinuity and the cleats contacting the sternum. The fastening member may be arranged with a wire or cable such that the wire or cable extends twice through the fastening member and forms a loop around a portion of the sternum. The fastening member may be crimped to secure both ends of the loop to the fastening member.
US09237905B2
In one embodiment, the invention includes a medical instrument for insertion into a subject including an elongate body which includes a proximal end and a distal end, a broad face, a narrow face, a lateral side and a counter-lateral side, said faces and sides defining a trapezoid shape along the length of the elongate body. The broad and narrow faces are generally parallel to one another and the lateral and counter-lateral sides each connect between the broad and narrow faces. The distal end of the instrument includes a cutting edge and is provided for insertion into the subject, wherein an incision made in a target area of the subject results in a linear penetration in the target area. An aperture may be disposed at or near the distal end of the medical instrument.
US09237901B2
A liquid injection device includes an injection unit which injects a liquid, a liquid supply instrument which supplies the liquid to the injection unit, and a control unit which controls operation of the injection unit and the liquid supply instrument, wherein the injection unit includes a distal end portion where a nozzle for injecting the liquid is formed, and a body portion in which the distal end portion is removably loaded, at the distal end portion, a distal end-side memory is provided in which first startup data is written, and the control unit is a control unit which reads and writes the first startup data from and to the distal end-side memory in the distal end portion loaded in the body portion and manages use time of the distal end portion based on the first startup data that is read out.
US09237891B2
A surgical stapling device that comprises an end effector that is configured to receive various control motions from a robotic system.
US09237890B2
A surgical stapler includes an anvil assembly and a cartridge assembly. The anvil assembly defines staple forming depressions. One or both of the anvil assembly and the cartridge assembly are pivotable relative to the other between an open position and a clamped position. The cartridge assembly includes a first plurality of staples and a second plurality of staples. The first plurality of staples is initially positioned in alignment with the staple forming depressions of the anvil assembly for ejection from the cartridge assembly. The second plurality of staples is movably supported in the cartridge assembly from a first position misaligned with the staple forming depressions of the anvil assembly to a second position aligned with the staple forming depressions for subsequent ejection from the cartridge assembly.
US09237885B2
At least one embodiment is directed to a tracking system for the muscular-skeletal system. The tracking system can identify position and orientation. The tracking system can be attached to a device or integrated into a device. In one embodiment, the tracking system couples to a handheld tool. The handheld tool with the tracking system and one or more sensors can be used to generate tracking data of the tool location and trajectory while measuring parameters of the muscular-skeletal system at an identified location. The tracking system can be used in conjunction with a second tool to guide the second tool to the identified location of the first tool. The tracking system can guide the second tool along the same trajectory as the first tool. For example, the second tool can be used to install a prosthetic component at a predetermined location and a predetermined orientation. The tracking system can track hand movements of a surgeon holding the handheld tool within 1 millimeter over a path less than 5 meters.
US09237880B2
A backing block for an ultrasonic transducer array stack of an ultrasound probe is formed as a composite structure of material of high thermal conductivity in which is embedded a structure of acoustic dampening material. In a constructed embodiment the composite structure is formed from a block of thermally conductive graphite in which a plurality of cylindrical holes are formed which are filled with acoustic dampening material. The holes are angled in relation to the Z-axis direction from the rear of the transducer stack so that reverberation energy traveling in that direction will encounter acoustic dampening material. The graphite around the holes is effective to conduct heat to the rear of the probe and away from the transducer stack and its ASIC.
US09237874B2
Embodiments of systems, methods and non-transitory computer readable media for imaging are presented. Preliminary image data corresponding to a first FOV of a subject at a first resolution is acquired using an imaging system including one or more radiation sources and at least one hybrid detector, specifically using at least one section of the hybrid detector having the first resolution. The target ROI is identified using the preliminary image data. Further, the subject is positioned to align the target ROI along a designated axis. Additionally, parameters associated with the sources, the hybrid detector and/or an imaging system gantry are configured for acquiring target image data at a second resolution greater than the first resolution using at least one section of the hybrid detector having the second resolution. Further, one or more images corresponding to at least the target ROI are reconstructed using the target and/or the preliminary image data.
US09237867B2
A cartridge (700) for insertion into a meter comprises: a plurality of cartridge brackets (704) disposed on an inner wall (703) of the cartridge; a spindle (702) mounted so as to be rotatable within the cartridge and movable longitudinally in first and second directions within the cartridge; and a plurality of testing members (708) each arranged to be supported temporarily by at least one of the plurality of cartridge brackets, each of the testing members including) a hole (306) through which the spindle is located, the spindle having a plurality of spindle brackets (706) disposed on an outer surface thereof, each spindle bracket being movable between first and second positions.
US09237856B2
A light detecting apparatus includes: a first photoelectric conversion element unit (110) and a second photoelectric conversion element unit (120) each of which converts input light to an electric current and output it; an optical current transducer unit (100) for outputting, as a detected current, a differential current between an electric current outputted by the first photoelectric conversion element unit and an electric current outputted by the second photoelectric conversion element unit; and a first current/voltage converting unit (200) for amplifying the detected current outputted from the optical current transducer unit, converting it to a voltage signal, and outputting the voltage signal.
US09237850B2
A method and system are presented for use in determining one or more parameters of a subject. A region of interest of the subject is irradiated with acoustic tagging radiation, which comprises at least one acoustic tagging beam. At least a portion of the region of interest is irradiated with at least one electromagnetic beam of a predetermined frequency range. Electromagnetic radiation response of the at least portion of the region of interest is detected and measured data indicative thereof is generated. The detected response comprises electromagnetic radiation tagged by the acoustic radiation. This enables processing of the measured data indicative of the detected electromagnetic radiation response to determine at least one parameter of the subject in a region corresponding to the locations in the medium at which the electromagnetic radiation has been tagged by the acoustic radiation, and outputting data indicative of the at least one determined parameter.
US09237849B1
A machine-implemented display method that, with respect to a volume dataset being rendered, enables a user to navigate to any position in space and look in any direction. An enhanced display method for this type of dataset improves upon known Maximum Intensity Projection (MIP) techniques. The enhanced method, “Relative MIP,” uses a different approach to pixel value rendering. Relative MIP draws information from an amount of difference present between a current pixel and its neighbors, and then visualizes the maximum intensity of this difference.
US09237847B2
An ophthalmoscope device includes a support structure, an image capture device, and a display device. The support structure is configured to be worn by a subject. The image capture device is configured to capture images of the eye fundus of the subject. The display device is configured to overlay images in the field of view of the subject. The overlaid images are used to align the pupil/fovea orientation axis with the optical axis of the image capture device.
US09237846B2
A photorefraction ocular screening device for assessing vision and corresponding disorders associated with the human ocular system is provided. More specifically, the present invention provides for a photorefraction ocular screening device employing advanced methods of pupil detection and refractive error analysis. The photorefraction ocular screening device is comprised of an LED arrangement configured with a plurality of irradiation sources serving as visual stimuli, wherein the visual stimuli may be presented in varying illumination patterns to the pupils of an examinee for expanding the range of ocular responses that can be used to determine refractive error.
US09237839B2
A device, system, and method for activating and initializing an in vivo imaging device with an RF radiation signal. Functionality of the in vivo imaging device is tested and results may be reported to a user. The in vivo imaging device may include an RF switch to facilitate powering or deactivation of one or more electrical components of the device. The initialization system may include an optical artifact testing unit, a field of illumination testing unit, and a transmission/reception testing unit. The activation system may comprise an in vivo device association unit which may relate a designated device to a single data recorder or to a single controller.
US09237838B2
The inventive endoscopy system includes a cannula for arranging an endoscope and forming, between said cannula and endoscope, an irrigation or aspiration channel for transporting an irrigation or aspiration fluid, respectively, a connection ring mounted around the cannula and provided with a connection channel connectable to the irrigation or aspiration channel, respectively and a connector which is mounted on the connection ring and includes a transport channel with the connection channel and a first pressure sensor for detecting pressure in the transport channel. The connection ring is provided with a bypass circuit connectable to the irrigation or aspiration channel, respectively and the connector including a dead channel connectable to the bypass circuit and a second pressure sensor for detecting pressure in the dead channel.
US09237834B2
A cyclonic separator comprising a first cyclone stage, a second cyclone stage and an inlet duct. The first cyclone stage comprises a cyclone chamber and a first dirt collection chamber. The second cyclone stage is located downstream of the first cyclone stage and comprises a second dirt collection chamber. The inlet duct carries fluid from an opening in the base of the cyclonic separator to the cyclone chamber, and the first dirt collection chamber surrounds at least partly the inlet duct and the second dirt collection chamber.
US09237833B2
A vacuum cleaner includes a cleaner body and a dust container separably mounted on the cleaner body. The dust container includes a dust collection body including an opening, a wall, and a dust separation part. A cover covers the opening of the dust collection body. An air guide is disposed at the dust collection body, the air guide having an opening provides an inflow hole through which air separated from dust in the dust separation part is introduced, and a filter accommodated in the air guide filters the air separated from the dust. When the cover uncovers the opening of the dust collection body, the filter is visible through the opening of the air guide.
US09237831B1
The present invention is directed to a foam soap delivery system. In accordance with the present invention, the system includes a paperboard core with a plurality of sheets of paper or tissue wound around the paperboard core. A dispenser is removably disposed within the paperboard core, and a water-soluble sheet soap is disposed within the dispenser.
US09237829B2
The hob (1) comprises a support plate (2) which has a treatment area (3) and the cooking vessel (50) has rotary blades (53) connected to an upper magnetic coupling member (54). Below the plate (2) of the hob (1) there is a lower magnetic coupling member (4) rotatably driven by an actuator (6) to magnetically transmit torque to the upper magnetic coupling member (54) of the vessel (50). The hob (1) includes a lower magnetic element (8) below the plate (2) and the vessel has an upper magnetic element (58), which are at the same predetermined distance from the rotating shafts (E1, E2) of the respective magnetic coupling members. When the vessel (50) is in a predetermined angular position, the magnetic attraction between the lower and upper magnetic elements (8, 58) applies opposition to the rotation of the vessel (50).
US09237823B2
The invention concerns a beverage production system comprising a capsule (1) and a module (2) for producing a beverage from the capsule, the capsule (1) comprising an enclosure (1a) and a rim (1b), and the module (2) comprising: a first capsule engagement member (3), which can be displaced relative to a second, co-operating capsule engagement member (4) between a capsule discharge position and a beverage production position, the displaceable first capsule engagement member (3) comprising member (13) having the shape of a hollow bell, and the capsule (1) presenting an enclosure outer shape that is conformal to at least a portion of the hollow bell shaped member (13) and the capsule presenting a rim (1b) size such that at least a part of the rim of the capsule extends beyond at least a part of the first capsule engagement member (3) once it is engaged in the first capsule engagement member, wherein the displaceable first capsule engagement member (3) comprises retaining means able to create friction with discrete parts of the outer shape of the enclosure (1a) of the capsule, and wherein the module (2) comprises means for engaging the rim (1b) of the capsule extending beyond the first capsule engagement member when the first capsule engagement member (3) is displaced from the beverage production position to its opened capsule-insertion position.
US09237822B2
A fruit squeezer for squeezing juice picks up, squeezes and discards the squeezed fruit with use of a single hand. The squeezer has a first handle and a second handle that are rotatably connected to each other. Each handle has a top portion and a bottom portion. A biasing spring biases the top and bottom portions apart. A U-shaped jaw is fixed to the bottom end of the second handle. A pressing plate jaw is pivotally mounted to the bottom end of the first handle. Squeezing the top ends of the handles toward each other against the force of a spring moves the jaws for squeezing the fruit. A screen operatively connected to the handles simultaneously rotates at a second pivot axis from a rest position to a screening position below the fruit for screening solids from the squeezed juice.
US09237821B2
The present embodiments provide for a system of fastening devices, e.g., mounts, brackets, and assemblies for installing roller window shades. In one embodiment, the fastening device system comprises two one-piece, disk-shaped mounting brackets, one for each end of a shade tube, wherein the mounting brackets are configured such that, in use, the outer circumference of the brackets are visible; the mounting means being largely hidden within the bracket or by the shade. In a particular embodiment, the fastening system is designed for use with motorized shades, wherein one mounting bracket is configured to key the shade motor, and one mounting bracket is configured to receive the idler pin.
US09237819B1
A device for hanging an object on a wall includes a crossbar, a knuckle, an arm, and an end cap. The crossbar includes a track extending between two opposing ends of the crossbar. The knuckle is slidably coupled to the crossbar such that the knuckle is slidable in a first direction. The knuckle includes a projection that has a pair of parallel sides. The arm has a marking pin that projects generally perpendicular from a forward surface of the arm. The arm is coupled to the crossbar via the knuckle such that the arm is slidable along the pair of parallel sides of the projection in a second direction. The end cap is coupled to one of the two opposing ends of the crossbar. The end cap includes an “L” bracket that provides an engagement surface for engaging a corner of a second object previously hung on the wall.
US09237818B2
A mounting assembly for a medal is provided. The medal is coupled to a ribbon. The mounting assembly includes a housing, a magnet disposed in the housing, and a clip member having first and second walls. The first wall has a first surface and a second surface. The second wall has a biasing portion extending toward the first wall. The second wall is coupled to the housing such that a gap is formed between the biasing portion and the first surface of the first wall. The mounting assembly further includes an adhesive sheet that is disposed on the second surface of the first wall. The adhesive sheet is configured to hold the medal thereon.
US09237792B2
When a turning portion on the front end side of the cover is turned in one direction, a turning-portion engagement part disposed in the turning portion engages with a container main body-side engagement part so as to close the cover. When the turning portion of the cover is turned in the opposite direction, engagement between the turning-portion engagement part and the container main body-side engagement part is released. When the turning portion is kept turned in the opposite direction, a turning-portion opening-operation auxiliary portion disposed in the turning portion abuts on a container main body-side opening-operation auxiliary portion and the cover can be pressed up with a weak force by the principle of the lever.
US09237780B2
A conditionally visible bite line may be demarcated on a shoe upper using one of a fluorescent material and an Infrared (IR) material. Such a conditionally visible bite line may be observable only under particular conditions, such as when illuminated by an ultraviolet light source or an IR light source, as appropriate. A light may be projected to intersect the conditionally visible bite line under conditions rendering the conditionally visible bite line detectable. The intersection(s) of the projected light and the conditionally visible bite line may be used to create a virtual bite line for use in generating a tool path to process the surface of a shoe upper bounded by the conditionally visible bite line.
US09237776B2
An accessory for a hat is disclosed which a wearer can use to show support for a team, cause or event and/or to protect the wearer from rain and damaging UV rays. In particular, the hat accessory may receive a protective covering with printed indicia on the exterior surface thereof. The protective covering may also be coated with a water repellent and also embedded with a treatment for UV protection. The protective covering may be removably attachable to the hat accessory so that the wearer can show support to a particular team, event or cause depending on the circumstances.
US09237772B2
A garment configured to be worn by a wearer having two breasts may include a set of two support structures and a housing. The support structures may be positioned within the housing such that each support structure corresponds to a position between a center and a bottom of one of the wearer's breasts when the garment is worn by the wearer. Each support structure may be configured to reposition a portion of a volume of the wearer's respective breast and support a portion of a weight of the wearer's respective breast when worn by the wearer. Optionally, the garment may include a set of flexible structures positioned within the housing such that each flexible structure is coincident with one of the support structures of the set of two support structures. The housing may wrap around the wearer's chest, thereby enabling the wearer to wear the garment.
US09237766B2
A refrigerator includes a cabinet defining an open storage space and including a door with an exterior side and an interior side adapted to receive a modular component. The modular component includes a base removably connected to the interior side and has a first edge and a second edge. A component door is hingedly-connected to the first edge of the base and is operable between an open position and a closed position. The base and component door define a sealed compartment when the component door is in the closed position. First fasteners are disposed on the component door, and second fasteners are disposed on the base. The second fasteners engage the first fasteners to create an airtight seal between the component door and the base. A vacuum device is in communication with the sealed compartment and a heat sealer is disposed on the base or the component door.
US09237754B1
An apparatus and method for cleaning a poultry carcass. In one exemplary aspect, a conveyor is applied for conveying the carcass along a track and brush device is positioned next to the track for brushing the carcass exterior, wherein the device is embodied with at least one rotatable drum, and to which drum brush hairs are connected, such that opposite ends of the brush hairs are connected to the drum so as to arrange that the brush hairs form a closed loop with the drum.
US09237750B2
The present invention relates to the use of Ornidazole and related compounds as herbicides active on a wide range of photoautotrophic organisms. The compounds of the present invention show effective herbicidal activity while being non-hazardous to the environment and to human health.
US09237731B2
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH552985. The invention thus relates to the plants, seeds and tissue cultures of the variety CH552985, and to methods for producing a corn plant produced by crossing a corn plant of variety CH552985 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH552985.
US09237727B2
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH306764. The invention thus relates to the plants, seeds and tissue cultures of the variety CH306764, and to methods for producing a corn plant produced by crossing a corn plant of variety CH306764 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH306764.
US09237717B2
A soybean cultivar designated S120091 is disclosed. The invention relates to the seeds of soybean cultivar S120091, to the plants of soybean cultivar S120091, to the plant parts of soybean cultivar S120091, and to methods for producing progeny of soybean cultivar S120091. The invention also relates to methods for producing a soybean plant containing in its genetic material one or more transgenes and to the transgenic soybean plants and plant parts produced by those methods. The invention also relates to soybean cultivars or breeding cultivars, and plant parts derived from soybean cultivar S120091. The invention also relates to methods for producing other soybean cultivars, lines, or plant parts derived from soybean cultivar S120091, and to the soybean plants, varieties, and their parts derived from use of those methods. The invention further relates to hybrid soybean seeds, plants, and plant parts produced by crossing cultivar S120091 with another soybean cultivar.
US09237715B2
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH844202. The invention thus relates to the plants, seeds and tissue cultures of the variety CH844202, and to methods for producing a corn plant produced by crossing a corn plant of variety CH844202 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH844202.
US09237708B1
A novel maize variety designated PH253R and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH253R with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH253R through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH253R or a locus conversion of PH253R with another maize variety.
