US11724370B2

A lockable adapter is configured to couple a drive socket to a tool. The lockable adapter includes a body defining a longitudinal axis. The body is configured to couple the lockable adapter to the tool. The lockable adapter includes a sleeve moveably coupled relative to the body along the longitudinal axis of the body between a first position and a second position. The sleeve is configured to interface with the drive socket to support the drive socket on the sleeve. The lockable adapter includes a collar moveable relative to the sleeve. The sleeve moves into the second position configured to lock the drive socket to the sleeve in response to inserting the drive socket onto the sleeve. The sleeve moves into the first position configured to allow removal of the drive socket from the sleeve in response to moving the collar relative to the sleeve.
US11724369B2

A tool adapter includes a body, which is elongated along a first axis. The body includes at least a first side surface that is opposite to the second side surface, as well as a first end surface that is opposite to the second end surface. The body includes a first input drive connector, which is located at a middle section of the body and which is accessible from the first side surface. The first input drive connector is structured to mate with a first drive part of a torque wrench such that a longitudinal axis of the torque wrench is parallel to the first axis when the torque wrench is connected to the adapter. The body includes a first output drive connector that is located at a middle region of the first end surface. The first output drive connector is structured to mate with a first connector part of a tool head such that a longitudinal axis of the tool head is parallel to the first axis when the tool head is connected to the adapter. The first input drive connector is defined to be a first size. The first output drive connector is defined to be a second size, which is different from the second size.
US11724364B2

An abrasive article includes a backing, abrasive particles secured to the backing, and a size coat provided over the abrasive particles, the size coat comprises a binder resin, at least one filler material and at least one lubricant material having a melting temperature of at least about 200 degrees F. A method of grinding aluminum using such an abrasive article is also described.
US11724361B2

Systems and methods for providing real-time modification of cutting process programs using feedback from one or more sensors which measure one or more operational parameters of a cutting process and/or cutting apparatus. The sensor readings may be used to provide real-time modification of a motion program after such motion program has been provided to a motion controller. Examples of such operational parameters may include waterjet pump supply pressure, the abrasive mass flow rate, the force of the waterjet on the target piece, etc. The systems and methods discussed herein also utilize a cutting algorithm or program to calculate actual cut quality based on one or more sensor inputs, and to generate warnings or system shut-downs accordingly. The systems and methods discussed herein also utilize inspection devices to inspect coupons or first articles, and use the inspection data to autonomously modify motion programs and/or cutting process models without user intervention.
US11724357B2

A carrier head includes a base assembly, a substrate mounting surface connected to the base assembly, a plurality of segments disposed circumferentially around the substrate mounting surface to provide a collet retaining ring to surround a substrate mounted on the substrate mounting surface, and an outer ring that is vertically movable relative to the plurality of segments. An inner surface of the collet retaining ring is configured to engage a substrate, and the collect retaining ring and outer ring are configured such that vertical motion of the outer ring controls motion of the collet retaining ring between a clamping and unclamping position.
US11724356B2

Embodiments relate to a porous polyurethane polishing pad for use in a chemical mechanical planarization (CMP) process of semiconductors and a process for producing the same. In the porous polyurethane polishing pad, it is possible to control the size and distribution of pores, whereby the polishing performance (i.e., polishing rate) of the polishing pad can be adjusted, by way of employing thermally expanded microcapsules as a solid phase foaming agent and an inert gas as a gas phase foaming agent.
US11724353B2

Disclosed herein is a plasma-resistant chamber component and a method for manufacturing the same. A plasma-resistant chamber component of a semiconductor processing chamber that generates a plasma environment includes a ceramic article having multiple polished apertures. A roughness of the multiple polished apertures is less than 32 μin.
US11724343B2

A method for repairing an at least externally coated hollow component. The direct mechanical machining of a coated component after use removes the need for a coating-removal and selective hollowing step and a selective repair of cracks, since a design adaptation leads to a component being engineered or used such that it can be used again as a result of external dimensional stipulations.
US11724337B2

A hybrid welding device capable of reducing an influence of by-products such as spatters, plasma, plumes, and fume, and reducing contamination of a laser optical system and welding defects is provided. A laser head includes a laser nozzle that forms an optical path of a laser beam, a first rectifying plate that is arranged on a tip side of the laser nozzle so as not to interfere with the laser beam, a first air knife that injects compressed air along the first rectifying plate, a second rectifying plate that is arranged between the first rectifying plate and the welded portion so as not to interfere with the laser beam, and a second air knife that injects compressed air along the second rectifying plate. The first rectifying plate and the second rectifying plate have a shape elongated in a direction perpendicular to an optical axis of the laser beam and a welding direction. The second rectifying plate has a torch opening through which a tip of a welding torch can be inserted.
US11724327B2

Disclosed is a handle clamp for an exothermic mold. The clamp includes a pair of legs, each having a plurality of rods that are shaped to fit into engagement holes on sections of the mold. The rods of each leg engage with one section of the mold. Engagement brackets are rotatably disposed on one or more or the rods. The brackets each have a thumb bolt that can be extended toward a mold section connected with the clamp. When engaged with the mold section, the thumb bolt stabilizes the mold section on the handle. A detent mechanism is provided between the bracket and the leg of the handle. The detent mechanism releasably holds the bracket in one of a selected plurality of rotational positions with respect to the rod. By selecting different rotational positions for the brackets, the handle can be configured to engage with different configurations of mold. The thumb bolts that are biased toward the mold section by a spring. The bolts include a key that can be aligned or misaligned with a key slot on the bracket. By aligning the key with the key with the key slot, the bolt can be moved toward or away from the mold section under the biasing force of the spring. By misaligning the key and key slot, the bolt can be locked into engagement with the mold section or else held in a disengaged position.
US11724323B2