US09237702B1
A novel maize variety designated PH25M1 and seed, plants and plant parts thereof. Methods for producing a maize plant that comprise crossing maize variety PH25M1 with another maize plant. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH25M1 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. Hybrid maize seed, plant or plant part produced by crossing the variety PH25M1 or a locus conversion of PH25M1 with another maize variety.
US09237700B1
Disclosed is the seed of a novel soybean variety, designated SCH24258, a sample of which is deposited under ATCC Accession No. PTA-122197. Also disclosed are plants, or parts thereof, grown from the seed of the variety, plants having the morphological and physiological characteristics of the SCH24258 variety, and methods of using the plant or parts thereof in a soybean breeding program.
US09237699B2
The invention relates to the novel cotton variety designated 11R154B2R2. Provided by the invention are the seeds, plants, plant parts and derivatives of the cotton variety 11R154B2R2. Also provided by the invention are methods of using cotton variety 11R154B2R2 and products derived therefrom. Still further provided by the invention are methods for producing cotton plants by crossing the cotton variety 11R154B2R2 with itself or another cotton variety and plants and seeds produced by such methods.
US09237698B2
The invention relates to the novel cotton variety designated 11R136B2R2. Provided by the invention are the seeds, plants, plant parts and derivatives of the cotton variety 11R136B2R2. Also provided by the invention are methods of using cotton variety 11R136B2R2 and products derived therefrom. Still further provided by the invention are methods for producing cotton plants by crossing the cotton variety 11R136B2R2 with itself or another cotton variety and plants and seeds produced by such methods.
US09237697B2
The invention relates to the soybean variety designated A1036292. Provided by the invention are the seeds, plants and derivatives of the soybean variety A1036292. Also provided by the invention are tissue cultures of the soybean variety A1036292 and the plants regenerated therefrom. Still further provided by the invention are methods for producing soybean plants by crossing the soybean variety A1036292 with itself or another soybean variety and plants produced by such methods.
US09237692B2
A molded planter includes a container and a separate rim insert for providing the appearance of a wide upper rim. The rim insert is configured to snap fit into the upper annular edge of the container. When the rim insert and container are assembled, the upper annular edge of the container extends to or above the upper surface of the rim insert such that there is no visible seam between the container and rim insert when the planter is viewed from the side.
US09241435B2
An electronic device housing includes a plastic substrate. The plastic substrate includes a first surface. The electronic device housing further includes an activating layer formed on the first surface. The activating layer contains metal powder. The activating layer defines a recessed portion. Some of the metal powder is partially exposed on the surface of the recessed portion. Some of metal powder is partially inserted into the plastic substrate corresponding to the recessed portion. The electronic device housing further includes an antenna layer formed on the recessed portion. The antenna layer is a metal layer. A method for manufacturing the electronic device housing is also disclosed.
US09241422B2
A multidirectional support structure for tablet display apparatus includes a support member having a first end section and a second end section opposite to the first end section. The first end section is pivotally connected with an angle adjustment seat. The angle adjustment seat is further pivotally connected with a rotatable connection assembly. The connection assembly is formed with a receiving space for receiving the tablet display apparatus. The second end section of the support member is pivotally connected with one side of a base seat. The other side of the base seat is pivotally connected with a board body. The board body can be connected with multiple press keys as necessary to form a keyboard. Accordingly, the tablet display apparatus can be co-used with the keyboard and rotated and tilted by different angles and supported in different inclined positions.
US09241419B2
A bracket fixing hole that is configured to insert a screw part of a bracket fixing screw that is configured to mount the bracket to a bracket mounting part, a clamp hole that is configured to mount a cable clamp, and at least two notches that are configured to position the bracket to the at least two convex parts of the bracket mounting part are formed to a bracket. The bracket fixing hole and the clamp hole are faced on the opposed sides in such a manner that a first line segment that connects parts of the two notches is disposed between the holes. A second line segment that connects a center of the bracket fixing hole and a center of the clamp hole and the first line segment generally bisect each other at right angles. A gravity center is disposed on the side of the bracket fixing hole to the first line segment.
US09241414B2
A bezel-less display is disclosed that includes an electronic display device and a cover. The electronic display device has an image-displaying portion and another portion adjacent the image-displaying portion along at least one side. The cover, which may include a glass or plastic sheet, is positioned adjacent the electronic display device and includes a first portion positioned adjacent the image-displaying portion of the display device and a second portion positioned adjacent the other portion of the display device. The optical properties of the first portion are also selected to transmit images displayed on the image-displaying portion and the optical properties of the second portion are selected to mask the other portion of the display device.
US09241399B2
A printed circuit board according to an embodiment of the present invention includes a substrate including a first metal layer, a second metal layer formed on one surface of the first metal layer, and a third metal layer formed on the other surface of the first metal layer, an insulating layer formed on the second metal layer, and a circuit pattern formed on the insulating layer. A cavity configured to accommodate a light emitting element package is formed in the insulating layer. A thermal conductivity of the first metal layer is greater than thermal conductivities of the second metal layer and the third metal layer.
US09241397B2
Disclosed is a microwave plasma processing apparatus including: a processing container configured to define a processing space a microwave generator configured to generate microwaves for generating plasma of a processing gas introduced into the processing space, a distributor configured to distribute the microwaves to a plurality of waveguides using a variable distribution ratio, an antenna installed in the processing container to seal the processing space and configured to radiate the microwaves distributed to each of the plurality of waveguides by the distributor to the processing space, a monitor unit configured to monitor a power of the microwaves distributed to each of the plurality of waveguides by the distributor, and a distribution ratio control unit configured to correct the distribution ratio used for distribution of the microwaves by the distributor based on a difference between a ratio of the power of the microwaves monitored by the monitor unit and a previously designated distribution ratio.
US09241395B2
A method and apparatus for improved control of the trajectory and timing of droplets of target material in a laser produced plasma (LPP) extreme ultraviolet (EUV) light system is disclosed. A droplet illumination module generates two laser curtains for detecting the droplets. The first curtain is used for detecting the position of the droplets relative to a desired trajectory to the irradiation site so that the position of a droplet generator may be adjusted to direct the droplets to the irradiation site, as in the prior art. A droplet detection module detects each droplet as it passes through the second curtain, determines when the source laser should generate a pulse so that the pulse arrives at the irradiation site at the same time as the droplet, and sends a signal to the source laser to fire at the correct time.
US09241391B2
The present invention is directed to an electrical wiring assembly that includes a wall plate cover, a housing portion and an electro-optical assembly coupled to a plurality of wiring terminations. The assembly includes a circuit configured to provide an output signal in response to an external input signal. The assembly also includes a plurality of lighting elements coupled to the circuit and configured to emit the plurality of light beams in response to the output signal. The electro-optical assembly further includes an ambient light sensor accessible to the ambient space via at least one of the plurality of openings. The ambient light sensor is configured to generate the at least one external input signal in response to an ambient light level in the ambient space, the ambient light sensor being substantially isolated from the plurality of light beams.
US09241388B2
A method of manufacturing a light-emitting device which includes a light-emitting source is provided by applying, onto the light-emitting source, a fluorescent resin which includes fluorescent particles and is stored in and discharged from an applicator. The method includes measuring a first concentration which is a concentration of the fluorescent particles included in the fluorescent resin discharged from the applicator; and applying, onto the light-emitting source, the fluorescent resin in an application amount determined based on the first concentration which has been measured and reference data which indicates a relationship between a concentration of the fluorescent particles and an application amount of the fluorescent resin that enables the light-emitting device to have constant chromaticity.
US09241383B2
A light-emitting device (10) includes a plurality of light-emitting areas (10a, 10b and 10c), and each of the light-emitting areas (10a, 10b and 10c) includes a first light-emitting block (3) and a second light-emitting block (4). Each respective first light-emitting blocks (3) include a plurality of first light-emitting elements (A1, A2, or A3), which are connected in series, and each respective second light-emitting blocks (4) include a plurality of second light-emitting elements (B1, B2, or B3), which are connected in series. The number of first light-emitting elements in each respective first light-emitting blocks (3) is the same with one another of the first light-emitting blocks (3), and the number of second light-emitting elements in each respective second light-emitting blocks (4) is the same with one another of the second light-emitting blocks (4).
US09241377B2
A light emitting diode (LED) backlight driving circuit includes a power supply, an LED light bar, and a constant current driving chip that adjusts brightness of the LED light bar. The constant current driving chip receives the PWM dimming signal. N boost units are connected in series between the power supply and the LED light bar, and the N boost units are connected in parallel with each other. Comparing units are correspondingly coupled to control ends of one or more of (N−1) boost units. When a duty ratio of the PWM dimming signal is less than a preset threshold, the comparing unit drives a corresponding boost unit to turn off. N is an integer greater than or equal to 2.
US09241369B2
A method of connecting a plurality of portable terminal over a wireless local area network (WLAN), the method including: a user selecting at least one contact from a contact list displayed on a screen of a first portable terminal, transmitting, from the first portable terminal to an external server over a cellular network, connection information necessary for establishing a WLAN link to the first portable terminal; pushing the connection information from the external server to a second portable terminal corresponding to the selected contact; a user pressing a connection authentication button on a selection menu displayed on the second portable terminal, and establishing the WLAN link to the first portable terminal from the second portable terminal by using the connection information.
US09241361B2
A method of handling device to device communication for a first user equipment (UE) in a wireless communication system includes establishing a Radio Resource Control (RRC) connection to a network of the wireless communication system; and receiving a first RRC message indicating to the first UE to use a first data radio bearer (DRB) for a proximity-based services (ProSe) communication with a second UE of the wireless communication system, wherein the first DRB is different from a second DRB for communication between the first UE and the network.
US09241354B2
A method and apparatus for transmitting a transport network layer (TNL) address in a wireless communication system is provided. A home eNodeB (HeNB)/X2-proxy determines a TNL address and an eNB ID to be transmitted in a configuration transfer message based on an indication whether a direct X2 interface or an indirect X2 interface is to be established between a macro eNB and a HeNB. Or, in case that the direct X2 interface between the macro eNB and the HeNB is not available, the HeNB GW/X2-proxy modifies the TNL address of the HeNB and the eNB ID of the HeNB in the configuration transfer message into a TNL address of the NeNB GW/X2-proxy and an eNB ID of the HeNB GW/X2-proxy.
US09241348B2
Embodiments herein relate to a method in a user equipment (10) for requesting access to a radio communications network (1), which user equipment (10) comprises at least two transmit antenna ports. The user equipment (10) obtains one or more random access preambles to be used to access the radio communications network. The user equipment (10) transmits; in case of obtaining one random access preamble, the one random access preamble over the at least two transmit antenna ports. In case of obtaining more than one random access preambles, the user equipment (10) transmits each random access preamble over a separate antenna port out of the at least two transmit antenna ports.
US09241346B2
A method and apparatus for data transmissions in a wireless network are disclosed. A first device may send a first frame to a second device including information regarding a number of pending data frames to be transmitted from the first device to the second device. The first device receives an acknowledgement frame including a number of approved data frames for transmission from the first device to the second device. The first device then may send a plurality of data frames without performing the contention-based channel access procedure in response to the acknowledgement frame. The first device may send a first frame to a second device for requesting data frames that are pending at the second device. The first device receives an acknowledgement frame including a number of pending and approved data frames. The first device may receive a plurality of data frames in response to the acknowledgement frame.
US09241340B2
The present invention relates to a way that a machine type communication module transmits/receives data, using a sleep mode or avoiding a busy time of a base station. That is, the present invention relates to an apparatus for scheduling in LTE machine type communication in which a machine type communication module transmits/receives data, using a sleep mode or avoiding a busy time of a base station for a response to an order or for a periodic report. The apparatus for scheduling in LTE machine type communication includes a machine type communication module that performs machine type communication with a base station.
US09241327B2
Disclosed in some examples is a method of wireless resource block assignment in a long term evolution wireless network including creating a downlink control information message for a user equipment, the downlink control information message comprising: a resource block assignment field which indicates up to N physical resource blocks scheduled to the user equipment by specifying an index into a plurality of all possible physical resource block allocations of between 1 and N resource blocks, wherein the resource block assignment field comprises at most a number of bits necessary to address all of the possible physical resource block allocations for assignments of 1 to N physical resource blocks, and wherein N is less than a total number of physical resource blocks; and sending the downlink control information over a physical downlink control channel using orthogonal frequency division multiplexing.
US09241325B2
A method and an apparatus for providing channel sharing are disclosed. For example, the method receives a request for a white space channel assignment, and identifies one or more white space channels in accordance with the request. The method sends a response to the request comprising a white space channel assignment, wherein the white space channel assignment assigns one of the identified one or more white space channels.
US09241322B2
Techniques disclosed herein provide for enhanced LTE Positioning Protocol (LPP) Reliable Transport where the receiver of an LPP message sends a non-piggybacked acknowledgement. An example method for executing on a mobile device a protocol session with a location server includes sending a first protocol session message associated with a first protocol session to the location server, entering a wait-for-acknowledgement state in which uplink transmissions from the mobile device to the location server are suspended while waiting for an acknowledgement from the location server in response to the first protocol session message, receiving a second protocol session message associated with a second protocol session which is not an acknowledgement to the first protocol session message but includes information requested in the first protocol session message; exiting the wait-for-acknowledgement state responsive to receiving the second protocol session message; and performing an action using the information received in the second protocol session message.
US09241307B2
Methods and stations for wireless communication are described herein. In some aspects, the station may include a processing circuit configured to process a first signal transmitted to the station, the first signal indicating a target wake up time when an activation signal is expected to be received. The station may further include a wake-up circuit configured to transition a first receiver to an awake state based on the indicated target wake up time. The first receiver is configured to receive the activation signal at the indicated target wake up time. The station may further include a second receiver configured to transition to an awake state based on the first receiver receiving the activation signal and receive a second signal while in the awake state.
US09241299B2
The present invention discloses a method and a device for discovering a UE, a first UE and a base station. The method for discovering a UE comprises the steps of: monitoring, by a first UE, an uplink signal in a mobile communication system; extracting, by the first UE, first information for identifying a UE that is to be discovered and that transmits the uplink signal from the monitored uplink signal; transmitting, by the first UE, a monitoring report message carrying the first information to a base station, acquiring, by the first UE, the device ID of the UE to be discovered in accordance with the monitoring report response message and completing the discovery process of the UE. According to the present invention, it is able to discover the UE without changing a channel system of an existing system and occupying time-frequency resources of the system.
US09241298B2
Access terminals are adapted to transmit a plurality of previously successful access probes to a network node, and determine an initial transmission power level for subsequent access attempts. The initial transmission power level can be determined based at least in part on one or more parameters associated with the plurality of previously successful access probes. An initial access probe of a subsequent access attempt can then be transmitted at the determined initial transmission power level. Network nodes that receive the one or more access probes from access terminals can send a message instructing the access terminals to employ a particular initial transmission power level for a subsequent access attempt. Other aspects, embodiments, and features are also included.
US09241294B2
A base station for a communication system and a handoff method thereof are provided. The base station comprises a transceiver and a processor. The transceiver receives a measurement report message with a present reference signal received quality from a wireless device. The processor electrically connected to the transceiver calculates a next report period, estimates a next reference signal received quality and adjusts a first threshold according to a variance of a reference signal received quality. The processor further enables the transceiver to transmit a first measurement control message to the wireless device according to the next report period. The handoff decision process is triggered based on the first threshold and the next reference signal received quality.
US09241291B2
A method for reducing handover interruption time in a mobile station is disclosed, in which a mobile station performs a ranging procedure using a dedicated ranging code previously allocated from a target base station. The dedicated ranging code allocated by the target base station may be provided through the serving base station, or may directly be provided from the target base station.
US09241279B2
A communication control apparatus that controls a wireless communication between a base station and a terminal, the communication control apparatus including: a memory configured to store combinations of each of threshold values, each of areas, and each of realtimenesses, and a processor configured to obtain a specified threshold value of the threshold values by referring the combinations in accordance with a specified area and a specified realtimeness, the specified area being one of the areas where the terminal is located, the specified realtimeness being one of the realtimenesses and being information which indicates how long a delay time from requesting a data communication to performing the data communication is acceptable, and to permit the terminal the data communication, when a channel quality between the terminal and the base station is better than the specified threshold value.
US09241277B2
The disclosed embodiments include a method for monitoring and optimizing network performance to a wireless device that includes determining network performance information of a wireless router and communicating data packets containing the network performance information to a network management device. In one embodiment, the network management device is configured to transmit instructional data packets to the wireless router that include instructions for optimizing network performance associated with the wireless device in response to identify a network performance problem associated with the wireless router.
US09241273B2
Methods, corresponding apparatuses, and computer program products for configuring one or more signaling radio bearers are disclosed. A method comprises sending a configuration request for configuring one or more signaling radio bearers to a local area access point by which a user equipment is connected to a wide area base station, wherein the one or more signaling radio bearers are used for communication between the user equipment and the wide area base station. The method also comprises receiving configuration information with respect to the one or more signaling radio bearers from the local area access point. The method additionally comprises sending the configuration information with respect to the one or more signaling radio bearers to the user equipment via a radio resource control message. With the claimed inventions, the wide area base station is capable of efficiently configuring the signaling radio bearers for use between the wide area base station and the user equipment via the local area access point.
US09241269B1
A method of identifying a subscribing customer of a service on a Wi-Fi network is disclosed, the method comprising, in response to selection of an application on a mobile communication device, the application designed to access a service, transmitting either a carrier IP address assigned to the mobile communication device or a media access control address assigned to the mobile communications device, the carrier IP address or media access control address embedded in a payload of an IP datagram over a Wi-Fi network to a server, confirming at the server that the carrier IP address or media access control address belongs to a subscribing customer for the service and that the account of the subscribing customer is in good standing, sending back from the server to the mobile communication device a transmission containing an authentication token, and, granting access to the service to the mobile communication device.
US09241266B2
The present invention relates to an authentication system, a small base station, and an authentication method which allow a server side to authenticate whether an installation position of a small base station is valid or not. In a packet to be sent as an authentication request from the femto base station 1, in-IC card information of an IC card inserted into the femto base station 1 is contained. A network terminating device 2 converts a local IP address described in a header of the packet to a global IP address, and sends it to a femto concentrator 4. The femto concentrator 4 generates authentication information by associating the in-IC card information with the global IP address, and sends it to an authentication server 5. The authentication server 5 determines that the installation position of the femto base station 1 is valid if the in-IC card information and global IP address included in the authentication information have been associated with each other and registered in an authentication table. The present invention can be applied to a base station for a femtocell.
US09241265B2
An approach is presented for handling incoming status messages with respect to a request and/or a communication channel (e.g., PSMS). A PSMS client causes, at least in part, a transmission of a request over a communication channel, the request originating from an application associated with a device. A status message client of the PSMS client causes, at least in part, a monitoring of one or more inboxes associated with the communication channel for one or more status messages related to the communication channel, the request, or a combination thereof. The status message client causes, at least in part, a presentation of a representation of at least a portion of the one or more status messages, status information interpreted from the one or more status messages, or a combination thereof in a user interface of the application.
US09241252B2
Systems and methods for identifying an entity associated with a wireless network access point are provided. An estimated location of a wireless network access point and a network name associated with a wireless network access point can be accessed. The network name can be analyzed to identify at least one text signal. An entity associated with the wireless network access point can be identified based at least in part on the text signal. For instance, a confidence score for a plurality of candidate entities identified using the estimated location of the wireless network access point can be determined based on the text signal. The confidence score can be used to identify the entity associated with the wireless network access point. Information associated with the entity can be presented in a graphical user interface.
US09241250B2
Embodiments of the present invention provide a system and method which overcome the limitations of CAMEL systems which do not natively support reauthorization functionality. The system and method provide a mediation mechanism by which an online charging systems that supports reauthorization functionality can run using the mediation mechanism over CAMEL system. The mediation mechanism provides a means for added user credits to be utilized and allows the user to continue with the activity in which the user was engaged. This is advantageous both to the user and the service provider.
US09241244B2
A method for receiving a multimedia broadcast multicast service (MBMS) by a user equipment (UE) in a wireless communication system, the method comprising acquiring, by the UE, a predetermined system information block (SIB) from a base station (BS); and upon acquiring the predetermined SIB, transmitting an MBMS interest indication message by the UE to the BS. The predetermined SIB includes information related to MBMS service continuity. Whether the transmitting of the MBMS interest indication message is allowed is provided to the UE through the predetermined SIB.
US09241230B2
An approach and device for optimizing a sound system by extracting a two-channel stereo source out of a set of multiple channels with unknown frequency responses, crosstalk, time delays and sample rate by employing a digital test sequence that utilizes maximum-length-sequences (MLS) that is fed into the sound system and results in a reconstructed stereo source that may be further used as an input to a signal processor that performs improved speaker and room equalization.
US09241221B2
A thermoacoustic chip includes a shell having a hole and a speaker located in the shell. The speaker includes a substrate having a surface, a sound wave generator located on the surface of the substrate and opposite to the hole of the shell, and, a first electrode and a second electrode. The first electrode and the second electrode are spaced from each other and electrically connected to the sound wave generator.
US09241220B2
A speaker device includes a diaphragm, a frame supporting the diaphragm vibratably along a vibration direction, and a driving part disposed in proximity of the frame and vibrating the diaphragm corresponding to an audio signal. The driving part includes a magnetic circuit having a magnetic gap formed along a direction different from the vibration direction of the diaphragm, a voice coil supporting part having a voice coil and vibrating along the magnetic gap, and a vibration-direction-conversion part direction-converting the vibration of the voice coil supporting part and transmitting the vibration to the diaphragm. The vibration-direction-conversion part includes a link body angle-converting a link part formed between the voice coil supporting part and the diaphragm.
US09241211B2
A tubular body having an air flow passage, wherein an area of a cross section, in a direction perpendicular to a tube axis, of a space enclosed with an inner wall of the tubular body increases toward an open end thereof, wherein a curvature of the inner wall at an end portion of the tubular body near the open end is repeatedly increased and decreased along a circumferential direction of the inner wall, and wherein, when the inner wall in a cross section of the end portion in the direction perpendicular to the tube axis is viewed from the tube axis, a convex portion at which the inner wall protrudes in a direction away from the tube axis and a concave portion at which the inner wall is recessed in a direction toward the tube axis are repeatedly formed along the circumferential direction.
US09241209B2
A wearable audio component includes a first cable and an audio source in electrical communication with the first cable. A housing defines an interior and an exterior, the audio source being contained within the interior thereof. The exterior includes an ear engaging surface, an outer surface, and a peripheral surface extending between the front and outer surfaces. The peripheral surface includes a channel open along a length to surrounding portions of the peripheral surface and having a depth to extend partially between the front and outer surfaces. A portion of the channel is covered by a bridge member that defines an aperture between and open to adjacent portions of the channel. The cable is connected with the housing at a first location disposed within the channel remote from the bridge member and is captured in so as to extend through the aperture in a slidable engagement therewith.
US09241208B2
A communication shield assembly covers a mouth of a wearer when the wearer speaks into a mouthpiece. The assembly includes an audio headset including a head strap and a speaker. The speaker is coupled to the head strap. A microphone has an arm member and a mouthpiece. A first end of the arm member is coupled to the audio headset and a second end of the arm member is coupled to the mouthpiece. The mouthpiece extends in front of a mouth of a user for transmitting audio information to an external receiver when the user speaks into the mouthpiece. A shield is coupled to the microphone and is positioned adjacent to the mouthpiece wherein the shield covers the mouth of the user when the user speaks into the mouthpiece.
US09241206B2
A loudspeaker enclosure defined by one or more panels housing a drive unit. The drive unit includes a coil, a diaphragm, and a magnet. The magnet is decoupled from the one or more panels of the loudspeaker enclosure. Sound is generated by the movement of the diaphragm and complementary movement of the magnet, on application of an appropriate electrical signal to the coil. The moving diaphragm acts against a first volume of air within the enclosure, while the movement of a surface coupled to the magnet, acts against a second air volume, different from the first volume. The surface coupled to the magnet is decoupled from the one or more panels of the loudspeaker enclosure.
US09241198B2
A method and system for automatically scheduling television commercials within the broadcasting content have been disclosed. A program scheduling module schedules television programs (broadcasting content) with respect to specific time-slots for advertisement insertion. An advertisement scheduling module schedules television commercials to be inserted into the broadcast content. The advertisement module determines time slots in the television programs for inserting television commercials, and dynamically inserts television commercials at specific time slots within the television programs prior to broadcasting.
US09241188B2
A system that incorporates teachings of the present disclosure may include, for example, a media processor having a controller to receive media content from a subscriber of a media communication system, receive marketing content from a marketing information source, and present the media content and the marketing content in a personal TV channel. Other embodiments are disclosed.
US09241186B2
A system for securely providing adaptive bit rate streaming media content on-demand may include a security sever of a program distributor that selects, based on a received authorized request, which of a differently encrypted stored versions of a “special segment” of the requested program to deliver to the receiving device during the transmission of the requested program. The selection may be based on a pseudo-random selection process per request for the program based on an identifier of the request associated with the remote control device. The selection of which of the differently encrypted stored versions of the “special segment” of the ordered program to deliver may be based on the current session. The secure remote then sends to the receiving device the correct decryption key for the receiving device to decrypt the particular encrypted version selected of the “special segment” to be sent to the receiving device.
US09241173B2
A data compression apparatus 100 and method suitable for image data 50 assembles pixel values 52 into at least one group 55 with a positional index 56. An encoding unit 130 sets a maximum bit plane according to a highest value in the group, and encodes the data values sequentially along the group using iteratively reduced bit plane levels until reaching a lowest bit plane or exhausting the data values in the group, including recording the positional index where the bit plane level is changed, to provide a compressed dataset.
US09241162B2
A moving picture coding apparatus for performing inter-picture predictive coding for pictures constituting a moving picture is provided with a coding unit for performing predictive error coding for image data; a decoding unit for performing predictive error decoding for an output from the coding unit; a reference picture memory for holding output data from the decoding unit; and a motion vector detection unit for detecting motion vectors on the basis of the decoded image data stored in the memory. When coding a B picture as a target picture, information indicating whether or not the target picture should be used as a reference picture when coding another picture is added as header information. Therefore, in a decoding apparatus for decoding a bit stream Bs outputted from the moving picture coding apparatus, management of a memory for holding the reference picture can be facilitated on the basis of the header information.
US09241156B2
A method for estimating the type of the GoP structure of a plurality of video frames in a video stream by estimating their frame types includes: capturing frame sizes in bytes of every video frame subsequent to an initial I-frame to obtain an array of frame sizes by exploiting features of a transport layer carrying the video stream; converting, after a number of frames, the array of frame sizes into an array of zeros and ones; matching the binarized array of frame sizes to a number of predefined short basic binary patterns, said predefined binary patterns depicting all GoP structures to be considered; converting the result of said matching to form a single score value; and determining the particular pattern of the number of predefined patterns of binaries having the best score value, according to a predefined metric.
US09241151B2
A system for displaying a 3D thermal image by using two thermal imaging cameras and extracting distance/depth data in the thermal images. The system includes two thermal imaging cameras where one thermal imaging camera is used as a master camera serving as a reference and the other is used as a slave camera to correct gain and offset of the thermal images and ensure uniformity. In addition, provided is an apparatus and method for correcting gain and offset of the thermal images to be identical to each other and ensuring uniformity by using a process module separately from two thermal imaging cameras.
US09241149B2
A method and system for preparing subtitles for use in a stereoscopic presentation are described. The method allows a subtitle to be displayed without being truncated or masked by comparing the subtitle's initial footprint with an image display area. If any portion of the initial footprint lies outside the image display area, the subtitle is adjusted according to adjustment information, which includes at least one of: a scale factor, a translation amount and a disparity change, so that the adjusted subtitle lies completely within the image display area. Furthermore, the disparity of the subtitle can be adjusted by taking into account the disparities of one or more objects in an underlying image to be displayed with the subtitle.
US09241142B2
The present disclosure provides a stream processor, an associated stream controller and compiler, and associated methods for data processing, such as image processing. In some embodiments, a method includes defining a kernel pattern associated with an image frame, and processing the image frame using the defined kernel pattern. The method can further include generating a kernel switch lookup table based on the defined kernel pattern. In various implementations, the stream controller is operable to direct execution of kernels on the image frame according to the defined kernel pattern and the kernel switch lookup table.
US09241141B1
Sensing systems using projection blocks of structured light provide useful information about the surfaces they are projected onto. A camera captures an image which contains a captured block, that is, an image of the projection block interacting with the surface. Corrections may be applied to the captured image to compensate for distortions produced by projector and/or camera systems and produce a corrected image. Noise may be removed from the corrected image using a bilateral filter, producing a filtered image. The filtered image may be processed to determine a boundary of the captured block.
US09241125B2
A unified recording format allows both recorded programs and paused buffered broadcasts to be stored in memory as a common virtual stream. As content is received on a channel, it is placed into the virtual stream with newer content at the start of the stream and progressively aging content migrating farther downstream. A front section of the stream effectively operates as a pause buffer, as the currently tuned broadcast program is recorded in this section and is responsive to pause/resume commands. Recorded programs are also stored as part of the same virtual stream. Pointers are used to identify the boundaries of the pause buffer, as well as the beginning and end of each recorded program in the virtual stream.
US09241119B2
An image pickup apparatus includes a plurality of pixels. Each pixel includes a photoelectric conversion unit, an amplifying transistor, and a reset transistor. Each pixel is set into a selected state or a non-selected state according to a voltage supplied to an input node of an amplifying transistor via the reset transistor. A control unit controls the reset transistor to turn on or off by supplying a voltage to a control node of the reset transistor. More specifically, a first voltage is supplied to the control node of the reset transistor in the pixel at the selected state to control it in the off-state, and a second voltage is supplied to the control node of the reset transistor in the pixel at the non-selected state to control it to be in the off-state.
US09241116B2
A radiation image pickup apparatus capable of setting an optimum threshold value used for instantaneously and highly accurately detecting the presence/absence of irradiation includes a pixel array having a plurality of pixels arranged in a matrix, where each of the pixels includes a conversion element and a switch element, a drive circuit for supplying a drive signal for controlling the switch element between a conducting state and a non-conducting state, a detection unit for outputting a detection signal varying with the intensity of irradiation of the pixel array, and an arithmetic unit for calculating an end threshold value used to detect end of irradiation on the basis of the signal output from the detection unit during a period of time during which irradiation is applied to the pixel array in which the switch elements of the pixels are set in a non-conducting state by the drive circuit.
US09241112B2
An imaging apparatus includes an imaging unit that captures a subject to generate image data of the subject; a display unit that displays the image; an image separating unit that separates a subject image and a background image from the image displayed; a special effect input unit that receives information related to special effects respectively applied to the subject image and the background image; a special effect image generating unit that generates a special effect image of each of the subject and background images by applying special effects corresponding to information received by the special effect input unit; a storing unit that stores special effect information for assigning an advisability corresponding to a combination of special effects which the special effect image generating unit applies to the subject image and the background image; and a synthetic image generating unit that generates a synthetic image using the generated special effect image.
US09241107B2
An image pickup device includes: an image pickup element; a control portion sequentially resetting charge stored in the image pickup element for every pixel line in a predetermined direction such that an electronic leading blade moves in a simulated manner; and a focal plane shutter.
US09241099B2
A lens barrel (12) of a camera module (1) is provided with an electrode terminal which is connected to a focus adjusting device (11) and to an electrode terminal (32) of a holder (13). The electrode terminal (32) of the holder (13) faces the electrode terminal of the lens barrel (12) which electrode terminal changes in position in accordance with movement of the lens barrel (12) which movement is caused with the use of a lens barrel moving mechanism.
US09241094B2
An event aware video system (EAVS) is to capture video frames during a first time period and process event portion of the video frames before transferring the processed data to a central computing system. The EAVS may establish a present no-event frame from the video frames, wherein a last frame of the video frames is marked as the present no-event frame if the difference between adjacent pair of frames of the video frames is less than a threshold value. The EAVS may establish an event frame, wherein a present frame captured after establishing the no-event frame is marked as the event frame if the difference between the present frame and a previous frame captured prior to the present frame is greater than the threshold value. The EAVS may generate the processed data by processing the event of the event frame.
US09241089B2
An image forming apparatus includes: an acquiring unit; a resolution converting unit; a receiving unit; a position determining unit; a correcting unit; and a scaling unit. The acquiring unit acquires image data composed of a plurality of pixels; the scaling-factor determining unit determines a scaling factor of the acquired image data; the resolution converting unit converts a resolution of the acquired image data into a higher resolution than the resolution of the image data; the receiving unit receives a designation of a sub-scanning directional shift amount of a correction pixel to be corrected; a position determining unit performs a position determining process; and the scaling unit scales the image data at the determined scaling factor by causing the position determining unit and the correcting unit.
US09241085B2
An image processing apparatus includes: an obtaining unit configured to obtain a multi-value image as an obtained image; and a control device configured to: convert the obtained image into a first binary image; determine whether the first binary image is a blank paper image, on the basis of the first binary image; and output a binary image, the binary image outputting including: outputting the first binary image in a case where it is determined that the first binary image is not the blank paper image; and not outputting the first binary image in a case where it is determined that the first binary image is the blank paper image.
US09241068B2
An interactive voice response system receives a communication initiated by a remote requesting party. Based upon receipt at the interactive voice response system of the communication, visual data to provide to the remote requesting party as part of an integrated interactive script is determined. The visual data is provided to the remote requesting party as part of the integrated interactive script. Depending upon a selection of the remote requesting party, individual elements of the integrated interactive script are sent to the remote requesting party iteratively based upon interaction between the remote requesting party and the interactive voice response system, or multiple individual elements of the integrated interactive script are sent together to the remote requesting party, and individually presented to the remote requesting party based upon interaction between the remote requesting party and the interactive voice response system.
US09241060B1
The communication device comprising a first weather implementer, a second weather implementer, a first weather dependent shortcut icon modification implementer, and a second weather dependent shortcut icon modification implementer.
US09241044B2
A method for fetching a content from a web server to a client device is disclosed, using tunnel devices serving as intermediate devices. The client device access an acceleration server to receive a list of available tunnel devices. The requested content is partitioned into slices, and the client device sends a request for the slices to the available tunnel devices. The tunnel devices in turn fetch the slices from the data server, and send the slices to the client device, where the content is reconstructed from the received slices. A client device may also serve as a tunnel device, serving as an intermediate device to other client devices. Similarly, a tunnel device may also serve as a client device for fetching content from a data server. The selection of tunnel devices to be used by a client device may be in the acceleration server, in the client device, or in both. The partition into slices may be overlapping or non-overlapping, and the same slice (or the whole content) may be fetched via multiple tunnel devices.
US09241042B2
A method and system for HTTP request service identify a true URL content regardless of whether the target URL is redirected, and send the true URL content to a client. The requesting and sending of the redirected URL content is done internally in the HTTP server system and do not require the client to have the ability to receive and execute a URL redirection command. The server system receives a URL request from the client and generates within the server a response to the URL request. If the response does not contain any redirection information, the true URL content includes the target URL content; and if the response contains redirection information indicating a redirected URL, the true URL content includes a redirected URL content associated with the redirected URL. The client receives the true URL content in either case by submitting a request for the target URL once.
US09241040B2
A technique and apparatus to provide status tracking of presence and/or location of a mobile, wireless device to a requesting entity even outside of a particular wireless system. This allows wireless service providers the ability to monitor and log changes in the status of mobile stations within and/or outside their networks. Embodiments are disclosed wherein presence and/or location information is provided to entities outside of a particular servicing wireless network using the mechanisms of call processing components of a mobile network (e.g., call setup procedures), and using standard mechanisms currently available to any appropriately conforming Mobile Switching Center (MSC) element. A mobile activity status tracker (MAST) is disclosed which contains a database of information similar to the information contained in the Home Location Register. The MAST tracks and reports status and activity of mobile wireless devices in a wireless network using mobile registration message, mobile inactivity message forwarding, and/or mobile automatic notification of subscriber status to TCP/IP entities (e.g., application servers on the Internet or Intranet). The MAST system duplicates the same or similar information contained in a corresponding HLR, but is available as an external database entity which is not restricted by SS7 standards. The tracking need not track call-specific information, e.g., called telephone numbers or information regarding conversations sustained by the tracked wireless subscribers.