A reamer incudes a core and a plurality of outer-circumference cutting edges provided on an outer circumference of the core and made of a hard tool material. The core extends from a front end to a rear end. The core is provided with a plurality of flutes from the front end to the rear end. A center-of-gravity adjustment portion, which adjusts a distance from a center of rotation to a center of gravity, is provided at least partially from terminal ends of the plurality of flutes on a rear end side to the rear end of the core. The center-of-gravity adjustment portion causes the deviation of the center of gravity from the center of rotation to be smaller than when no center-of-gravity adjustment portion is provided.
US11724321B2

Provided is a hole drilling machine and the method for drilling an oval hole and an inner-diameter-changing hole by means of the hole drilling machine, the machine and the method being configured so that the oval hole can be shaped with high accuracy and drilling of a complicated hole such as the inner-diameter-changing hole can be performed with high accuracy. A hole drilling machine 100 includes a spindle 101 and an auxiliary spindle 120 holding both end portions of a processing tool 102 having a cutting blade 103. The spindle 101 includes a spindle drive motor 106 configured to rotatably displace the processing tool 102 on a circular path, and a tool turnable-drive motor 105 configured to spin the processing tool 102. The auxiliary spindle 120 includes an auxiliary spindle drive motor 120b. In the auxiliary spindle drive motor 120b, a tool fitting portion 120a in which a tip end portion of the processing tool 102 is slidably fitted is synchronously rotatably driven on the same circular path as that for the spindle 101. A table reciprocatably-displacing mechanism 111 is provided between the spindle 101 and the auxiliary spindle 120. The table reciprocatably-displacing mechanism 111 reciprocatably displaces a work piece WK in an X-axis direction perpendicular to an axial direction of the spindle 101.
US11724317B1

In one aspect, refractory coatings are described herein having multiple cubic phases. In some embodiments, a coating comprises a refractory layer of TiAlN deposited by PVD adhered to the substrate, the refractory layer comprising a cubic TiAlN phase and a cubic A1N phase, wherein a ratio of intensity in the X-ray diffractogram (XRD) of a (200) reflection of the cubic AlN phase to intensity of a (200) reflection of the cubic TiAlN phase, I(200)/I(200), is at least 0.5.
US11724313B2

A scandium-containing aluminium powder alloy, wires and materials including said alloy, and a method for producing the scandium-containing aluminium powder alloy, the wires and materials, the proportion of scandium in the scandium-containing aluminium powder alloy being elevated, are disclosed. At least one element is selected from the group consisting of the lanthanum group except for Ce, Y, Ga, Nb, Ta, W, V, Ni, Co, Mo, Li, Th, Ag.
US11724303B2

A method for producing a heat exchanger having tubes that are each received at a longitudinal end side in an associated header, the tubes and the headers are formed out of aluminium. The method may include soldering the tubes and the headers to one another to form a coolant-conducting channel structure, and cold-forming the heat exchanger following the soldering of the tubes to the headers such that strength is thereby increased.
US11724301B1

An expander of a tubular assembly having a tubular covering element inserted into a tubular element includes a tip for pushing a first internal wall of the tubular covering element towards a second internal wall of the tubular element so as to enable the adhesion of a first external wall of the tubular covering element to the second internal wall. The expander includes a rotary joint sliding along a first longitudinal axis, to which the tip is coupled so as to arrange the tip radially and enable it to rotate around the first axis. The expander further includes a sensor operatively connected to the tip to detect a radial displacement of the tip owing to a current thrust exerted by the tip, and a logic control unit operatively connected to the sensor and the tip to adjust a future thrust as a function of the radial displacement.
US11724298B1

A forming method of a nickel aluminum (NiAl) alloy tubular part with micro flow channels including preparing a laminated tube blank. A step of fixing aluminum wires to an outer surface of the laminated tube blank to prepare a middle tube blank. A step of winding a nickel (Ni) flexible substrate and an Al flexible substrate on an outer surface of the middle tube blank to prepare a composite tube blank. A step of carrying out hot gas forming on the composite tube blank to prepare a composite tubular part. A step of carrying out in-mold first-stage reaction synthesis to make the Ni flexible substrate chemically react with the aluminum (Al) flexible substrate. A step of carrying out in-mold second-stage reaction synthesis to melt all the aluminum wires. A step of carrying out hot isostatic pressing treatment to prepare the NiAl alloy tubular part with the micro flow channels.
US11724293B2

The present invention relates to compositions and methods for the remediation of contaminated solids and liquids. In particular, embodiments of the present invention relate to the bioremediation of solids and liquids by a composition comprising a biocatalyst or mixture of biocatalysts. The present invention also relates to methods for producing the bioremediation compositions and methods for applying the bioremediation compositions to contaminated sites, including treatment, storage, and disposal facilities, as well as various contaminated water sources, such as aquifers and reservoirs.
US11724289B2

In some examples, a processing machine has at least one cleaning device for cleaning a substrate. The at least one cleaning device and the at least one substrate are able to be arranged in a first and a second cleaning state, and the substrate is arranged at a distance from the at least one cleaning device in the first cleaning state. The substrate is arranged in contact with the at least one cleaning device in the second cleaning state, and the at least one cleaning device and the substrate are arranged so as to be transferable at least from the first cleaning state into the second cleaning state. The at least one cleaning device is arranged to be adjusted from a first cleaning position in the first cleaning state into a second cleaning position in the second cleaning state.
US11724278B2

An outpouring assembly, comprising an outpouring plate, wherein the outpouring plate is provided with a liquid outlet through hole, a paste discharge pipe is disposed in the liquid outlet through hole, the paste discharge pipe moves up and down in the liquid outlet through hole, and when a lower end of the paste discharge pipe extends out of the liquid outlet through hole, the paste discharge pipe is in a liquid outpouring state. A beneficial effect of the present invention is as follows: Because a liquid such as the color paste or water has surface tension, the color paste adheres to a surface of an outlet, outpouring precision of the outpouring assembly is affected. A paste discharge pipe is disposed in the liquid outlet through hole, so that a quantity of color pastes adhered to a paste discharge outlet of the paste discharge pipe can be effectively reduced.
US11724277B2