US09241018B2
An image sharing server provides several ways of sharing images between users. After a user contributes images to the image sharing server, the user can interact with the image sharing server to identify and tag people in the images, share the images with other users, and organize the images into memory boxes. Memory boxes can also be shared between users, and multiple users can be granted the ability to add images to a shared memory box. In addition, the image sharing server can prompt a user to share his or her images with other users who contributed related images. The image sharing server also performs facial recognition to automatically identify people in images, and facial recognition models can be shared between users.
US09241013B2
Caller name is authenticated using authentication certificates issued by a registration authority that registers callers who wish to terminate calls to callers subscribed to the registration authority. In one embodiment, the authentication certificates are sent to a called device or a proxy for the called device via a path that is separate from the call setup path. An indication is conveyed to the called party to indicate whether the caller name was successfully authenticated.
US09241011B2
A method and system is provided for assessing the cumulative set of access entitlements to which an entity, of an information system, may be implicitly or explicitly authorized, by virtue of the universe of authorization intent specifications that exist across that information system, or a specified subset thereof, that specify access for that entity or for any entity collectives with which that entity may be directly or transitively affiliated. The effective system-level access granted to the user based upon operating system rules or according to access check methodologies is determined and mapped to administrative tasks to arrive at the cumulative set of access entitlements authorized for the user.
US09240998B2
When a plurality of user terminals request a plurality of contents, the numbers of user terminals which request the content are managed. For each of the plurality of contents, the number of content servers which provide that content is decided using the managed numbers. For each of the plurality of contents, the content is installed in content servers as many as the number decided in association with that content, and user terminals which request the content are permitted to access the content servers which provide the content.
US09240997B1
Aspects of the present invention monitor an electrical circuit in a power over Ethernet (“PoE”) installation to detect potential security breaches and implement a security response upon detecting the security event. The security event may be a disruption to the electrical circuit lasting more than a threshold duration (e.g., 250 ms, 0.5 second, 1 second). The disruption can be an open circuit caused by cutting or unplugging the Ethernet cable. In one aspect, the security response can be discontinuing further communications over the PoE connection.
US09240986B1
A method is used in managing security and wireless signal detection. Information is gathered about analog signal reception at a receiver. Based on the information, a result is produced for use in determining location information at the receiver. The result is used to affect a security decision.
US09240981B2
A system and method can verify trustfulness of a fabric component in an InfiniBand (IB) fabric. A subnet manager that is responsible for authenticating the fabric component using private/public key pairs. The subnet manager can first send a first encrypted message to a fabric component in the IB fabric, wherein the first encrypted message contains a token and is encrypted using a public key associated with the fabric component. Then, the fabric component is allowed to decode the first encrypted message using a private key associated with the fabric component, and to send a second encrypted message back to the subnet manager. Finally, the subnet manager can authenticate the fabric component if the second encrypted message contains correct information.
US09240972B2
A method to improve the registration of “Permanently Registered Users” (User1, User2, . . . User500) in an NGN-IMS subsystem. The permanently registered users are coupled to the IMS subsystem via a group device (AGW1, IP-PBX, SIP/H.323 GW) that is registered in the IMS subsystem as a dedicated IMS virtual user by means of its IMPI/IMPU identifier. The HSS/UPSF server is then allowed to download the user profiles in bulk. This results in fewer loads on the IMS and in a shortened start-up time of the group device(s).
US09240971B2
Systems and methods of the present disclosure facilitate updating the translation provided by one or more name servers from symbolic names to network addresses. In some embodiments, the system includes one or more remote devices, a management server, a configuration module, a detection module, and/or an update module. The management server may be configured to monitor and manage the remote device, which may be provided with network addresses by one or more address provisioning servers. Responsive to the detection module detecting a change in the network address of a remote device, the update module may update one or more name servers using an update program that includes templates for a control file, authentication information, and/or a template obtained from the management server. The detection and update modules can execute on remote devices or on the address provisioning server, and can be installed and configured automatically by the management server.
US09240970B2
A communication collaboration system may include a memory storing machine readable instructions to receive a first signal representing a first mode of communication for a user. The communication collaboration system may further include machine readable instructions to seamlessly escalate the first signal to a second signal representing a second mode of communication for the user. The second mode of communication may be different from the first mode of communication. The communication collaboration system may further include a processor to implement the machine readable instructions.
US09240967B2
A computer-implemented method includes generating a communication to be sent from a sender to a recipient who are related to one another by blood or employment; and scheduling delivery of the communication to the recipient based on a future location of the recipient. The content of the communication and the future location of the recipient are determined from an analysis of electronically-accessible resources by or about the sender, the recipient, or both.
US09240965B2
The present disclosure involves systems, software, and computer implemented methods for monitoring interactions of business processes within networked business processes. One method comprises identifying a networked business process, the networked business process comprising a set of interrelated business processes performed by two or more second network participants. A first message from a first network participant associated with the networked business process is received, where the first message includes information defining an event associated with a first business process performed by the first network participant. At least a second network participant associated with the information defining the event included in the first message is identified. The identified at least second network participant is then notified of the information defining the event included in the first message.
US09240961B2
A bi-directional VLAN bridging path is created on an edge switch in an MVRP environment without administrator intervention using a virtual network profile (VNP) feature running on the edge switch. The VNP feature is configured to detect a device coupled to a port of the edge switch, learn the Medium Access Control (MAC) address of the device on a MVRP-VLAN and automatically convert the MVRP-VLAN to a VNP-Dynamic-VLAN corresponding to a static VLAN to create a bi-directional VLAN Port Association (VPA) for the device.
US09240955B1
A system and method of management of communication in a potentially unreliable wide-area network that contains one or more nodes connected to said network, each potentially having access to one or more inputs and/or outputs and capable of evaluating said inputs and directing said outputs, a global address space (GAS) accessible by said nodes, and a communication system using said GAS that provides communications between said nodes.
US09240954B1
A resource delivery network and method for distributing content in the network is disclosed herein. The network comprises a plurality of servers arranged in tiers and partitioned. Each server includes a resource store with a set of resources for distribution to a successive tier. Updates to each successive tier are provided by a pull-forward client on servers in the tier. This forward propagation mechanism maximizes resource availability at edge servers in the network. Resources transmitted to the edge tier servers may be transformed, combined, and rendered without taxing lower tier servers. Transformation and pre-rendering of data can be performed by low priority CPU tasks at each layer of the system.
US09240952B2
During communication of a large data message from a client application to a server application, requirements to communicate smaller control messages can arise. To facilitate timely communication of control messages, a client application may include a chunking module that divides a data message into chunks that can be sent as a sequence of individual data message packets. When a control message needs to be sent, the sequence of data message packets can be interrupted to send a control message packet. At the server application, the sequence of message packets is processed so that data message packets are appended to a data message and control messages are extracted for immediate processing.
US09240947B2
Enhanced mesh network performance is provided by computation of a path metric with respect to multi-hop paths between nodes in a mesh network and determination of a path through the mesh network that is optimal according to the path metric. Information is communicated in the mesh network according to the determined path. Nodes in the mesh network are enabled to communicate via one or more wireless links and/or one or more wired links. The path metric optionally includes an effective bandwidth path metric having elements (listed from highest to lowest conceptual priority) including an inverse of a sustainable data rate, a number of wireless links, and a number of wireless and wired links. The sustainable data rate is a measure of communication bandwidth that is deliverable by a path for a period of time. Accounting is made for interference between contiguous wireless links operating on the same channel.
US09240944B2
In one embodiment, a method includes receiving a packet from a first host at a first edge device, the packet comprising a layer 3 address of a second host in communication with a second edge device, using the layer 3 address of the second host to receive a layer 2 address and a location identifier for the second host from a database accessible from a core network, the database comprising a mapping of layer 3 host addresses to layer 2 host addresses and location identifiers, and storing a mapping of the layer 2 address to the location identifier at the first edge device for use in forwarding packets to the second host. The first edge device is in communication with the second edge device in an overlay network defined by the edge devices interconnected by the core network. An apparatus and logic are also disclosed herein.
US09240940B2
In accordance with some implementations, a method for evaluating large scale computer systems based on performance is disclosed. A large scale, distributed memory computer system receives topology data, wherein the topology data describes the connections between the plurality of switches and lists the nodes associated with each switch. Based on the received topology data, the system performs a data transfer test for each of the pair of switches. The test includes transferring data between a plurality of nodes and determining a respective overall test result value reflecting overall performance of a respective pair of switches for a plurality of component tests. The system determines that the pair of switches meets minimum performance standards by comparing the overall test result value against an acceptable test value. If the overall test result value does not meet the minimum performance standards, the system reports the respective pair of switches as underperforming.
US09240937B2
The monitoring by a monitoring node of a process performed by a monitored node is often devised as a tightly coupled interaction, but such coupling may reduce the re-use of monitoring resources and processes and increase the administrative complexity of the monitoring scenario. Instead, fault detection and recovery may be designed as a non-proprietary service, wherein a set of monitored nodes, together performing a set of processes, may register for monitoring by a set of monitoring nodes. In the event of a failure of a process, or of an entire monitored node, the monitoring nodes may collaborate to initiate a restart of the processes on the same or a substitute monitored node (possibly in the state last reported by the respective processes). Additionally, failure of a monitoring node may be detected, and all monitored nodes assigned to the failed monitoring node may be reassigned to a substitute monitoring node.
US09240935B2
A disclosed technology can accurately measures the data frame loss between a pair of communication devices even when link aggregation is present between the communication devices. A communication system includes a transmitting device, receiving device, a plurality of transmitting and receiving links, and a measuring device. The transmitting device duplicates for the same number of times as the number of transmitting and receiving links a data frame loss measurement frame in which the total number of transmitted data frames is written, and then transmits them to the transmitting and receiving links. The receiving device writes the total number of received data frames in the received data frame loss measurement frame. The measuring device measures the data frame loss between the transmitting and receiving devices by subtracting the total number of data frames received by the receiving device from the total number of data frames transmitted by the transmitting device.
US09240934B2
Systems and methods are disclosed for monitoring the health of a home area network. An example system includes multiple devices communicatively coupled via a home area network and a gateway device communicatively coupled to the devices via the home area network. The home area network is configured for communicating information regarding a resource consumed at a geographical area serviced by the home area network. The gateway device includes a processor and a computer-readable medium. The processor can execute instructions embodied in the computer-readable medium to perform operations. The operations include monitoring communication metrics describing communications among the devices via the home area network. The operations also include monitoring application-level events generated by applications executed by the devices. The operations also include generating a status indicator for the home area network based on the communication metrics and the application-level events. The status indicator describes a health of the home area network.
US09240932B2
It is provided a user equipment, including mode switching means adapted to switch, autonomously or based on a command from a base station of a communication system to which the user equipment belongs, the user equipment into a low data rate mode; measuring means adapted to measure a downlink reference signal received on a downlink from the base station; feedback preparing means adapted to prepare a feedback based on the measurement by the measuring means; encoding means adapted to encode the feedback, thus obtaining encoded data; modulating means adapted to modulate the encoded data; and providing means adapted to provide the modulated encoded data for being sent on the uplink at a predetermined time after the downlink reference signal was received, if the user equipment is in the low data rate mode.
US09240929B2
In response to a request to duplicate a network, the network is duplicated. The duplicate network includes one or more virtual devices that correspond to one or more devices in the network being duplicated. The devices of the duplicate network are communicatively arranged in a manner consistent with a topology of the network being duplicated. Once the duplicate network is created, access to the duplicate network is provided.
US09240924B2
Certain aspects of the present disclosure relate to a system for replicating BIOS setting data (BIOSSD) across computers. The system includes a plurality of computers, and each computer is connected to a service processor (SP). Each computer includes a BIOS chip, which stores a first BIOSSD collection. The SP stores a second BIOSSD collection. When the first BIOSSD collection is newer, the SP receives a copy of the first BIOSSD collection from the computer to replace the second BIOSSD collection. When the second BIOSSD collection is newer, the SP transmits a copy of the second BIOSSD collection to the computer to replace the first BIOSSD collection in the BIOS chip. A remote management may request and obtain from the SP the updated second BIOSSD collection such that the remote management computer may send the copy the updated second BIOSSD collection to other SP's for update.
US09240909B2
The present invention provides a method of channel estimation implemented in a receiver having multiple antennas configured to receive at least one common pilot available to a plurality of users and a plurality of dedicated pilots. Each dedicated pilot is allocated to one of the plurality of users. The method includes estimating at least one first channel associated with a first user and at least one second channel associated with a second user based on observations of the plurality of dedicated pilots and of said at least one common pilot.
US09240905B2
The disclosure generally relates to mechanisms to protect hybrid networking equipment at a port level granularity and thereby provide capabilities to specify the protection of client services on a port-by-port basis. For example, in one embodiment, a Virtual Connection Point (VCP) may be established as a termination point for a transport-side network connection and configured as a Layer 1 bridge/select connection to switch among any one of a plurality of backplane Layer 1 termination points. The plurality of backplane Layer 1 termination points may be protected using a link aggregation group, wherein a Layer 2 switch may be established to direct packets between the link aggregation group and the VCP configured as the Layer 1 bridge/select connection.
US09240894B2
A network system includes: a core switch; and an edge switch. The edge switch includes: a join message identification unit; and a marking unit. The join message identification unit identifies a join message from among MAC frames from the user network. The marking unit marks mark information to a header of a MAC-in-MAC frame in which the identified join message is encapsulated. The core switch includes: a plurality of input/output ports; a mark identification unit; and a port setup unit. The mark identification unit identifies a MAC-in-MAC frame to whose a header the mark information is marked. The port setup unit associates a multicast group of a join message which is encapsulated in the identified MAC-in-MAC frame, with an input/output port to which the identified MAC-in-MAC frame is input.
US09240881B2
Techniques are disclosed for establishing secure communications between computing devices utilizing proximity services in a communication system. For example, a method for providing secure communications in a communications system comprises the following steps. At least one key is sent from at least one network element of an access network to a first computing device and at least a second computing device. The first computing device and the second computing device utilize the access network to access the communication system and are authenticated by the access network prior to the key being sent. The key is useable by the first computing device and the second computing device to securely communicate with one another when in proximity of one another without communications between the first computing device and the second computing device going through the access network.
US09240868B2
Systems and methods for improving data transmission rates in communication networks are disclosed. In an 802.11 wireless communication network, where a source node of the wireless network transmits TCP data to a destination node of the wireless network, the destination node does not transmit TCP acknowledgments (ACKs) for the TCP data if 802.11 ACKs indicate that the destination node received the TCP data. If a source outside the wireless network transmits TCP data to the destination node within the wireless network through an intermediate device, such as an access point, the destination node suppresses transmitting TCP ACKs. The intermediate device transmits TCP ACKs as proxy for the destination node to the source. The intermediate device also suppresses TCP ACKs where a source node within the wireless network sends the TCP data to a destination node outside of the wireless network.
US09240861B2
A pathway control system, implementing control and setting for a communication pathway between wireless communication devices each implementing wired communication and wireless communication and each equipped with an AMR function, detects communication speed with respect to uplink wireless communication and downlink wireless communication in each wireless communication device, thus determining which one of uplink wireless communication and downlink wireless communication undergoes communication failure. It carries out adaptive modulation control on uplink wireless communication or downlink wireless communication, which undergoes communication failure, calculates new communication speed, and carries out STP pathway control based on new communication speed. Irrespective of a reduction of line speed due to activation of an AMR function, it is possible to automatically switch to redundant pathways by way of STP pathway control; it is possible to prevent momentary disconnection of wireless communication; and it is possible to maintain an adequate capacity for communication pathways.
US09240848B2
An eye quality monitoring system may include an eye quality monitor that includes a charge pump that is configured to output (a) a first charge in a first direction upon detection of a first transition of a sampled non-return-to-zero (NRZ) data signal in a first region of a unit interval of an eye pattern, and (b) a second charge in a second direction upon detection of a second transition of the sampled NRZ data signal in a second region of the unit interval of the eye pattern. The first direction is opposite from the second direction. The eye quality monitor is configured to form an eye quality output that relates to a quality of the eye pattern based on the first and second charges.
US09240847B2
A method is provided for suppressing interferences in a sampling process. The method includes the method step of sampling an analog useful signal at a sampling frequency f as well as determining whether an interference amplitude is present. In the presence of an interference amplitude, a stochastic shift of the chronologically equidistant sampling points in time, which are determined by the sampling frequency f, is carried out within a range [−Δt; +Δt] (21) around the equidistant sampling points in time, Δt being the maximum shift. Subsequently, a resampling of the analog useful signal is carried out. It is redetermined whether an interference amplitude is present. In the case of the continuous presence of an interference amplitude, a change in the absolute value of the maximum shift |Δt| is carried out and the process is restarted with the method step of stochastically shifting the sampling points in time.
US09240846B2
A method, system and device are provided for avoiding in-device coexistence interference between different radio technologies by allocating random access channel preambles to include one or more dedicated access preambles to be sued for sending IDC interference indication messages over a random access channel (RACH) to a radio access network. In response, the radio network provides control parameters and/or instructions for avoiding interference in a random access response message corresponding to the IDC interference indication message using one or more fields in the MAC subheader and payload fields of a designated IDC MAC PDU message.
US09240845B2
A system is provided for intercepting signals transmitted between a target served by a fiber optic network and a subscriber. A network is described having a phone switch at a central office configured to receive signals for transmission to and from a target, such as the target of a criminal investigation. A signal received at the central office is assigned to an analog circuit, and a monitoring device configured to intercept and monitor the signal is installed along the analog circuit at a location that allows the monitoring of communications without notifying the target that he is under surveillance. After the signal has been monitored, it is converted to a digital signal for transmission. A method is also provided for intercepting a signal transmitted between the target served by a fiber optic network and a subscriber, such that a monitoring device may be installed without alerting the target.
US09240841B2
The invention relates to a method and system for free-field optical transmission by means of laser signals, including setting a rate for encoding information that is useful for transmission on the basis of variations in a signal receiving characteristic belonging to a single communication session. The encoding rate is preferably dynamically adjusted during the communication session. An optimized compromise is thereby created between a useful rate that is high and a post-decoding bit error rate that is low. The method and the related system enable atmospheric conditions that can disrupt laser signal transmission to be taken into account in real time when said laser signals pass through part of the earth's atmosphere.
US09240839B2
An array of light emitters is arranged single-file along an emitting surface of a transmitting device and emits light in a z-direction normal to the emitting surface. The array of light emitters is aligned along a y-direction normal to the z-direction. A lens assembly is optically coupled to the array of light emitters. The lens assembly includes at least one cylindrical lens and at least one aspherical lens. The lens assembly emits the light in free-space along the z-direction and has a first focal length in the y-direction and a different, second focal length in an x-direction. An encoder is coupled to apply a data signal to the array of light emitters. The data signal causes the array of light emitters to illuminate in a pattern that switches at a rate corresponding to a rolling shutter of a receiving sensor array.
US09240838B2
An optical transmitter includes a signal generator configured to generate a drive signal from input data, an optical modulator configured to have a voltage-to-light-intensity characteristic in which intensity of output light changes in response to an applied voltage, and to generate a light signal that corresponds to the drive signal, a multiplier configured to multiply the drive signal and an electric signal that is obtained from the light signal; and a control section configured to control, based on output of the multiplier, a bias voltage for the optical modulator.
US09240835B2
A system, and related methods and devices, is disclosed for increasing an output power of a frequency band in a distributed antenna system that includes at least one RXU module that is operatively coupled to at least one RAU module. A first group of the plurality of channels within a first frequency band may be allocated to the RAU module, and a second group of the plurality of the channels within the first frequency band may be allocated to the RXU module. The at least one RAU module may be configured to receive RF signals from the first group of the plurality of channels being used in the first frequency band, and the at least one RXU module may be configured to receive RF signals from the second group of the plurality of channels being used in the first frequency band. In this manner, the amount of composite power per channel is increased.
US09240832B2
A method for detecting signals using an adaptive transducer arrangement, the arrangement including a transducer array having a plurality of transducers, a beamformer, and an energy detector, the method comprising: determining weights to be applied by the beamformer to signals emitted from each transducer in order to maximize a performance metric; applying the determined weights to the signals emitted from each transducer; measuring the energy received at the energy detector; comparing the measured energy with a predetermined value and based on said comparison determining whether or not one or more signals are present.
US09240816B2
A method and apparatus are provided to generate a preamble signal. A peak of each pulse of the preamble signal is synchronized with a sensitivity region of a super regenerative receiver (SRR). The method and apparatus are configured to transmit, to the SRR, a data packet comprising the preamble signal, wherein the data packet is a baseband signal corresponding to the preamble signal.
US09240813B2
Embodiments of a hybrid unit that supports a configurable number of radio units for a base station in a cellular communications network and embodiments of Distributed Digitally Convertible Radio Units (DDCRUs) for use with the hybrid unit are disclosed. In one embodiment, a hybrid unit for a base station in a cellular communications network is provided. The hybrid unit includes an analog hybrid matrix. The analog hybrid matrix includes a number of feeder ports operative to connect to at least one radio unit and up to a number of radio units that are external to and separate from the hybrid unit. In one preferred embodiment, the radio unit(s) is(are) DDCRU(s). The analog hybrid matrix also includes a number of antenna ports operative to connect to at least one and up to a corresponding number of antennas of the base station.
US09240810B2
A method for processing a chain reaction code includes first selecting a source symbol which is associated with an output symbol of degree two or higher (i.e., an output symbol which is itself associated with two or more input symbols), and subsequently deactivating the selected source symbol in an attempt to produce an output symbol of degree one. The inactivation process can be repeated either successively until an output symbol of degree one is identified, and/or whenever the decoding process is unable to locate an output symbol of degree one.
US09240802B2
Disclosed is an inverse quantization method that reverse-quantizes multiple quantized values as a set, obtaining a set of multiple inverse quantized values, said method being characterized in that the range of potential inverse quantized values for each quantized value is obtained using at least a signal other than that of the aforementioned quantized value, and in that the set of preliminary inverse quantized values for which the total variation norm is the minimum within the range of potential values for each inverse quantized value is obtained as the aforementioned set of reverse-quantized values.
US09240800B2
A system including an encoder, multiple sensing elements and control logic. The encoder has a pole pitch and is configured to rotate in a direction of rotation. The multiple sensing elements are situated along the direction of rotation and span at least half the length of the pole pitch. The control logic is configured to receive signals from the multiple sensing elements based on the encoder in a static position and obtain a switching point based on the signals.
US09240799B1
A device including a conductive layer configured to output a spin-current based on an analog input value, a plurality of magnetoresistive devices, and an encoder configured to output a digital value. Each of the magnetoresistive devices may be configured to receive a different reference voltage on a first side and the spin-current on a second side. The magnetization state of each of the magnetoresistive devices is set by respective reference voltages and the spin-current. The encoder may include a plurality of digital bits that is a digital representation of the analog input value based on the magnetization states of the magnetoresistive devices.
US09240793B2
A method for stabilizing the output frequency of an oscillator comprises providing a temperature model to capture the temperature characteristics of a second oscillator when measured by a first oscillator, measuring a value indicative of the frequency of the second oscillator by using the first oscillator, determine a temperature of the second oscillator based on the measured value indicative of the frequency of the second oscillator and the temperature model, determining a compensation amount for the frequency of the first oscillator from the determined temperature, and providing a compensated output frequency of the first oscillator as a stabilized output.
US09240785B2
At least one analog signal compatible complementary metal oxide semiconductor (CMOS) switch circuit is incorporated with digital logic circuits in an integrated circuit. The integrated circuit may further comprise a digital processor and memory, e.g., microcontroller, microprocessor, digital signal processor (DSP), programmable logic array (PLA), application specific integrated circuit (ASIC), etc., for controlling operation of the at least one analog signal compatible CMOS switch for switching analog signals, e.g., audio, video, serial communications, etc. The at least one analog signal compatible CMOS switch may have first and second states, e.g., single throw “on” or “off”, or double throw common to a or b, controlled by a single digital control signal of either a logic “0” or a logic “1”.
US09240774B2
A single ended to a differential signal converter. The single ended signal is passed through a high pass filter to block DC components. A positive and a negative version of the filtered signal are used collectively as the differential output of the converter. To allow accurate measurements on the input signal without waiting for the output of the high pass filter to settle, the differential outputs are offset by a dynamically generated signal representative of the midpoint of the filtered signal. That offset is generated by capturing a value representing the midpoint when a signal is first applied. This captured value is allowed to change with a time constant matching a time constant of the high pass filter. The converter may be used to connect a test instrument to a unit under test that generates test signals in a format that the test instrument is not specifically configured to measure.
US09240769B2
A piezoelectric thin film resonator includes a substrate, a lower electrode provided on the substrate, a piezoelectric film provided on the lower electrode, and an upper electrode provided on the piezoelectric film. At least a portion of the upper electrode and that of the lower electrode oppose each other through the piezoelectric film, and at least a portion of the periphery of the upper electrode is reversely tapered.
US09240762B2
The present document relates to amplifiers, notably multi-stage amplifiers, such as linear regulators or linear voltage regulators (e.g. low-dropout regulators) configured to provide a constant output voltage subject to load transients. An amplifier comprising an output stage for providing an output current at an output voltage, in dependence of an input voltage at a stage input node of the output stage, is described. The output stage comprises a first input transistor; wherein a gate of the first input transistor is coupled to the stage input node of the output stage. Furthermore, the output stage comprises a first diode transistor; wherein the first diode transistor is arranged in series with the input transistor. In addition, the output stage comprises a pass device configured to provide the output current at the output voltage; wherein the first diode transistor and the pass device form a current mirror.
US09240760B2
A power amplifier module includes a first amplification transistor that amplifies and outputs a radio frequency signal, a second amplification transistor that is connected in parallel to the first amplification transistor and that has a smaller size than the first amplification transistor, a bias circuit that supplies a bias voltage or a bias current to the first and second amplification transistors, a current detector circuit that detects a current flowing in the second amplification transistor, and a bias control circuit that controls the bias voltage or the bias current supplied from the bias circuit to the first and second amplification transistors depending on the detection result of the current detector circuit.
US09240757B2
A transmission apparatus comprises a signal generator that generates input signals of two or more bands of frequencies and outputs the generated input signals; a power amplifier that amplifies the input signals and outputs amplified signals; a branching filter that outputs branched signals for the respective frequencies from the amplified signals; a data transmitter that transmits data based on one of the branched signals of a first frequency; a power regenerator that converts one of the branched signals of a second frequency into regenerated power and output the regenerated power, and a power combiner that combines the regenerated power and power supply power output from a voltage source, as combined power and supplies the combined power to the power amplifier.
US09240756B1
A two-stage RF amplifier comprising first and second transistors arranged in cascode. The first transistor cooperatively connected to an input RF signal source through a parallel RC network. The gate of the second transistor terminated with a lossy connection.
US09240743B2
Provided is a power-generation control device capable of appropriately using a drive belt looped around a power generator and an internal-combustion engine mounted on a vehicle. The device monitors a difference between an actual generated current of a rotating electrical machine and an estimated generated current estimated from estimated power-generation torque for controlling power generation of the rotating electrical machine, which corresponds to a power-generation torque command, or the like. When a difference equal to or more than a predetermined value occurs between the actual and the estimated generated currents, the power-generation control device limits the estimated power-generation torque so as to be reduced, and further limits the estimated power-generation torque with use of learning limiting power-generation torque calculated based on the estimated power-generation torque at a time when the difference has occurred between the actual generated current and the estimated generated current.
US09240730B2
A power circuit of an AC power supply includes a power input unit connected to a AC/DC converter. The AC/DC converter is connected to a DC/DC circuit, and the DC/DC circuit is further connected to an adjustable DC voltage regulation circuit. The adjustable DC voltage regulation circuit is connected to an amplifier to amplify and convert the DC voltages into the AC voltages, thereby outputting different AC voltages and electric currents under the condition of not switching off the output when adjusting the voltage via cross position, so that a power level is switched promptly and a very low power distortion.
US09240724B2
A multiphase DC/DC power converter includes an input, an output, at least a first converter and a second converter coupled in parallel between the input and the output, an inductor coupled to the first and second converters, an output capacitor coupled between the first and second converters and the output, and a control circuit coupled to the first converter and the second converter. The first and second converters each include a power switch. The control circuit is configured to switch the power switches at a frequency with a phase shift therebetween, and to vary the frequency to regulate a voltage at the output. Additionally, the control circuit may be configured to switch power switches at a fixed frequency with substantially no phase shift therebetween during startup of a multiphase DC/DC power converter, and at a variable frequency with a defined phase shift therebetween after startup.
US09240720B2
DC to DC converters and pulse width modulation controllers are presented with compensation circuitry to mitigate discontinuous conduction mode (DCM) undershoot and continuous conduction mode offsets in inductor current emulation information by providing compensation signals proportional to the output voltage and the converter off time (Toff) when the low side converter switch is actuated.
US09240713B2
The invention provides a switching power supply device such that the occurrence of noise is reduced by jitter control of a switching frequency. The switching power supply device includes a switching power supply device main body wherein a predetermined output direct current voltage is obtained by switching an input alternating current voltage using a switching element, a switching control unit that controls the switching frequency in accordance with a feedback voltage that indicates the difference between an output set voltage and the output direct current voltage, a jitter control unit that applies jitter to the switching frequency, and a jitter amplitude control unit that changes jitter amplitude caused by the jitter control unit in accordance with the feedback voltage.
US09240711B2
A constant current control circuit with PFC function and its PFC circuit are provided. The PFC circuit comprises a valley-filled PFC circuit and a harmonic compensation circuit, whose output signal is supplied to the current control circuit. By adding the harmonic compensation circuit to the PFC circuit, the distortion of input current is decreased and the power factor is enhanced. Moreover, the whole circuit is simplified and its cost is reduced.
US09240706B2
Among other things, one or more techniques and/or systems are provided for synchronizing one or more direct current (DC) to alternating current (AC) power sources (e.g., a DC power source coupled to an inverter) for restoration of power to a load. That is, responsive to a grid fault of a grid used to supply power to a load over a common bus, the common bus is isolated from the grid and the load. One or more DC to AC power sources are synchronized through synchronization circuits (e.g., voltage, phase, and/or frequency synchronization) until a total power supply provided by respective synchronized DC to AC power sources is greater than or equal to a target power used to supply the load. Once the target power is achieved, a load circuit breaker is closed so that respective synchronized DC to AC power sources provide power to the load over the common bus.
US09240702B2
A modular pocket system includes a modularly mountable pocket modularly mountable to a tactical garment. An insert is mounted in the pocket to align and closely inductively couple a primary inductive coil and related primary drive circuits in the insert to a secondary inductive coil and related secondary charging circuits in a portable electronic device mountable into the insert for the inductively coupled transmission of power between the coils so to transmit power to the portable device, where the device has a rechargeable energy storage component electrically connected to the secondary inductive coil and secondary charging circuits.
US09240694B2
A method for charging a battery is used for charging a solid secondary battery including a positive electrode active material layer, a negative electrode active material layer and a solid electrolyte layer formed between the positive electrode active material layer and the negative electrode active material layer. Specifically, the method for charging a battery includes a process for obtaining or estimating temperature of the solid secondary battery; and an over-discharge process for lowering voltage of the solid secondary battery to or below a rated voltage by performing over-discharge and/or making an external short circuit with respect to the solid secondary battery prior to a process for charging the solid secondary battery, provided that the temperature is equal to or higher than a predetermined temperature.
US09240693B2
A battery discharge device according to an exemplary aspect of the present disclosure includes, among other things, a sensor configured to sense a parameter of a high voltage source, a controller in communication with the sensor and a discharge circuit that discharges energy stored on the high voltage source in response to a command signal from the controller. The discharge circuit includes a plurality of resistors connected in parallel to one another.
US09240688B2
Disclosed are ultrasonic wireless power transmitter and receiver apparatuses, and a method for wireless charging thereof. A method for wireless charging according to the present disclosure includes: transmitting, by an ultrasonic wireless power transmitter apparatus, an wakeup signal to an ultrasonic wireless power receiver apparatus; calculating, by the ultrasonic wireless power transmitter apparatus, a charging time according to a charging status information received from the ultrasonic wireless power receiver apparatus; generating, by the ultrasonic wireless power transmitter apparatus, an ultrasonic signal, amplifying the generated ultrasonic signal to predetermined voltage and thereafter; charging, by the ultrasonic wireless power transmitter apparatus, the ultrasonic wireless power receiver apparatus for the calculated time and thereafter; and determining, by the ultrasonic wireless power transmitter apparatus, whether secondary charging is to be performed according to a charged status information received from the ultrasonic wireless power receiver apparatus.
US09240685B2
A power management and distribution (PMAD) system includes a first power supply of a first type, a second power supply of a second type different from the first type and first and second loads. The PMAD system includes a matrix of solid state power controllers (SSPCs) connected between the first and second power supplies and the first and second loads. The matrix is configured to selectively supply each of the first and second loads with a plurality of different power levels based on on/off states of the SSPCs of the matrix.
US09240673B2
A wavelength tunable silicon-on-insulator (SOI) laser comprising: a laser cavity including: a semiconductor gain medium having a front end and a back end; and a phase-tunable waveguide platform coupled to the front end of the semiconductor gain medium; wherein the phase-tunable waveguide platform includes a first Distributed Bragg Reflector (DBR) and a second Distributed Bragg Reflector (DBR); at least one of the Distributed Bragg Reflectors having a comb reflectance spectrum; and wherein a mirror of the laser cavity is located at the back end of the semiconductor gain medium.
US09240672B1
A wavelength tunable laser includes a gain section, a grating section, and an isolation section. The gain section generates and modulates an optical signal. The grating section is positioned adjacent to the gain section, and the isolation section is disposed between the gain section and the grating section. The isolation section impedes conduction of an electrical current between the gain section and the grating section.
US09240654B2
A circuit-terminal connecting device comprising a first connector having a first housing attached to a first circuit board provided thereon with first circuit-terminals and a first metallic member, a second connector having a second housing attached to a second circuit board provided thereon with second circuit-terminals and a second metallic member and a manipulatable member mounted on the second housing, wherein an end portion of the manipulatable member is formed into a movable locking portion supported by the second metallic member, the first metallic member is provided thereon with a fixed locking portion, and the manipulatable member is resiliently deformed for causing the movable locking portion to engage with the fixed locking portion so that the second housing is put in mechanical lock to the first housing when the second housing is put in engagement with the first housing for connecting the second circuit-terminals with the first circuit-terminals.
US09240643B2
A device for contacting a circuit board having one or more contact elements, an intake into which at least one section of the circuit board can be inserted, an actuator for moving the circuit board relative to the contact elements until the contact elements are contacted, and at least one securing component for fixing the circuit board in the position in which the contact elements are contacted.
US09240640B2
A card edge connector includes a longitudinal housing with a pair of sidewalls and an inserting slot therebetween, a plurality of contacts and three metallic retainers, each of the retainers has a base portion retained in the insulative housing and a pair of board locks defining a central line L in a vertical direction perpendicular to the longitudinal direction. The retainer includes a first retaining portion and a second retaining portion disposed at both sides of the central lines L and different from each other.
US09240638B2
A connector is provided that includes a first housing that supports first terminal bricks. The first housing can mate with a second housing that supports second terminal bricks that are configured to make with the first terminal bricks. The first housing and first terminal bricks can be adjusted so that a variety of spacing requirements can be met by the combination of the first and second housings while allowing for reduced tooling investment.
US09240628B2
The present disclosure provides systems and methods associated with an antenna system comprising a tension member configured to be towed by an aerial platform and/or secured to an orbiting satellite. In some embodiments, a first end of the tension member may be secured to the aerial platform and the second end may extend unsecured from the aerial platform at a different elevation than the first end. A plurality of antenna assemblies, each comprising at least one antenna, may be secured to and spaced along the length of the tension member. Each of the plurality of antennas may be adapted for use with a particular frequency or frequency bandwidth. For example, each of the plurality of antennas may be adapted or tuned for one or more frequencies useful for synthetic aperture radar (SAR). In some embodiments, a receiving system, a communication link, and/or an antenna location system may be utilized.