A paint mist removing apparatus includes: a duct through which air containing paint mist passes; an element fit part provided at the duct, the element fit part being fitted with a filter element including a filter part configured to remove the paint mist and a filter case housing the filter part, the filter case having a case exit from which all air taken in from a case entrance of the filter case is caused to exit through the filter part; an frame-like projection projecting from an inner surface of the duct and abutting on an entire circumference of an opening edge of the case exit of the filter case; and a duct side-surface opening being open at a side surface of the duct and normally closed by a door member, the duct side-surface opening being open when the filter element is set in and out from the element fit part.
US11724274B2

The present invention refers to a working assembly for a painting system, containing a mobile platform and a crank and slider-type oscillating mechanism, which reproduces movements transmitted to a shaft and that guides a paint gun, mimicking the process performed by painters. Thus, the mobile platform and the oscillating mechanism were designed to move unidirectionally over the surface, being able to move in two orthogonal directions and also to rotate in order to keep the platform level.
US11724269B2

A smoke generator for anti-burglar purposes comprising canister holding means for holding a canister for chemicals to be used to generate smoke wherein the smoke generator further comprises a smoke deflector arranged below the position of the canister for even distribution of generated smoke, and wherein the smoke deflector have a smoke deflector cavity of sector shape. The smoke generator is provided with a cartridge for the canister to ease replacement of used or expired canister. The smoke deflector is provided with a residual collector to prevent residuals and debris from littering the room where the smoke generator is used.
US11724266B2

An applicator system for applying a material to a substrate is disclosed, the applicator system having a nozzle assembly (28) that includes a nozzle having a nozzle head (108). The nozzle assembly (28) also includes a baffle plate (101) including a cutout (144) that extends through the baffle plate (101), where the baffle plate (101) is received by the nozzle head (108) such that the nozzle head (108) and the baffle plate (101) define a cavity. The nozzle assembly (28) further includes a cover plate (102) attached to the nozzle head (108) such that the cover plate (102) secures the baffle plate (101) within the nozzle head (128), where an outlet passage is defined between the baffle plate (101) and the cover plate (102), the outlet passage being fluidly connected to the cavity through the cutout (144) of the baffle plate (101).
US11724264B2

The invention relates to a system for the gravimetric sorting of a mixture of substances during the processing and/or the recycling of residual building materials and/or demolition materials, comprising a fractioning unit (2) adapted to divide the mixture of substances into at least m fractions (A, B, C); at least n·m gravimetric densimetric tables (A.1, A.2.2, A.3.2), arranged in m cascades each with at least n densimetric tables distributed to n stages, wherein the fractioning unit is coupled to them densimetric tables (A.1) of the first stage such that a different one of the at least m fractions can be supplied to each of the densimetric tables of the first stage; wherein, within each cascade, each densimetric table of a considered stage (A.2.2, A.3.2) is coupled to a densimetric table (A.1, A.2.2) of the preceding stage such that either the first partial fraction or the second partial fraction (12, 22) of the densimetric table (A.1, A.2.2) of the preceding stage can be supplied to the densimetric table (A.2.2, A.3.2) of the considered stage. An appropriate method is also part of the invention.
US11724254B2

Aspects of the invention relate to liquid transfer systems including a pipette tip having a body defining an inner volume and having first and second ends, the first end arranged to transfer a volume of liquid into and out of the pipette tip and the second end arranged for attachment to a pipette, and a bladder sealingly attached to the body. In some embodiments, the bladder is disposable in the inner volume. The bladder may be defined by a membranous sac and/or a planar membrane. The bladder may be moveable in response to an applied pressure to transfer liquid. The bladder also may be stretchable to accommodate a volume of fluid. In some embodiments, the pipette tip is used in a cell culture incubator, with a manipulator including a pipette that is in fluid communication with the pipette tip.
US11724249B2

Provided are a high-performance Cu—P co-supported zeolite and the like having excellent thermal endurance and catalyst performance. A Cu—P co-supported zeolite comprising at least a small pore size zeolite, and an extra-backbone copper atom and an extra-backbone phosphorus atom supported on the small pore size zeolite, wherein a silica-alumina ratio (SiO2/Al2O3) is 7 or more and 20 or less, a ratio of the copper atom to a T atom (Cu/T) is 0.005 or more and 0.060 or less, a ratio of the phosphorus atom to the T atom (P/T) is 0.005 or more and 0.060 or less, and a ratio of the phosphorus atom to the copper atom (P/Cu) is 0.1 or more and 3 or less.
US11724247B2

Bifunctional catalyst compositions, methods, and systems are provided for the use of CO2 as a soft oxidizing agent to effectively convert low-value small alkanes to high-value small olefins. The bifunctional catalyst comprises a metal oxide catalyst and a redox-active ceramic support.
US11724234B2

This invention relates thin film nanocomposites (TFNCs) and methods of preparing the same by molecular layer-by-layer assembly. The TFNCs comprise a porous nanofibrous support first layer coated with a mid-layer having an outer separating layer, wherein the out separating layer has one or more bilayers or trilayers. The TFNCs can be particularly suitable for use as filtration membranes for the separation of dissolved components from fluids such as ultrafiltration, nanofiltration, and reverse osmosis. Thus, embodiments of the invention also include filtration systems and methods of filtering.
US11724233B2