US09240614B2
The present invention provides a nonaqueous electrolytic solution which can improve the electrochemical characteristics in a broad temperature range, an electrochemical element produced by using the same and a sulfonic ester compound having a branched structure which is used for the same.The present invention relates to a nonaqueous electrolytic solution prepared by dissolving an electrolyte salt in a nonaqueous solvent, which comprises a sulfonic ester compound represented by the following Formula (I) in an amount of 0.001 to 5% by mass of the nonaqueous electrolytic solution: (wherein R represents an alkyl group or an aryl group; A represents a >CH group or a >SiZ group (Z represents an alkyl group or an aryl group); X represents an alkyl group, a cycloalkyl group or an aryl group; Y represents a cycloalkyl group, a -L1CHRaOSO2Rb group or a —Si(Rc)(Rd)OSO2Rb group; W represents 1 or 2; Ra represents an alkyl group; Rb, Rc and Rd represent an alkyl group or an aryl group; L1 represents an alkylene group in which at least one hydrogen atom may be substituted with —OSO2Re (Re has the same meaning as that of R), a divalent linkage group containing at least one ether bond or a single bond).
US09240611B2
The present disclosure provides an embodiment of an integrated structure that includes a first electrode of a first conductive material embedded in a first semiconductor substrate; a second electrode of a second conductive material embedded in a second semiconductor substrate; and a electrolyte disposed between the first and second electrodes. The first and second semiconductor substrates are bonded together through bonding pads such that the first and second electrodes are enclosed between the first and second semiconductor substrates. The second conductive material is different from the first conductive material.
US09240609B2
A fuel cell is formed by stacking membrane electrode assemblies and metal separators. The metal separator is formed by adhering and joining together an anode separator and a cathode separator. In the metal separator, a step is provided on an outer circumferential end of the cathode separator, the step being spaced from an outer circumferential end of the anode separator. An adhesive layer is formed on the step between the outer circumferential end of the cathode separator and the outer circumferential end of the anode separator.
US09240607B2
Provided are a polymer electrolyte membrane used in fuel cells, and a method for producing the same, the method including a step of filling a crosslinkable ion conductor in the pores of a porous nanoweb support; and a step of crosslinking the ion conductor filled in the pores of the porous nanoweb support. The method for producing a polymer electrolyte membrane uses a relatively smaller amount of an organic solvent, can ameliorate defects of the support caused by solvent evaporation, and can enhance the impregnability of the ion conductor to the support and the convenience of the process.
US09240605B2
A reformer is disclosed in one embodiment of the invention as including a channel to convey a preheated plurality of reactants containing both a feedstock fuel and an oxidant. A plasma generator is provided to apply an electrical potential to the reactants sufficient to ionize one or more of the reactants. These ionized reactants are then conveyed to a reaction zone where they are chemically transformed into synthesis gas containing a mixture of hydrogen and carbon monoxide. A heat transfer mechanism is used to transfer heat from an external heat source to the reformer to provide the heat of reformation.
US09240603B2
In a case where gas supply controller of an FC system determines that the temperature of an FC is a predetermined temperature or less, the gas supply controller fixes the FC voltage to a voltage value within a voltage region where degradation is relatively small, the voltage value being below a voltage range where an oxidation-reduction proceeds. Further, the amount of a gas supplied to the FC is changed in accordance with electric power required by a load.
US09240602B2
Provided is a fuel cell system capable of supplying electric power to external loads without excess or deficiency even when switching occurs between operation states. A warm-up timing judgment part judges whether it is time to operate warm-up based on the temperature of a fuel cell stack. A target shift voltage determination part determines a target output voltage of the fuel cell stack used during a warm-up operation, and a voltage change speed determination part determines a voltage change speed based on electric power required from the fuel cell stack, the target output voltage of the fuel cell stack used during the warm-up operation which is output from the target shift voltage determination part and a current output voltage detected by a voltage sensor. A voltage decrease execution part operates voltage decrease processing according to the voltage change speed indicated by the voltage change speed determination part.
US09240598B2
In solid polymer fuel cells employing framed membrane electrode assemblies, a conventional anode compliant seal is employed in combination with a cathode non-compliant seal to provide for a thinner fuel cell design, particularly in the context of a fuel cell stack. This approach is particularly suitable for fuel cells operating at low pressure.
US09240596B2
The invention relates to a composite material comprising carbon fibers and complex oxide particles, wherein the carbon fibers and the complex oxide particles have a carbon coating on at least part of their surface, said carbon coating being a non powdery coating The material is prepared by a method comprising mixing a complex oxide or precursors thereof, an organic carbon precursor and carbon fibers, and subjecting the mixture to a heat treatment in an inert or reducing atmosphere for the decomposition of the precursors The material is useful as the cathode material in a battery.
US09240593B2
There is provided a method for producing an active material for a nonaqueous secondary battery, including firing an adherend in which a compound containing an element A (at least one element selected from among B, Al, Ga, In, Si, Ge, Sn, Mg and transition metal elements) is adhered to a particle surface of a material capable of being doped and dedoped with lithium ions, in a water-containing atmosphere so that weight increasing rate of the adherend is in a range of 0.1% by weight or more and 5.0% by weight or less, and firing the adherend.
US09240583B2
The present invention provides carboxymethylcellulose or a salt thereof that can prevent defects such as streaks and pinholes from occurring in the obtained electrode when it is used as a binder for an electrode of a nonaqueous electrolyte secondary battery. The present invention provides carboxymethylcellulose or a salt thereof of which ratio of a dry mass A to a dry mass B is less than 50 ppm when 2 liters of a 0.3 mass % aqueous solution of the dry mass B of the carboxymethylcellulose or a salt thereof is prepared, the entire amount of the aqueous solution is filtrated through a 250-mesh filter under a reduced pressure of −200 mmHg, and the dry mass A of a residue on the filter is measured after filtration. The applications of the carboxymethylcellulose or a salt thereof are also provided.
US09240580B2
A battery module including a plurality of battery cells; a housing fixing a position of the plurality of battery cells; and a barrier between adjacent ones of the plurality of battery cells, the barrier including a base facing a wide surface of the battery cells, and at least one flange on a periphery of the base, wherein the at least one flange includes at least one flange battery spacer on an inner side thereof and at least one housing spacer on an outer side thereof.
US09240569B2
A display includes: a light emitting layer; a reflective section reflecting light, that enters through the light emitting layer, to a display surface; an absorption-type polarizing plate provided on the display surface; a retardation film provided between the light emitting layer and the absorption-type polarizing plate; a reflection-type polarizing plate provided between the retardation film and the absorption-type polarizing plate, and reflecting, among light transmitted by the retardation film, light in a predetermined light-axis direction; and an outside-light reflection suppression layer provided between the light emitting layer and the reflection-type polarizing plate, and absorbing part of outside light.
US09240568B2
Opal glass compositions and devices incorporating opal glass compositions are described herein. The compositions solve problems associated with the use of opal glasses as light-scattering layers in electroluminescent devices, such as organic light-emitting diodes. In particular, embodiments solve the problem of high light absorption within the opal glass layer as well as the problem of an insufficiently high refractive index that results in poor light collection by the layer. Particular devices comprise light-emitting diodes incorporating light scattering layers formed of high-index opal glasses of high light scattering power that exhibit minimal light attenuation through light absorption within the matrix phases of the glasses.
US09240563B2
The invention describes a multi-device OLED (1) comprising a device layer stack (100) comprising a bottom electrode (11), a top electrode (14), at least one inter electrode (13) and plurality of active layers (120, 121), wherein the bottom electrode (11) is applied to a substrate (10), and each active layer (120, 121) is enclosed between two electrodes (11, 13, 14); a current distribution means (500) comprising a current distribution layer (51, 53, 54) for each electrode (11, 13, 14) of the device layer stack (100); a plurality of openings (110, 130) extending from the top electrode (14) into the device layer stack (100), wherein each opening (110, 130) exposes a contact region (111, 131) of an electrode (11, 13); and a plurality of electrical connectors (41, 42), wherein an electrical connector (41, 42) extends into an opening (110, 130) to electrically connect the electrode (11, 13) exposed by that opening (110, 130) to the current distribution layer (53, 54) for that electrode (11, 13). The invention also describes a method of manufacturing such a multi-device OLED. The invention further describes a method of driving such a multi-device OLED, which method comprises applying a voltage across at least one pair (51, 53, 53, 54) of current distribution layers (51, 53, 54) of the current distribution means (500) to stimulate the corresponding active layer (120, 121) of a device of the multi-device OLED (1).
US09240558B2
Provided is a novel compound which can be used for a transport layer or as a host material or a light-emitting material in a light-emitting element and with which a high-performance light-emitting element can be manufactured. A dibenzo[c,g]carbazole compound in which an aryl group having 14 to 30 carbon atoms and including at least anthracene is bonded to nitrogen of a dibenzo[c,g]carbazole derivative is synthesized. By use of the dibenzo[c,g]carbazole compound, a light-emitting element having very good characteristics can be obtained.
US09240553B2
The present invention provides an indeno[1,2-b]phenanthrene compound having suppressed hole transport ability. The indeno[1,2-b]phenanthrene compound represented by the general formula [1] described in claim 1 is provided. In the formula [1], R1 and R2 each represent a hydrogen atom or an alkyl group. X1 and X2 each represent a substituent selected from the group consisting of a hydrogen atom, an alkyl group, a methoxy group, and a cyano group. A1 represents a monovalent or a divalent aromatic hydrocarbon group. A2 represents a monovalent or a divalent aromatic hydrocarbon group or a monovalent or a divalent heteroaromatic group. n represents an integer of 0 to 4. When n is 2 or more, a plurality of A2 may be identical to or different from each other.
US09240546B2
A magnetoresistive device includes a substrate and an electrically insulating layer arranged over the substrate. The magnetoresistive device further includes a first free layer embedded in the electrically insulating layer and a second free layer embedded in the electrically insulating layer. The first free layer and the second free layer are separated by a portion of the electrically insulating layer.
US09240542B2
There is provided a piezoelectric ceramic having a high and stable piezoelectric constant and a high and stable mechanical quality factor in a wide operating temperature range, and a piezoelectric element according to the present invention includes a main component containing a perovskite type metal oxide having the following general formula (1) or (2); and Mn as a first auxiliary component, (Ba1-xCax)a(Ti1-y-zSnyZrz)O3 (1) (0.08≦x≦0.20, 0.01≦y≦0.04, 0
US09240541B2
There are provided a piezoelectric vibration module and a vibration generating apparatus including the same. The piezoelectric vibration module includes: a piezoelectric actuator including a piezoelectric element deformed in both a first direction and a second direction perpendicular to the first direction through the application of electrical power thereto; at least one first rod transferring deformation force of the piezoelectric actuator in the first direction; at least one second rod converting deformation force of the piezoelectric actuator in the second direction into deformation force in the first direction and transferring the converted deformation force; and a mass body connected to the first and second rods and disposed on the piezoelectric actuator so that displacement is generated in the first direction.
US09240532B2
A LED package structure includes a substrate unit, a light-emitting unit and a package unit. The substrate unit includes two lead frames, and light-emitting unit including a LED chip electrically connected between the two lead frames. The package unit includes a light-transmitting package body enclosing the light-emitting unit and one part of each lead frame and a lens body integrated with the light-transmitting package body, and another part of each lead frame is exposed from the light-transmitting package body. Therefore, light beams generated by the LED chip pass through the lens body to project a cross light pattern on a plane, the cross light pattern has a concentrated cross light shape and a scattered light shape surrounding the concentrated cross light shape, the luminous intensity of the concentrated cross light shape is substantially the same and larger than the luminous intensity of the scattered light shape.
US09240531B2
A semiconductor light-emitting device includes a semiconductor light-emitting layer, a pair of electrodes, a fluorescent material layer and a chromaticity adjusting layer. The semiconductor light-emitting layer emits first light. The pair of electrodes is connected to the semiconductor light-emitting layer. The fluorescent material layer covers at least a center portion of the semiconductor light-emitting layer, and contains a fluorescent material to absorb the first light and radiate second light. The chromaticity adjusting layer covers at least a peripheral portion of the semiconductor light-emitting layer, is exposed to outside, and contains a fluorescent material with a concentration lower than a concentration of the fluorescent material in the fluorescent material layer.
US09240529B2
This invention is related to LED Light Extraction for optoelectronic applications. More particularly the invention relates to (Al, Ga, In)N combined with optimized optics and phosphor layer for highly efficient (Al, Ga, In)N based light emitting diodes applications, and its fabrication method. A further extension is the general combination of a shaped high refractive index light extraction material combined with a shaped optical element.
US09240504B2
Provided is a solar cell with improved photoelectric conversion efficiency. The solar cell includes a photoelectric conversion body and first and second electrodes. The photoelectric conversion body includes a substrate made of semiconductor material. The first and second electrodes are disposed at intervals on one main surface of the photoelectric conversion body. Terraces each formed of a crystal plane are provided on a main surface of the substrate on the one main surface side of the photoelectric conversion body. At least one of the terraces exists between the first electrode and the second electrode.
US09240500B2
There is provided a novel material used for solar cells that can contribute to the improvement in maximum output of solar cells without using the conventional MPPT system. A film-forming material for forming a light-collecting film on a transparent electrode of a solar cell, including an aromatic group-containing organic polymer compound (A) and a cross-linker (B), wherein the film-forming material exhibits an index of refraction of 1.5 to 2.0 at a wavelength of 633 nm and a transmittance of 95% or more with respect to light having a wavelength of 400 nm, and a solar cell obtained by coating a cured film made from the film-forming material on a surface of a transparent electrode.
US09240498B2
Phosphate-based glass doped with copper ions having infrared blocking filter characteristics is formed into particles and is mixed with a transparent encapsulating resin to encapsulate a semiconductor element. The glass particles have a particle diameter four times or more as large as a wavelength of infrared radiation to be blocked. An optical semiconductor device can be obtained having a stable filter characteristics thereof even if an incident light angle changes and is resistant to moisture.
US09240497B2
A method of fabricating a semiconductor device that includes forming a replacement gate structure on a portion of a semiconductor substrate, wherein source regions and drain regions are formed in opposing sides of the replacement gate structure. A dielectric is formed on the semiconductor substrate having an upper surface that is coplanar with an upper surface of the replacement gate structure. The replacement gate structure is removed to provide an opening to an exposed portion of the semiconductor substrate. A functional gate conductor is epitaxially grown within the opening in direct contact with the exposed portion of the semiconductor substrate. The method is applicable to planar metal oxide semiconductor field effect transistors (MOSFETs) and fin field effect transistors (finFETs).
US09240496B2
Techniques for providing floating body memory devices are disclosed. In one particular exemplary embodiment, the techniques may be realized as a semiconductor device comprising a floating gate, a control gate disposed over the floating gate, a body region that is electrically floating, wherein the body region is configured so that material forming the body region is contained under at least one lateral boundary of the floating gate, and a source region and a drain region adjacent the body region.
US09240495B2
A memory cell is provided including a tunnel dielectric layer overlying a semiconductor substrate. The memory cell also includes a floating gate having a first portion overlying the tunnel dielectric layer and a second portion in the form of a nanorod extending from the first portion. In addition, a control gate layer is separated from the floating gate by an intergate dielectric layer.
US09240494B2
A semiconductor device including a first dielectric film, a floating gate portion, second and third dielectric films, a control gate portion, and a recess on the side face of the floating gate portion. The second dielectric film for element isolation is embedded between a height position of a lower portion of the side face of the floating gate portion and a height position inside the semiconductor substrate. The third dielectric film covers an upper surface and a side face portion of the floating gate portion up to a height position of an upper surface of the second dielectric film, and on the second dielectric film. A height position of an interface between the second and third dielectric films is between a height position of a center of the recess and a position in a predetermined range below the height position of the center of the recess.
US09240488B2
A transistor including an oxide semiconductor, which has good on-state characteristics, and a high-performance semiconductor device including a transistor capable of high-speed response and high-speed operation. In the transistor including an oxide semiconductor, oxygen-defect-inducing factors are introduced (added) into an oxide semiconductor layer, whereby the resistance of a source and drain regions are selectively reduced. Oxygen-defect-inducing factors are introduced into the oxide semiconductor layer, whereby oxygen defects serving as donors can be effectively formed in the oxide semiconductor layer. The introduced oxygen-defect-inducing factors are one or more selected from titanium, tungsten, and molybdenum, and are introduced by an ion implantation method.
US09240484B2
A gate stressor for a fin field effect transistor (FinFET) device is provided. The gate stressor includes a floor, a first stressor sidewall, and a second stressor sidewall. The floor is formed on a first portion of a gate layer. The gate layer is disposed above a shallow trench isolation (STI) region. The first stressor sidewall formed on a second portion of the gate layer. The second portion of the gate layer is disposed on sidewalls of a fin. The second stressor sidewall formed on the third portion of the gate layer. The third portion of the gate layer is disposed on sidewalls of a structure spaced apart from the fin. The first stressor side wall and the second stressor sidewall do not exceed a height of the fin.
US09240478B2
A semiconductor device and a method of manufacture are provided. A substrate has a dielectric layer formed thereon. A three-dimensional feature, such as a trench or a fin, is formed in the dielectric layer. A two-dimensional layer, such as a layer (or multilayer) of graphene, transition metal dichalcogenides (TMDs), or boron nitride (BN), is formed over sidewalls of the feature. The two-dimensional layer may also extend along horizontal surfaces, such as along a bottom of the trench or along horizontal surfaces of the dielectric layer extending away from the three-dimensional feature. A gate dielectric layer is formed over the two-dimensional layer and a gate electrode is formed over the gate dielectric layer. Source/drain contacts are electrically coupled to the two-dimensional layer on opposing sides of the gate electrode.
US09240476B2
A method of forming a transistor device includes providing a drift layer having a first conductivity type and an upper surface, forming first regions in the drift layer and adjacent the upper surface, the first regions having a second conductivity type that is opposite the first conductivity type and being spaced apart from one another, forming a body layer on the drift layer including the source regions, forming spaced apart source regions in the body layer above respective ones of the first regions, forming a vertical conduction region in the body layer between the source regions, the vertical conduction region having the first conductivity type and defining channel regions in the body layer between the vertical conduction region and respective ones of the source regions, forming a gate insulator on the body layer, and forming a gate contact on the gate insulator.