A first wafer has a first stop layer deposited on a substrate, the substrate used to form a base support structure. A second wafer has a second stop layer deposited on a sacrificial substrate, and a filter layer deposited on the second stop layer. A rib layer is deposited on one of: the first stop layer of the first layer; or a third stop layer that is deposited over the filter layer. A rib pattern is formed in the rib layer. The first and second wafers are flip bonded such that the rib pattern is joined between the filter layer and the first stop layer. Elongated voids are formed within the filter layer. The base support structure is formed within the substrate of the first wafer such that there is a fluid flow path between the base support structure, the rib layer, and the elongated voids of the filter layer.
US11724232B2

A method providing direct access to porous three-dimensionally (3D) continuous polymer network structures and shapes by combining BCP-resol co-assembly with CO2 laser-induced transient heating. The CO2 laser source transiently heats the BCP-directed resol hybrid films to high temperatures at the beam position, inducing locally controlled resol thermopolymerization and BCP decomposition in ambient conditions. This enables shaping of BCP-directed porous resin structures with tunable 3D interconnected pores in a single process. Pore size can be varied from 10 nm to about 600 nm.
US11724227B2

A system and method of operating an air cleaner assembly including a selective scavenging apparatus that may be configured to actuate in response to a pulse cleaning operation. The air cleaner assembly may include an air cleaner housing, filter media positioned within an interior space of the air cleaner housing, a pulse cleaning apparatus extending into the interior space, and the selective scavenging apparatus in fluid communication with an egress aperture of the air cleaner housing. The selective scavenging apparatus may be configured to move fluid and sediment out of the air cleaner housing during a scavenging time period and the pulse cleaning apparatus may be configured to direct a pulse of gas into the clean air space during a cleaning operation. The scavenging time period may start based on the beginning of the cleaning operation and may end based on the completion of the cleaning operation.
US11724226B2

An apparatus and methods are provided for an air filter precleaner for an open air filter box. The air filter precleaner includes a filter medium between a base and a grating that are fastened over an opening into an interior of the air filter box. The filter medium comprises a sheet of filter material having a shape and a size suitable for being supported between the base and the grating. The base is a rigid member that supports the filter medium in a sheet configuration, such that the airstream passes through the filter medium before entering the air filter box. The grating is a rigid member comprising a screen portion surrounded by a frame that is configured to be fastened onto the air filter box. The screen portion comprises a shaped lattice that allows the airstream to pass through the filter medium before entering the air filter box.
US11724225B2

A filter housing includes a first end, an opposite second end and a peripheral side wall, all defining, in a combination with each other, a hollow interior of the housing. An air inlet is provided adjacent the first end and an air outlet is provided in the second end. The air inlet and air outlet are in open communication with the hollow interior. One or more openings are provided through the second end, being disposed between the air outlet and the peripheral side wall. A filter cleaning apparatus includes the filter housing, a hollow filter within the hollow interior and a nozzle within the hollow filter. The nozzle is designed to purge contaminates from the filter with pressurized fluid supply. The contaminates can be removed through one or more openings. The apparatus can be used as an air intake pre-cleaner or as a main air filter for internal combustion engine.
US11724214B2

A system for removing particulate matter from a multiphase stream comprising gas, liquid and the particulate matter. The system comprises a first vessel for receiving the multiphase stream and separating a majority of gas from the multiphase stream and collecting a slurry of liquid and particulate matter; a second vessel for receiving the slurry and causing separation of the particulate matter from the liquid and for generating a pressure head of liquid against the particulate matter; a third vessel for receiving the particulate matter from the second vessel and collecting the particulate matter until a pre-determined mass or volume of particulate matter is collected; and an outlet in the third vessel for conveying the particulate matter out of the third vessel.
US11724208B2

A ball is provided forming an inside structure of the snow person, the ball having an inner and outer surface. The ball is a unitary work piece that is free and unconnected to other work pieces. An adhesion surface is disposed on the outer surface of the ball, the adhesion surface provided with nodules that extend away from the surface of the ball to adhere snow while the ball is rolled. Light units are integrated into the surface of the ball and having light emitting portions that extend away from the surface of the ball. A light output of the light units is selected to transmit light through a layer of snow. Connections between the light units situated within the ball connect the light units together.
US11724206B2

An inflatable water slide having an air bubble blowing function, comprising a slide starting platform air sac body (11), a slope climbing air sac body (12), and a slide air sac body (13). Any or all of the slide start air sac body (11), the slope climbing air sac body (12), and the slide air sac body (13) are provided thereon with a bubble blowing apparatus (2). The bubble blowing apparatus (2) comprises an airduct cavity (21), a liquid storage compartment (22) used for storing a bubbling liquid, and a bubble discharging plate (23) provided with a bubble discharging opening. The bubble discharging plate (23) is provided at an outlet of the airduct cavity (21). The liquid storage compartment (22) is provided above the bubble discharging plate (23) and is provided with a liquid outlet connected to the bubble discharging plate (23). The airduct cavity (21) is in communication with cavities of the slide starting platform air sac body (11), the slope climbing air sac body (12), and the slide air sac body (13) provided corresponding to the bubble blowing apparatus (2).
US11724203B2

Provided is a social game capable of, when a new group is created, allowing such a group to progress a game smoothly. A server device that provides a game, in which a plurality of players can participate, is connected to terminal devices operated by the players via a communication line, and comprises: an information storage unit; and a control unit. The information storage unit stores information on a first group, in which the players participate, and information on a second group, in which the players are supposed to participate; the control unit receives notification on acceptance of participation in the second group from the terminal devices, and when it is determined that the number of players in the second group reaches a certain number, stores the second group as a new first group at the information storage unit.
US11724199B2

Systems and methods for monitoring gameplay for stopping points and applying a setting preference at a next predicted timing point. The monitored gameplay may be based on object data received from an object server. The supervising control server may predict one or more starting and/or stopping timing points in stopping periods within a gameplay session. The predicting of the one or more starting and/or stopping timing points may be based on a comparison of the gameplay data to historical gameplay data. Then, a setting preference set by a supervisory account may be applied to a next predicted timing point.
US11724190B2

Systems and methods for modifying game assets based on tradeable items that are associated with user accounts of users of the online gaming platform are disclosed. Exemplary implementations may: store, in electronic storage, item information associated with the tradeable items; obtain a first item identifier of a first tradeable item; obtain first user information of a first user account; link the first tradeable item with the first user account such that a first item-account connection is established; store the first item-account connection; obtain, based on the first item identifier, the first modification information; receive, from the first user, an indication of a selection of a first game asset to be modified based on the first modification information such that a first asset-item connection is established; and modify, based on the first modification information, the first attribute information in accordance with the first tradeable item.
US11724186B2

This document relates to techniques for addressing disruptions that prevent applications from receiving user input, prevent users from providing input to an application, and/or prevents or impacts users from receiving application output. One example method involves detecting a disruption to an interactive application during interaction by a user with the interactive application, generating automated user inputs, and providing the automated user inputs to the interactive application during the disruption to the interactive application.
US11724183B2

A system and method are described for managing the state of an online video game. A method includes initiating a new online video game in response to user input from a client device, the online video game being in a first state on a first server when initiated; executing the online video game on the server, thereby causing the online video game to enter a second state; pausing or terminating the online video game; determining differences between the first state and the second state and generating difference data containing the differences; transmitting the difference data over a network to a second server; and recreating the second state from the difference data and the first state in response to user input indicating that the user wishes to resume the online video game and in response to the second server being selected as the server on which to execute the video game.
US11724181B2

A non-transitory computer readable medium including program instructions, a method of controlling a game, and an information processing device make a game more amusing. When executed, the program instructions cause the information processing device to store information related to objects and information related to game contents in a storage, associate positioning information in a virtual space with each object, associate positioning information with the game contents, cause the objects and the game contents to be displayed at the position indicated by the positioning information associated with each of the objects and the game contents, change the positioning information associated with an object and the positioning information associated with each game content associated with the object, determine whether a predetermined condition is satisfied, and finalize the positioning information associated with the objects and the positioning information associated with the game contents when the predetermined condition is determined to be satisfied.
US11724177B2

A controller for use in interfacing with a virtual reality system is provided. The controller having a body with a proximate end and a distal end, and the distal end is opposite the proximate end. A handgrip portion of the body is disposed at the proximate end of the body. An extension portion of the body is coupled at the distal end of the body. The extension portion has a loop shape. A plurality of lights is disposed on a surface of the extension portion, such that lights illuminate at least part of the loop shape.
US11724169B2

An exercise assembly has a target. A plurality of compression blades is coupled to the target. A mounting plate is coupled to the plurality of compression blades. A mounting chassis is coupled to the mounting plate securing the exercise assembly to a building structure, wherein the mounting chassis moves in a forward and rearward direction relative to the building structure. A plurality of fasteners cis coupled to the mounting chassis securing the exercise assembly to the building structure.
US11724164B2

A golf clubhead that is designed with a unique inner and outer structure, using geometry and technology to provide super symmetry, harmony and balance at motion and at rest of golf swings. The triangular form clubhead does not require compensation during the swing thus allowing for greater repetition and simplicity of movement in turn producing performance benefits via consistency. The geometric triangular shape of the clubhead provides an instantly recognizable assistance in proper alignment at the rest position. The body of the clubhead may be hollow and feature inner symmetrical structures to complement the form of the body and to enhance and provide superior weight distribution and balance.
US11724162B2

Embodiments of golf club face plates with internal cell lattices are presented herein. Other examples and related methods are also disclosed herein.
US11724148B2

Connecting straps, for use for example in sports activities, include (a) a sleeve of webbing having a first end and a second end and having a loop at each end, each loop having a base and a free end, (b) disposed within the sleeve of webbing, a band of elastic material extending in a continuous loop, and (c) an attachment strap, adjacent each loop, configured to secure a portion of the band to the webbing at the base of each loop. In some cases, the band has a solid, polygonal cross-sectional shape.
US11724142B2

A method of proportioning a finished foam at or near a hazard comprising proportioning and delivering a first finished foam to the hazard, determining if the first finished foam extinguishes or suppresses the hazard, if not, selecting an amount of a fluorinated additive, and proportioning a foam solution including the selected amount of the fluorinated additive to form a fluorinated finished foam. A foam injection system is also disclosed.
US11724141B2

A sprinkler assembly includes a pipe, a sprinkler, and an adapter. The adapter includes an end wall that contacts the pipe, a sprinkler interface extending from the end wall that receives the sprinkler and fluidly couples the sprinkler with the pipe, and a gasket positioned in the sprinkler interface between the sprinkler and the pipe.
US11724139B2

System and method relates to a firewater monitor brake system, comprising a vertical locking disc collar adapted to be affixed externally or internally to a horizontal swivel of a firewater monitor system; a horizontal locking disc collar adapted to be affixed externally or internally to a vertical swivel of the firewater monitor system; a vertical brake mount adapted to be affixed to a horizontal swivel mounting pad of the firewater monitor system; a horizontal brake mount adapted to be affixed to a vertical swivel mounting pad of the firewater monitor system; a vertical brake system; wherein the vertical brake system is affixed to the vertical brake mount such that a portion of the vertical brake system is disposed around a portion of the vertical locking disc collar; a horizontal brake system, wherein the horizontal brake system is affixed to the horizontal brake mount such that a portion of the horizontal brake system is disposed around a portion of the horizontal locking disc collar; and a master cylinder adapted to be affixed to a tiller bar of the firewater monitor system, wherein the master cylinder is connected to and/or coupled to a lever system and wherein the master cylinder is connected to and or coupled to the vertical brake system and/or the horizontal brake system via an actuation system. Methods for making and using the system are also disclosed.
US11724134B2