US09240474B2
An enhanced GaN transistor is provided. The structure comprises a substrate, a heterostructure, a p-element epitaxy growth layer, a drain ohmic contact and a source ohmic contact disposed on the heterostructure and on two sides of the p-element epitaxy growth layer, a gate structure disposed on the p-element epitaxy growth layer, and is separated from the drain ohmic contact and the source ohmic contact, a surface passivation layer covered the drain ohmic contact, source ohmic contact, and p-element epitaxy growth layer, and covered portion of the gate structure.
US09240473B2
A transistor device capable of high performance at high temperatures. The transistor comprises a gate having a contact layer that contacts the active region. The gate contact layer is made of a material that has a high Schottky barrier when used in conjunction with a particular semiconductor system (e.g., Group-III nitrides) and exhibits decreased degradation when operating at high temperatures. The device may also incorporate a field plate to further increase the operating lifetime of the device.
US09240471B2
An electrostatic discharge protection circuit is disclosed. A method of manufacturing a semiconductor structure includes forming a semiconductor controlled rectifier including a first plurality of fingers between an n-well body contact and an anode in an n-well, and a second plurality of fingers between a p-well body contact and a cathode in a p-well.
US09240467B2
A semiconductor device for high power application in which a novel semiconductor material having high mass productivity is provided. An oxide semiconductor film is formed, and then, first heat treatment is performed on the exposed oxide semiconductor film in order to reduce impurities such as moisture or hydrogen in the oxide semiconductor film. Next, in order to further reduce impurities such as moisture or hydrogen in the oxide semiconductor film, oxygen is added to the oxide semiconductor film by an ion implantation method, an ion doping method, or the like, and after that, second heat treatment is performed on the exposed oxide semiconductor film.
US09240465B2
A semiconductor device has a vertical drain extended MOS transistor with deep trench structures to define a vertical drift region and at least one vertical drain contact region, separated from the vertical drift region by at least one instance of the deep trench structures. Dopants are implanted into the vertical drain contact regions and the semiconductor device is annealed so that the implanted dopants diffuse proximate to a bottom of the deep trench structures. The vertical drain contact regions make electrical contact to the proximate vertical drift region at the bottom of the intervening deep trench structure. At least one gate, body region and source region are formed above the drift region at, or proximate to, a top surface of a substrate of the semiconductor device. The deep trench structures are spaced so as to form RESURF regions for the drift region.
US09240463B2
High-voltage LDMOS devices with voltage linearizing field plates and methods of manufacture are disclosed. The method includes forming an array of poly islands and a control gate structure by patterning a poly layer formed over a deep well region and a body of a substrate. The method further includes forming a metal shield in contact with the control gate structure and over the array of poly islands.
US09240462B2
A method for fabricating a field-effect transistor with local source/drain insulation. The method includes forming and patterning a gate stack with a gate layer and a gate dielectric on a semiconductor substrate; forming source and drain depressions at the gate stack in the semiconductor substrate; forming a depression insulation layer at least in a bottom region of the source and drain depressions; and filling the at least partially insulated source and drain depressions with a filling layer for realizing source and drain regions.
US09240461B2
A method for fabricating a semiconductor device comprises forming a dummy gate pattern and a spacer that is arranged on a sidewall of the dummy gate pattern on a substrate, forming an air gap on both sides of the dummy gate pattern by removing the spacer, exposing the substrate by removing the dummy gate pattern, and sequentially forming a gate insulating film including a high-k insulating film and a metal gate electrode on the exposed substrate.
US09240448B2
Device structures for a bipolar junction transistor. The device structure includes a collector region, an intrinsic base formed on the collector region, an emitter coupled with the intrinsic base and separated from the collector by the intrinsic base, and an isolation region extending through the intrinsic base to the collector region. The isolation region is formed with a first section having first sidewalls that extend through the intrinsic base and a second section with second sidewalls that extend into the collector region. The second sidewalls are inclined relative to the first sidewalls. The isolation region is positioned in a trench that is formed with first and second etching process in which the latter etches different crystallographic directions of a single-crystal semiconductor material at different etch rates.
US09240442B2
A method for fabricating a capacitor of a semiconductor device includes forming a mold layer over a substrate, forming a plurality of preliminary openings by selectively etching the mold layer, forming a plurality of openings where each opening is formed to have a given linewidth by forming a sacrificial layer on sidewalls of the preliminary openings, and forming a plurality of storage nodes in the plurality of openings.
US09240439B2
A semiconductor device includes a first etching stopper film and a second etching stopper film that are formed to be spaced apart from one another on a first inter-layer insulating film; a metal thin film resistor formed to extend over the first and second etching stopper films; a second inter-layer insulating film formed on the first inter-layer insulating film to cover the first and second etching stopper films and the metal thin film resistor; a first contact hole formed in the second inter-layer insulating film to extend from a surface of the second inter-layer insulating film onto the first etching stopper film by penetrating through the metal thin film resistor; and a second contact hole formed in the second inter-layer insulating film to extend from a surface of the second inter-layer insulating film onto the second etching stopper film by penetrating through the metal thin film resistor.
US09240435B2
Disclosed is a coated type organic EL display wherein the light extraction efficiencies of all organic light-emitting elements are improved even when the organic light-emitting elements have different organic light-emitting layers for respective emission colors. Specifically disclosed is an organic EL display which comprises a substrate, a red organic light-emitting element (R), a green organic light-emitting element (G), and a blue organic light-emitting element (B), said organic light-emitting elements being arranged on the substrate. Each of the organic light-emitting elements has a pixel electrode that is a reflective electrode, a functional layer that is formed on the pixel electrode by coating, an organic light-emitting layer that is arranged on the functional layer, a counter electrode that is a transparent electrode arranged on the organic light-emitting layer, and a tapered bank that defines the functional layer formed by coating. The amounts of the functional layers formed by coating are different among the element (R), the element (G) and the element (B), and the tapered angles of the banks defining the functional layers are different among the element (R), the element (G) and the element (B).
US09240434B2
In at least one embodiment, a light-emitting diode includes a carrier and an organic layer sequence with an active layer. A mirror layer and electrical contact regions are located on a connection side of the carrier. The contact regions are provided for electrically contacting the organic layer sequence. Electrical dummy regions are located on the connection side. The dummy regions are electrically insulated from the contact regions. The mirror layer is present in the dummy regions and in the contact regions. At least two of the dummy regions are arranged in such a way that base areas of these dummy regions cannot be congruently superimposed merely by arbitrary rotation of the carrier relative to a center axis of the carrier perpendicular to the connection side.
US09240430B2
According to one embodiment, a semiconductor image pickup device includes a pixel area and a non-pixel area. The device includes a first photoelectric conversion element formed in the pixel area, a first transistor formed in the pixel area and connected to the first photoelectric conversion element, a second photoelectric conversion element formed in the non-pixel area, a second transistor formed in the non-pixel area and connected to the second photoelectric conversion element, a metal wire formed at least in the non-pixel area, a first cap layer formed on the metal wire to prevent diffusion of metal contained in the metal wire, and a dummy via wire formed in the non-pixel area and penetrating the first cap layer.
US09240427B2
An electronic imager includes a pixel sensor array, a plurality elements of a color filter array containing pigments forming multiple color filter patterns on the pixel sensor array and a silylating agent formed between at least first and second elements of the multiple color filter patterns. A method for forming a color filter array on a pixel sensor array of an electronic imager includes forming a pixel sensor array on a substrate, forming a first color filter pattern on the pixel sensor array, depositing a silylating agent on the first color filter pattern, disposing elements of a second color filter pattern on the silylating agent between respective elements of the first color filter pattern and disposing elements of a third color filter pattern on the silylating agent between respective elements of the first color filter pattern.
US09240426B2
A photoelectric conversion device in which a parasitic capacitance between an optical signal common output line for commonly transmitting an optical signal and a control signal line and a parasitic capacitance between an initial voltage common output line for commonly transmitting an initial voltage and the control signal line in a plurality of photoelectric conversion units are substantially equal is provided. The control signal line is arranged so that the length of the wiring part of the control signal line in parallel with the optical signal common output line and the length of the wiring part of the control signal line in parallel with the initial voltage common output line are substantially equal and the distance between the control signal line and the optical signal common output line and the distance between the control signal line and the initial voltage common output line are substantially equal.
US09240425B2
It is an object of one embodiment of the present invention to manufacture a light-emitting display device by simplifying a manufacturing process of a transistor, without an increase in the number of steps as well as the number of photomasks as compared to those in the conventional case. A step for processing a semiconductor layer into an island shape is omitted by using a high-resistance oxide semiconductor which is intrinsic or substantially intrinsic for the semiconductor layer, used to form transistors. Formation of an opening in the semiconductor layer or an insulating layer formed over the semiconductor layer and etching of an unnecessary portion of the semiconductor layer are performed at the same time; thus, the number of photolithography steps is reduced.
US09240422B2
A TFT array substrate, a fabrication method thereof and a display device. The TFT array substrate, comprising: gate lines (19), data lines (20) and a plurality of pixel units, each pixel unit comprises: a common electrode line (11), a gate insulating layer (16), a passivation layer (17) and a pixel electrode (12) in this order, wherein a backup common electrode line (41) is disposed at a position between the gate insulating layer (16) and the passivation layer (17) and opposite to the common electrode line (11), the backup common electrode line (41) is electrically insulated from the data line (20). The TFT array substrate with this structure can avoid the short circuit between the pixel electrode (12) and the common electrode line (11).
US09240419B2
Three-dimensional semiconductor devices are provided. The three-dimensional semiconductor device includes a substrate, a buffer layer on the substrate. The buffer layer includes a material having an etching selectivity relative to that of the substrate. A multi-layer stack including alternating insulation patterns and conductive patterns is provided on the buffer layer opposite the substrate. One or more active patterns respectively extend through the alternating insulation patterns and conductive patterns of the multi-layer stack and into the buffer layer. Related fabrication methods are also discussed.
US09240417B1
According to an embodiment, a nonvolatile semiconductor memory device comprises a memory area, a capacitor area, and a transistor area, on a semiconductor substrate. The nonvolatile semiconductor memory device comprises a memory cell and a select gate transistor, in the memory area. The nonvolatile semiconductor memory device includes a capacitor comprising a first electrode layer and a second electrode layer stacked on the first electrode layer via an insulating layer. An upper surface of the capacitor is covered by a first insulating layer, and the insulating layer has an upper level portion and a lower level portion. A part of an outline of the upper level portion is along a part of an outline of the second electrode layer.
US09240416B2
A semiconductor memory device according to an embodiment includes a stacked body with electrode films and inter-electrode insulating films alternately stacked therein, a semiconductor member, a charge accumulation film, an insulating member and a floating electrode member. The semiconductor member is provided in the stacked body. The insulating member is provided at a position opposed to the inter-electrode insulating film on a side surface of the charge accumulation film. The insulating member is divided for each of the inter-electrode insulating films. The floating electrode member is provided on a region of the side surface of the charge accumulation film not covered with the insulating member. The floating electrode member is in contact with the charge accumulation film. The floating electrode member is divided for each of the electrode films. The floating electrode member has higher conductivity than the charge accumulation film.
US09240408B2
Integrated circuit device with transistors having different threshold voltages and methods of forming the device are provided. The device may include the first, second and third transistors having threshold voltages different from each other. The first transistor may be free of a stacking fault and the second transistor may include a stacking fault. The concentration of the channel implant region of the third transistor may be different from the concentration of the channel implant region of the first transistor.
US09240401B2
Semiconductor devices and methods of manufacture thereof are disclosed. In some embodiments, a semiconductor device includes: a substrate; a first region over the substrate; a second region laterally adjacent to the first region; a third region disposed laterally adjacent to the second region on a side of the second region opposite the first region; a fourth region disposed within a portion of the first region proximate the second region; a fifth region disposed within a portion of the second region proximate the first region, wherein the fourth region and the fifth region are separated by a first isolation area; a sixth region disposed within a portion of the third region proximate the second region; and a seventh region disposed within the second region and below the fifth region.
US09240400B2
An input/output (IO) circuit is provided that reduces stress on a driver without using an additional reference voltage. The IO circuit receives an overshoot voltage and an undershoot voltage in a receive mode. The IO circuit includes a driver circuit. The driver circuit includes an NMOS transistor coupled to a PMOS transistor. A pad is coupled to the driver circuit. A PMOS protect circuit is coupled to the driver circuit and the pad. An NMOS protect circuit is coupled to the driver circuit and the pad. The NMOS protect circuit is configured to be activated only for a duration of the overshoot voltage received at the pad during the receive mode and the PMOS protect circuit is configured to be activated only for a duration of the undershoot voltage received at the pad during the receive mode.
US09240397B2
Light emitting devices and methods of integrating micro LED devices into light emitting device are described. In an embodiment a light emitting device includes a reflective bank structure within a bank layer, and a conductive line atop the bank layer and elevated above the reflective bank structure. A micro LED device is within the reflective bank structure and a passivation layer is over the bank layer and laterally around the micro LED device within the reflective bank structure. A portion of the micro LED device and a conductive line atop the bank layer protrude above a top surface of the passivation layer.
US09240392B2
A method of fabricating embedded die packages including the following steps: obtaining a honeycomb array of chip sockets such that each chip socket is surrounded by a framework having a polymer matrix of a first polymer and at least one via post through the framework around each socket; placing the honeycomb array on a transparent tape so that an underside of the honey comb array contacts the transparent tape; positioning a chip terminal the down (flip chip) in each chip socket so that undersides of the dies contact the transparent tape; using optical imaging through the tape to align the chips with the via posts; applying a packing material over and around the chips in the honeycomb array, and curing the filler to embed the chips on five sides; thinning and planarizing the packing material to expose upper ends of the vias on upper side of the array; removing the transparent tape; applying a feature layer of conductors on the underside of the honeycomb array and the undersides of the chips, to couple at least one terminal of each die to at least one through via; applying a feature layer of conductors on over side of the honeycomb array such that at least one conductor extends from a through via at least partway over each chip; dicing the array to create separate dies comprising at least one embedded chip having a contract pad coupled to a through via adjacent the chip.
US09240383B2
A high frequency switch module includes a multilayer substrate and a switch IC. The switch IC is mounted on a top plane of the multilayer substrate. A drive power signal input port and control signal input ports are connected to direct current external input ports through direct current voltage conductors, respectively. In-layer conductors of the direct current voltage conductors are arranged so that the in-layer conductors overlap each other at least partially in a state in which the multilayer substrate is viewed along a stacking direction.
US09240381B2
A semiconductor device includes a plurality of conductors for connecting another semiconductor device. Each conductor connects to a chip select pad within the semiconductor device through an upper vertical connection formed through an insulation layer formed on a substrate or connected to a straight vertical connection formed through the substrate and the insulation layer. The semiconductor device further includes a plurality of lower vertical connections formed through the substrate and correspondingly connecting to the chip select pads and a chip select terminal. The chip select terminal electrically connects to the die circuit of the semiconductor device while the chip select pads are electrically isolated from the die circuit. The lower vertical connections and the straight vertical connection can be arranged in two dimensions.
US09240380B2
A semiconductor device has a first semiconductor die mounted over a carrier. An interposer frame has an opening in the interposer frame and a plurality of conductive pillars formed over the interposer frame. The interposer is mounted over the carrier and first die with the conductive pillars disposed around the die. A cavity can be formed in the interposer frame to contain a portion of the first die. An encapsulant is deposited through the opening in the interposer frame over the carrier and first die. Alternatively, the encapsulant is deposited over the carrier and first die and the interposer frame is pressed against the encapsulant. Excess encapsulant exits through the opening in the interposer frame. The carrier is removed. An interconnect structure is formed over the encapsulant and first die. A second semiconductor die can be mounted over the first die or over the interposer frame.
US09240374B2
Semiconductor device and method for forming a semiconductor device are presented. The method includes providing a substrate prepared with intermediate dielectric layer having interconnect levels. The interconnect levels include M1 to MX metal levels, where 1 is the lowest level and X corresponds to a number of metal level. The metal level MX includes a metal pad having an oxidized portion. An upper level having an upper dielectric layer is formed over the dielectric layer having MX. The upper dielectric layer includes a plurality of via contacts over the metal pad and a metal line over the via contacts. The oxidized portion remains within the metal pad and prevents punch through between MX and its adjacent underlying metal level MX-1.
US09240372B1
A semiconductor die including first, second, and third bond pads. The first and second bond pads are arranged in an outer periphery of the semiconductor die. The first bond pad receives a reference voltage potential through a first lead wire. A first via arranged in a substrate of the semiconductor die is connected between the first bond pad and an interconnecting layer. A second via arranged in the substrate is connected between the interconnecting layer and the second bond pad to provide the reference voltage potential to the second bond pad. The third bond pad is arranged in an interior portion of the semiconductor die and is connected to the second bond pad using a second lead wire to receive the reference voltage potential. A circuit is arranged in the interior portion between the second bond pad and the third bond pad below the second lead wire.
US09240371B2
A semiconductor module is configured such that heat radiation substrates are connected to lead frames and semiconductor chips are directly connected to the lead frames, so that the semiconductor chips are not connected to the lead frames through conductive portions of the heat radiation substrates. Therefore, the conductive portion can have a solid shape without being divided. As such, an occurrence of curving of the heat radiation substrates is suppressed when a temperature is reduced from a high temperature to a room temperature after resin-sealing at the high temperature or the like. Therefore, connection between the semiconductor chip and the lead frames and connection between the lead frames and the heat radiation substrates enhance.
US09240369B2
An encapsulated semiconductor device includes: a first conduction path formative plate; a second conduction path formative plate joined to the first conduction path formative plate; a power element bonded to the first conduction path formative plate; a heatsink held by the first conduction path formative plate with an insulation sheet interposed between the heatsink and the first conduction path formative plate; and an encapsulation resin configured to encapsulate the first and second conduction path formative plates. A through hole or a lead gap is formed in a region of the first conduction path formative plate in contact with the insulation sheet. The insulation sheet is press-fitted into the through hole or the lead gap.