A sunscreen composition comprised of one or more sunscreen active agents encapsulated in a cellulose derived capsule wherein the composition can contain one or more additional agents. A sunscreen composition can be mixed with a body wash, an after shower body lotion, a shampoo, a conditioner, a soap, a gel, a hand sanitizer, a cream, a spray, a mouse, a lotion, an ointment, a make-up product, a lip balm, a hair spray product, an arachnid/insect repellent or a medicinal product.
US11724128B2

The present disclosure provides a system and method for X-ray imaging. The method of calculating scatter in an X-ray image may include forming a modulated X-ray image. The method of forming the modulated X-ray image may include acquiring X-rays through a collimator module and an imaged object in sequence to generate an X-ray image group; the acquisition may be performed during a movement of the collimator module in a first direction and the X-ray image group may include a plurality of X-ray images acquired at different times during the movement of the collimator; extracting sub-zones from the plurality of X-ray images in the X-ray image group; combining the sub-zones in the first direction to form the modulated X-ray image. In the present disclosure, an intensity distribution of the X-rays may be adjusted flexibly using a collimator without adding any extra hardware. In addition, scatter components in the X-ray images may be calculated to eliminate the scatter in the X-ray images finally.
US11724125B2

A radiotherapy apparatus for an animal comprises a treatment part including an accommodation space for placing an animal, an irradiation part including an electron generator and a linear accelerator coupled to one side of the electron generator and disposed in a direction perpendicular to the treatment part, the linear accelerator being configured to emit radiation toward the treatment part, and an image acquisition part located at a preset interval from the treatment part along an irradiation direction of the radiation and configured to obtain an image of an irradiation area when the radiation is applied, wherein the radiation has an output of 1 MeV to 2 MeV so as to be applied to a diseased part located within a predetermined distance range from epidermis of the animal.
US11724124B2

Systems and methods for restructure and stabilization of bones that provide an anti-microbial effect are disclosed herein. A device includes a delivery catheter having an inner void for passing at least one light sensitive liquid, and an inner lumen; an expandable member releasably engaging the distal end of the delivery catheter; at least one channel positioned in the expandable member; and a light conducting fiber sized to pass through the inner lumen of the delivery catheter and into the expandable member, wherein, when the light conducting fiber is in the at least one channel, the light conducting fiber is able to disperse light energy to provide an anti-microbial effect. When the light conducting fiber is in the expandable member, the light conducting fiber is able to disperse the light energy to initiate hardening of the light sensitive liquid within the expandable member to form a photodynamic implant.
US11724123B2

Photobiomedulation therapy (PBMT) can be applied to the eye to treat optical neuritis, a sign of multiple sclerosis (MS). The light of PBMT can be directed into the eye, regardless of the position of the eye, by a device that includes an array of light delivery devices and a heat sink lens. The device can be placed proximal to the eye to direct the light into the eye. The light can have one or more wavelengths from 400-1100 nm and can be applied in at least one of a pulsed operating mode, a continuous operating mode, and a super-pulsed operating mode through the light source device to the skeletal muscle. The light signal is applied for a time sufficient to stimulate a phototherapeutic response in the retina and/or the optic nerve. PBMT applied in this manner provides a noninvasive, safe and effective treatment for optic neuritis.
US11724122B2

Provided is a laser patch, and the laser patch includes: a patch body having a through hole for laser transmission; a circuit substrate disposed in the patch body; a built-in battery disposed, facing the circuit substrate, in the patch body; a laser diode element electrically connected to the circuit substrate and emitting a low-output laser beam to the outside of the patch body by using its own power coming from the built-in battery; and a charging terminal provided in the patch body for selectively supplying electricity to the built-in battery from an external charger.
US11724116B2

A wearable cardioverter defibrillator (“WCD”) latching connector system includes a receptacle positioned within a WCD monitor, and a connector configured to removably engage the receptacle.
US11724114B2

An implantable pulse generator (IPG) is disclosed having an improved ability to steer anodic and cathodic currents between the IPG's electrodes. Each electrode node has at least one PDAC/NDAC pair to source/sink or sink/source a stimulation current to an associated electrode node. Each PDAC and NDAC receives a current with a magnitude indicative of a total anodic and cathodic current, and data indicative of a percentage of that total that each PDAC and NDAC will produce in the patient's tissue at any given time, which activates a number of branches in each PDAC or NDAC. Each PDAC and NDAC may also receive one or more resolution control signals specifying an increment by which the stimulation current may be adjusted at each electrode. The current received by each PDAC and NDAC is generated by a master DAC, and is preferably distributed to the PDACs and NDACs by distribution circuitry.
US11724112B2

A biostimulator, such as a leadless cardiac pacemaker, having a header assembly that includes an antenna, is described. The antenna can be integrated into an insulator that separates an electrode of the header assembly from a flange of the header assembly. The antenna includes an antenna loop embedded in a ceramic material of the insulator. The antenna loop is located distal to the flange to reduce the likelihood of signal interference and increase communication range of the antenna. The header assembly is mounted on a housing have an electronics compartment, and an antenna lead extends from the antenna loop to electronic circuitry contained within the electronics compartment. Other embodiments are also described and claimed.
US11724108B2

Electrical stimulation of neural activity in the neural innervation of the spleen provides a useful way to treat acute medical conditions. The disclosed systems and methods stimulate the neural activity of a nerve supplying a spleen, wherein the nerve is associated with a neurovascular bundle, such that the electrical signal produces an improvement in a physiological parameter indicative of treatment of an acute medical condition.
US11724097B2