US09240368B2
A semiconductor device includes a die pad having an upper surface and a lower surface opposite to the upper surface, a semiconductor chip having a main surface and a back surface opposite to the main surface so that a plurality of electrode pads are formed on the main surface and being mounted on the die pad so that the back surface is opposite to the upper surface of the die pad, a plurality of leads arranged to be aligned on a side of the die pad, a first wire electrically connecting between a first electrode pad among the plurality of electrode pads of the semiconductor chip and a first lead among the plurality of leads, and a second wire having a diameter thicker than a diameter of the first wire and electrically connecting between a second electrode pad among the plurality of electrode pads of the semiconductor chip.
US09240365B2
A cooling device is disclosed. The cooling device includes a thermal diffusing unit operable to radiate heat taken from a heating element, and a heat transporting part, laminated in a thickness direction of the heat diffusing unit and diffused thereby. The thermal diffusing unit has an upper plate, a lower plate opposite thereto, a vapor diffusion path to diffuse an evaporated refrigerant, and a capillary channel to circulate a condensed refrigerant. The heat transporting part has an upper plate, a lower plate opposite thereto, a vapor diffusion path to diffuse an evaporated refrigerant, and a capillary channel to circulate a condensed refrigerant. Either the upper plate or the lower plate is formed with the same member of the lower plate or the upper plate of the heat transporting part.
US09240362B2
The invention relates to a layer arrangement and a wafer level package comprising the layer arrangement, and in particular, the layer arrangement comprises a getter layer and further comprises a sacrificial layer. The wafer level package may be used in microelectromechanical systems (MEMS) packaging at a vacuum level of about 10 mTorr or less such as close to 1 mTorr (i.e. MEMS vacuum packaging).
US09240358B2
A semiconductor device includes: a semiconductor substrate; a first insulating film on a surface of the semiconductor substrate; a temperature sensing diode on the first insulating film; a trench extending inward from the surface of the semiconductor substrate; and a trench electrode embedded in the trench via a second insulating film and connected to the temperature sensing diode.
US09240356B2
A surface inspection apparatus includes: an irradiation unit; a detection unit configured to detect a first detection signal according to a first light beam and a second detection signal according to a second light beam; a providing unit which is configured to provide a first reference data and a second reference data; and a determination unit which is configured to determine a processing condition of the pattern in the substrate as an inspection object substrate, based on consistency between the first detection signal and the first reference data, and consistency between the second detection signal and the second reference data.
US09240350B2
A technique for forming 3D structures is disclosed. In one particular exemplary embodiment, the technique may be realized as a method for forming 3D structures. The method may comprise providing a substrate comprising at least two vertically extending fins that are spaced apart from one another to define a trench; depositing a dielectric material in the trench between the at least two vertically extending fins; providing an etch stop layer within the dielectric material, the etch stop layer having a first side and a second opposite side; removing the dielectric material near the first side of the etch stop layer.
US09240349B2
A device for use with integrated circuits is provided. The device includes a substrate having a through-substrate via formed therethrough. Dielectric layers are formed over at least one side of the substrate and metallization layers are formed within the dielectric layers. A first metallization layer closest to the through-substrate via is larger than one or more overlying metallization layers. In an embodiment, a top metallization layer is larger than one or more underlying metallization layers. Integrated circuit dies may be attached to the substrate on either or both sides of the substrate, and either side of the substrate may be attached to another substrate, such as a printed circuit board, a high-density interconnect, a packaging substrate, an organic substrate, a laminate substrate, or the like.
US09240346B2
Self-aligned double patterning methods that can be used in back-end-of-line (BEOL) processing and other stages of integrate circuit device manufacturing. In these methods, line termini are masked prior to self-aligned double patterning. The self-aligned double patterning involves forming a mandrel, the shape of which is determined by a lithographic mask. That same lithographic mask is used prior to self-aligned double patterning to trim the mask that determines the locations of line termini. The methods provide precise positioning of the line termini mask relative to the line locations determined by self-aligned double patterning. The methods forms consistent end-of-line shapes and allow line termini to be placed more closely together than would otherwise be feasible.
US09240337B2
A substrate transporting method includes: after a holding unit of a substrate holding apparatus receives a substrate from one placement location for a substrate and holds it, detecting a first positional deviation of the substrate from a reference position of the substrate on the holding unit; transporting the substrate held by the holding unit to a position facing another placement location; detecting a second positional deviation of the substrate from the reference position of the substrate on the holding unit, when the substrate is located at the position facing the another placement location; calculating, based on the first and second positional deviations, a positional displacement of the substrate relative to the holding unit that occurred during the transporting of the substrate to the position facing the another placement location; and determining whether or not the positional displacement thus calculated falls within a predetermined range.
US09240335B2
The object of the present invention is to provide a wafer cleaning apparatus that reduces the amount of dissolved oxygen, without using hydrogen peroxide, to be able to reduce the deformation, etc. of a wafer and to reduce silicon consumption and a wafer cleaning method using the same.The present invention provides a wafer cleaning apparatus comprising: a first thin film contactor that receives drug solution for removing an oxide film or ultra pure water to separate and discharge gas dissolved in the drug solution for removing the oxide film or the ultra pure water; a second thin film contactor that receives the drug solution for removing the oxide film or the ultra pure water discharged from the first thin film contactor; a vacuum pump that discharges gas separated in the first and second thin film contactors to the outside; and a process vessel that stores the drug solution for removing the oxide film or the ultra pure water discharged from the second thin film contactor, and a wafer cleaning method using the same.
US09240329B2
Techniques disclosed herein include increasing pattern density for creating high-resolution contact openings, slots, trenches, and other features. A first line-generation sequence creates a first layer of parallel lines of alternating and differing material by using double-stacked mandrels, sidewall image transfer, and novel planarization schemes. This line-generation sequence is repeated on top of the first layer of parallel lines, but with the second layer of parallel lines of alternating and differing material being oriented to elevationally cross lines of the first layer. Etching selective to one of the materials within the double stack of parallel lines results in defining a pattern of openings, slots, etc., which can be transferred into underlying layers. Such patterning techniques herein can quadruple a density of features in a given pattern, which can be described as created a pitch quad.
US09240325B2
A method includes making a gate stack on the surface of an active zone, including depositing a first dielectric layer; depositing a gate conductive layer; depositing a first metal layer; depositing a second metal layer; depositing a second dielectric layer; partially etching the gate stack for the formation of a gate zone on the active zone; making insulating spacers on either side of the gate zone on the active zone; making source and drain electrodes zones; making silicidation zones on the surface of the source and drain zones; etching, in the gate zone on the active zone, the second dielectric layer and the second metal layer with stopping on the first metal layer, so as to form a cavity between the insulating spacers; making a protective plug at the surface of the first metal layer of the gate zone on the active zone, where the protective plug fills the cavity.
US09240315B1
A method and apparatus for conditioning an oxide surface during a semiconductor device formation process is provided herein. One or more plasma processing operations are performed on a substrate having a fin structure and shallow trench isolation structure (STI) formed thereon. An oxygen containing plasma process may modify surfaces of the STI structure in preparation for an argon containing plasma process. The argon containing plasma process may form a first layer on the fin structure and STI structure and an ammonia fluoride containing plasma process may form a second layer on the first layer. The first and second layers may be removed from the substrate during a subsequent heating process to provide a cleaned fin structure suitable for subsequent processing operations.
US09240311B2
A Direct Sample Analysis (DSA) ion source system operating at essentially atmospheric pressure is configured to facilitate the ionization, or desorption and ionization, of sample species from a wide variety of gaseous, liquid, and/or solid samples, for chemical analysis by mass spectrometry or other gas phase ion detectors. The DSA system includes one or more means of ionizing samples and includes a sealed enclosure which provides protection from high voltages and hazardous vapors, and in which the local background gas environment may be monitored and well-controlled. The DSA system is configured to accommodate single or multiple samples at any one time, and provide external control of individual sample positioning, sample conditioning, sample heating, positional sensing, and temperature measurement.
US09240309B2
Systems and methods are provided for maximizing the data acquired from a sample in a mass spectrometry imaging experiment. An ion source device is instructed to produce and transmit to a tandem mass spectrometer a plurality of ions for each location of two or more locations of a sample. A mass range is divided into two or more mass window widths. For each location of the two or more locations, the tandem mass spectrometer is instructed to fragment the plurality of ions received for each location using each mass window width of the two or more mass window widths and to analyze resulting product ions. A product ion spectrum is produced for each mass window width, and a plurality of product ion spectra are produced for each location of the two or more locations.
US09240308B2
Embodiments disclosed herein include an abatement system for abating compounds produced in semiconductor processes. The abatement system includes a plasma source that has a first plate and a second plate parallel to the first plate. An electrode is disposed between the first and second plates and an outer wall is disposed between the first and second plates surrounding the electrode. The plasma source has a first plurality of magnets disposed on the first plate and a second plurality of magnets disposed on the second plate. The magnetic field created by the first and second plurality of magnets is substantially perpendicular to the electric field created between the electrode and the outer wall. In this configuration, a dense plasma is created.
US09240306B2
The invention relates to a device for spot size measurement at wafer level in a multi charged particle beam lithography system. The device comprises a knife edge structure on top of a scintillating material, such a YAG material. The knife edge structure is arranged in a Si wafer which has a top plane at a sharp angle to a (1 1 0) plane of the Si. In an embodiment the angle is in the range from 2 to 4 degrees, preferably in the range from 2.9-3.1 degrees. The invention relates in addition to a method for manufacturing a device for spot size measurement at wafer level in a multi charged particle beam lithography system.
US09240292B1
The disclosure relates to a button assembly for a device, such as an electronic device. The button assembly may include a button and a seal. The button may fit within a space defined by the seal. A portion of each of three sealing surfaces may each seal and press against respective surfaces of the button.
US09240291B2
A tamper-resistant or tamper-evident keypad device for use in secure transactions. The keypad comprises multiple security mechanisms to prevent tampering to the device, and thus access to users' private information. The keypad is made of resilient materials and contains a tamper-resistant collar for housing the keypad's connector interface. The keypad comprises a multi-layered printed circuit board with at least two internal security-shield layers comprising switch trace protection, as well as additional security layers for tamper protection. The keypad comprises a silicon-rubber keypad actuator that engages tamper switches on the flexible security circuit. The keypad comprises an optional dome layer.
US09240289B2
An object of the present invention is to provide a contact switching device in which a short circuit contingent to flow-out of scattered objects caused by arc is eliminated, so that life durability is increased. For this, there is provided a contact switching device in which a movable iron core provided at one end portion of a movable shaft is attracted to a fixed iron core, based on excitation and degauss of an electromagnet portion, by which the movable shaft reciprocates in a shaft center direction, and movable contacts of a movable contact piece arranged at another end portion of the movable shaft contact and depart from fixed contacts. Particularly, contact surfaces between the fixed contacts and the movable contacts are arranged inside a box-shaped insulating member, and an opening portion of the insulating member is closed by a lid body having at least one extending portion in a direction of an arc generated between the fixed contacts and the movable contacts.
US09240286B2
The present invention has an object to provide a photoelectric conversion device which can be manufactured through a simple manufacturing process, achieve photoelectric conversion over a wide range of wavelength regions, and attain high photoelectric conversion efficiency even in the infrared wavelength region, a photodetection device, and a photodetection method. This photoelectric conversion device 1 includes a substrate 2 containing single crystalline titanium dioxide, adhesion layers 2c formed on a surface 2a of the substrate 2, metal microstructure bodies 3, each of which has a volume of 1,000 nm3 or more and 3,000,000 nm3 or less, arranged at predetermined intervals in a predetermined direction on surfaces of the adhesion layers 2c, a container 4 for containing an electrolyte solution L in an arrangement region of the metal microstructure bodies 3 on the surface 2a of the substrate 2, a conductive layer 7 formed on a rear surface 2b of the substrate 2, and a counter electrode 5 in contact with the electrolyte solution L in the container 4; and the metal microstructure bodies 3 adhere onto the substrate 2 through the adhesion layers 2c, a Schottky barrier is formed at an interface of the substrate 2 with the metal microstructure bodies 3, and photoelectric conversion is carried out for light in an infrared region by utilizing a plasmon resonance phenomenon.
US09240284B2
The capacitor includes at least: a capacitor body; two lead wires provided on one end surface; a projecting portion provided at a substantially central portion of another end surface; and at least two relief valves provided on the another end surface. On the another end surface, the at least two relief valves are arranged in substantially rotational symmetry with respect to the projecting portion. Further, an axial center line of the projecting portion and an axial center line of the capacitor substantially correspond to each other. Also provided are a capacitor case to be used the capacitor and a substrate provided with a circuit using the capacitor.
US09240279B2
A metallized film capacitor includes first and second metal electrodes, a dielectric film disposed between the first and second metal electrodes, and first and second external electrodes which are connected to the first and second metal electrodes, respectively. At least one of the first metal electrode and the second metal electrode comprises magnesium. The magnesium is distributed unevenly in the at least one of the first metal electrode and the second metal electrode.
US09240263B2
A cable includes a flexible jacket extending along a length and first and second lateral axes perpendicular to the length. The jacket also defines flat major surfaces that are parallel to each other and spaced apart on opposite sides of the first lateral axis. First and second inner wire assemblies extend within the jacket. The jacket maintains the first and second inner wire assembles in predetermined positions along the first lateral axis within 0.05 mm of each other and disposed on opposing sides of the second lateral axis. First and second outer wire assemblies also extend within the jacket. The outer wire assemblies include a wire of conductive filaments and an insulating layer of an enamel material surrounding the wire. The jacket maintains the first and second outer wire assemblies in positions along the first lateral axis and spaced apart from the first and second inner wire assemblies.
US09240261B2
Multi-conductor cables for telecommunication systems include a plurality of fiber-optic conductors and/or power conductors extending within an outer jacket in a main body portion of the cable, and extending outside of the outer jacket in a break-out portion of the cable. A break-out boot may be attached to the outer jacket and may surround the conductors in a break-out portion of the cable. Potting material may be provided in the break-out boot within spaces between adjacent conductors to provide innovative sealing of the break-out portion.
US09240240B2
Methods and apparatus utilizing indications of memory cell density facilitate management of memory density of a memory device. By permitting each of a plurality of portions of a memory array of the memory device to be assigned a corresponding memory cell density determined through an evaluation of those portions of the memory array, better performing portions of the memory array may not be hindered by lesser performing portions of the memory array.
US09240238B2
In a three dimensional NAND memory, increased threshold voltages in back gate transistors may cause program failures, particularly along word lines near back gates. When back gate transistor threshold voltages cannot be returned to a desired threshold voltage range then modified program conditions, including increased back gate voltage, may be used to allow programming.
US09240230B2
A system for using selectable-delay bipolar logic circuitry within the address decoder of a MOS-based memory includes a MOS-based memory, which includes an array of a plurality of memory cells configured to store data; an address decoder including bipolar logic circuitry, where the address decoder is configured to accept a word including a plurality of bits and access the array of memory cells using the word; where the bipolar logic circuitry includes a plurality of bipolar transistor devices, where at least one bipolar transistor device has an adjustable gate bias and is configured to accept an input, wherein the gate bias is adjusted based on the input, where the gate bias determines a selectable gate delay.
US09240226B2
A memory includes a first and second cell storing first data and second or reference-data. A first and second bit-lines connected to the first and second cells respectively correspond to a first and second sense-nodes. A first transfer-gate is inserted/connected between the first bit-line and the first sense-node. A second transfer-gate is inserted/connected between the second bit-line and the second sense-node. A sense-amplifier is inserted or connected between the first and second sense-nodes. A preamplifier includes a first and second common-transistors. The first common-transistor applies a first power-supply voltage to either the first or the second sense-node according to the first and second data or according to the first and reference-data during a data-read-operation. The second common-transistor applies a second power-supply voltage to the other sense-node out of the first and second sense-nodes according to the first and second data or according to the first and reference data.
US09240224B2
A method of soft programming a non-volatile memory (NVM) array includes determining a first number based on a temperature of the NVM array and applying the first number of soft program pulses to a section of the NVM array. A first soft program verify of the section of the NVM array is then performed for a first time after completing the applying the first number of soft program pulses.
US09240223B2
A semiconductor device includes a virtual power supplier, a driving signal generator and a load driver. The virtual power supplier boosts a driving voltage to generate a virtual voltage. The driving signal generator generates a driving signal based on the virtual voltage, such that the driving signal has a voltage level that is reinforced as compared with a voltage level of the driving voltage. The load driver drives a load based on the driving voltage and the driving signal.
US09240218B2
The present invention relates to a mobile terminal displaying an image and a control method of the same. A mobile terminal according to an aspect of the invention may include: a display unit displaying an image; and a controller receiving data according to a user's selection, storing the data to be associated with the image, and displaying an icon on the display unit to indicate that the data is stored.
US09240215B2
Some embodiments provide a media editing application that uses metadata or metadata tags associated with media content to facilitate editing operations. In some embodiments, the editing operations are performed on the media content at various different stages of the editing process in order to create a composite presentation. In creating the composite presentation, one or more effects are associated with a metadata tag. Once the effects are associated, the media editing application applies the effects to different pieces of media content tagged with the metadata tag in order to create the composite presentation.
US09240195B2
The present invention discloses a speech enhancing method, a speech enhancing device and a denoising communication headphone. In the solutions of the present invention, a first sound signal that comprises a user's speech signal transmitted through coupling vibration and an ambient noise signal transmitted through the air and a second sound signal that is mainly an ambient noise signal transmitted through the air are picked up by a primary vibration microphone and a secondary vibration microphone, respectively, that have a specific relative positional relationship therebetween, and the ambient noise signals picked up by the two vibration microphones are correlated with each other; a control parameter used to control an updating speed of an adaptive filter is determined according to the first sound signal and the second sound signal; the first sound signal is denoised and filtered according to the second sound signal and the control parameter; and the denoised and filtered speech signal is further denoised and speech high-frequency enhancement is performed thereon. The technical solutions of the present invention can effectively improve the signal to noise ratio (SNR) and the quality of speech in an environment of highly intense noises.