A rotary machine is provided which may include a rotor and a stator within a housing. The stator may be for generating a rotating magnetic field for applying a torque to the rotor. A commutator circuit may provide a plurality of phase voltages to the stator, and a controller may adjust the plurality of phase voltages provided by the commutator circuit to modify an attractive force of the stator on the rotor to move the rotor in an axial direction.
US11724096B2

A blood pump for supporting the heart may be provided that includes: a rotor with delivery elements; a rotor drive; a pressure sensor; and a regulating device that regulates a pressure or a hemodynamic parameter by means of control of the rotor drive. The pressure and/or the hemodynamic parameter may be determined by means of one or a plurality of hemodynamic sensors and/or from operating parameters of the pump. The regulating device may be suitable for regulating a hemodynamic parameter successively, such as periodically, to different target values. Using such regulation, the blood pump may be operated in an optimized manner, and operation of the blood pump may be varied in a targeted and patient-protective manner in order to attain certain goals.
US11724089B2

Intravascular blood pumps and methods of use. The blood pump include a pump portion that includes a collapsible blood conduit defining a blood flow lumen between an inflow and an outflow. The pump portion includes a distal collapsible impeller axially spaced from a proximal collapsible impeller, at least a portion of each of the distal and proximal collapsible impellers disposed between the inflow and the outflow.
US11724085B2

Systems and methods of disinfection of catheter connections are provided. A transfer catheter connector can include a UV-transparent window at its distal end and a sealing plunger proximal to the UV-transparent window. A solution set connector can be inserted inside a portion of the transfer catheter connector to connect a solution set and transfer catheter. The solution set connector comprises a lumen covered by a leading membrane surface; a sealing surface configured to sealingly engage the window surface, and a piercing member configured to pierce the membrane surface. The sealing plunger, membrane surface, and window define a disinfection zone. The connectors can be connected in a disinfection position configuration in which flow is not permitted between the catheters and the connectors are irradiated with UV light. After disinfection, the connectors are advanced to a flow position in which the piercing member pierces the membrane surface, enabling flow between the catheters.
US11724080B2

In a method for implantation of a physically stabilized aggregate of living cells or tissue fragment is injected into a channel provided in soft tissue filled with an aqueous gel. Also discloses are methods of stabilizing such aggregates and fragments and of forming such channel in soft tissue as well as means for carrying out the methods.
US11724066B2

The present embodiments provide strain relief members for a medical device delivery system, methods of use thereof, and methods of manufacturing. In one embodiment a strain relief member may include a support having a first end with a first outer diameter, a second end having a second outer diameter, an inner surface facing a support lumen that extends axially through the support along a longitudinal axis, and an outer surface opposite to the inner surface. An embodiment may also include an overlay coupled to a portion of the outer surface of the support, where the overlay comprises a first material and the support comprises a second material, and the first material is more flexible than the second material. A liner may be disposed in a portion of the support lumen and a first connector disposed over a portion of the support.
US11724062B2

Methods and devices for actuating a clearance device to clear obstructive debris from medical tubes are disclosed. More particularly, a shuttle that includes a first primary magnetic element that is adapted to magnetically engage and translate a magnetic guide within a tube is disclosed. The first primary magnetic element is aligned so that a first primary magnetic field emanating therefrom is aligned substantially perpendicular to a longitudinal axis of the tube when viewed from a side of the shuttle.
US11724056B2

Devices and methods for providing respiratory therapy are disclosed. One device includes a first lumen, a second lumen, and a bridge with at least one opening. The first lumen has a first inlet end to receive a first flow of breathing gas, a first outlet end to deliver the first flow, and a first bend between the first inlet end and the first outlet end. The second lumen has a second inlet end to receive a second flow of breathing gas, a second outlet end to deliver the second flow, and a second bend between the second inlet end and the second outlet end. The bridge separates the first lumen and the second lumen, attaches to the first lumen at the first bend and the second lumen at the second bend, and is configured to maintain the first flow of breathing gas separate from the second flow of breathing gas.
US11724053B2

An apparatus for endotracheal intubation. The apparatus allows medical personnel to grip and stabilize a bougie inside the apparatus and maintain a curved orientation during the intubation processes. The apparatus includes a locking ring for retaining the bougie during use.
US11724052B2

Airway adapters, suction catheter systems, and methods of using the same are described herein. An exemplary airway adapter assembly may comprise a connector body portion having a first end and a second end, an elongate cavity having an axial center can be defined between the first and the second end, and a valve can be coupled to the second end of the connector body. The exemplary airway adapter assembly may also comprise a ventilation base member comprising a tubular portion coupled to the second end of the connector body portion and ventilator port. The ventilator port may comprises a conduit having a first conduit end and a second conduit end, and the first conduit end may be coupled to the tubular portion through an articulable connection. An exemplary closed suction catheter system may comprise a suction control valve assembly and a closed suction catheter sheath.
US11724044B2

A catheter system may include a luer adapter, which may include an outer surface having threading or a recess. The catheter system may also include a flow control plug, which may include a proximal end and a distal end. The proximal end of the flow control plug may include a filter element permeable to air and not to blood. The distal end of the flow control plug may include a cylinder and a taper-shaped luer tip spaced apart from the cylinder. An inner surface of the cylinder may include a protrusion engaged in a snap-fit with the recess or corresponding threading mated with the threading.
US11724026B2

An infusion pump includes a housing with a door pivotally mounted to the housing, a tube channel on the housing configured to hold a tube in the infusion pump, a pumping mechanism including a shuttle, and a slide clamp ejection device.
US11724023B2

Systems, kits and methods for preparing an injection system and/or treating target lesions with a selective internal radiation therapy which includes a double-barrel syringe loaded with a two-component tissue glue and radioisotope loaded microspheres. The microspheres are loaded into the syringe based on the size of the target location and are administered with a needle or dual-lumen catheter. Dosing regimens for treating breast cancer lesions or surgical beds up to 130 mm in diameter and hepatocellular carcinoma lesions up to 50 mm are included.
US11724015B2

The invention provides apheresis devices and their use for removal of substantially all types of cell free DNA (cfDNA) in patients' blood, including nucleosome-bound cfDNA, exosome-bound cfDNA and unbound cfDNA (including double stranded DNA (dsDNA), single stranded DNA (ssDNA) and oligonucleotides), to limit the negative effects of the circulating cfDNA and to treat various diseases.
US11724012B2

A dialysis method and system for determining an amount of total chlorine in a partially purified water sample is disclosed. The system includes a water machine that produces at least partially purified water including an at least partially purified water sample and a dialysis machine that provides a dialysis treatment to a patient. The dialysis machine receives the at least partially purified water from the water machine to prepare dialysis fluid for the dialysis treatment. The system also includes a total chlorine detector configured to receive the at least partially purified water sample, at a first time apply a source voltage to the at least partially purified water sample, and at a second time stop applying the source voltage to the at least partially purified water sample and instead monitor a sensed electrical parameter to determine an amount of total chlorine in the at least partially purified water sample.
US11724011B2

Dialysis systems comprising actuators that cooperate to perform dialysis functions and sensors that cooperate to monitor dialysis functions are disclosed. According to one aspect, such a hemodialysis system comprises a user interface model layer, a therapy layer, below the user interface model layer, and a machine layer below the therapy layer. The user interface model layer is configured to manage the state of a graphical user interface and receive inputs from a graphical user interface. The therapy layer is configured to run state machines that generate therapy commands based at least in part on the inputs from the graphical user interface. The machine layer is configured to provide commands for the actuators based on the therapy commands.
US11724009B2

Modularizable implants and stents made with bio-absorbable metal wire alloys (‘bio-metals’, e.g. magnesium and alloys), and methods for making such implants and stents. The stents or implants may include one or more wire-formed rings or comprise inter-connected cells that form nets that may serve as modules that are assembled mechanically into stents, without the need for certain manufacturing processes that may affect the durability and physical properties thereof. The wires may be formed into rings mechanically and held in place using joining cuffs, and/or adjacent wires may be secured to one other mechanically using joining cuffs to form nets which can be used as implants or formed into stents. The stents can include radiopaque portions, e.g. associated with one or more joining cuffs, to aid in the positioning and evaluation of stents in the body by serving as visual indicators of alignment and expansion that can be detected using X-rays.
US11724006B2

A method of producing a cryogel-based multicompartment 3D scaffold is herein disclosed. The method comprises the steps of: a) providing a first frozen polymeric layer on a refrigerated support kept at subzero temperature; b) providing subsequent polymeric layers to obtain a stack of polymeric layers by possibly modulating the subzero temperature of the refrigerated support; c) optionally incubating the final polymeric structure at subzero temperature; and d) placing the produced cryogel at a temperature above 0° C., the method being characterized in that each subsequent layer i) is deposited on the previous one after freezing of this latter; ii) is deposited on the previous one before the complete polymerization of this latter; and iii) is deposited with a temperature higher than the freezing temperature of the previously deposited layer. Cryogel scaffolds obtained from the method of the invention are also disclosed.
US11724001B2

Disclosed is an air purification device having a housing for holding a photocatalytic oxidation (PCO) unit and a fan assembly. The device may also optionally include a filter compartment for holding a filter such as a HEPA filter. The air purification device is configured to provide effective purification and sanitation of air in a targeted indoor environment, and in particular in a medical environment such as a hospital.
US11723995B2

Sterilizing devices, preferably foot mats, comprise: a support member having an arrangement structure and a plurality of UV light emitting members, where the support member is configured for total internal reflection of UV light from the UV light emitting members; a power source providing power to the plurality of UV light emitting members; and a translucent substrate having an upper surface and a lower surface; wherein the translucent substrate is disposed above the support member such that the lower surface of the translucent substrate can be brought into contact with an upper region of the support member when a downward force is applied to the upper surface of the translucent substrate; and wherein the contact between the lower surface of the translucent substrate and the support member breaks the total internal reflection in the area of contact such that UV light is emitted through the translucent substrate.
US11723990B2

The present disclosure relates to polymers which contain a hydrophobic and hydrophilic segment which is sensitive to pH. In some aspects, the polymers form a micelle which is sensitive to pH and results in a change in fluorescence based upon the particular pH. In some aspects, the disclosure also provides methods of using the polymers for the imaging of cellular or extracellular environment or delivering a drug.
US11723989B2

Provided herein is a recombinant AAV (rAAV) comprising an AAV capsid and a vector genome packaged therein, wherein the vector genome comprises an AAV 5′ inverted terminal repeat (ITR), an engineered nucleic acid sequence encoding a functional human N-acetyl-alpha-glucosaminidase (hNAGLU), a regulatory sequence which direct expression of hNAGLU in a target cell, and an AAV 3′ ITR. Also provided is a pharmaceutical composition comprising a rAAV as described herein in a formulation buffer, and a method of treating a human subject diagnosed with MPS IIIB.
US11723987B2

Provided herein are recombinant expression vector systems for expression by stem cells that allow for selective elimination of stem cell-derived tumorigenic cells, while preserving stem cell-derived therapeutic cells. The systems provided herein provide a means by which modified stem cells can be safely transplanted into subjects. In exemplary embodiments, the system comprises at least two suicide genes, one of which is specifically inactivated in cells exhibiting the desired phenotype and one of which is activated when the cell comprising the recombinant expression vector system behaves similarly to or the same as a tumor cell.
US11723986B2

The invention provides for recombinant AAV vectors comprising a miniaturized human micro-dystrophin gene and methods of using the recombinant vectors to reduce or prevent fibrosis in subjects suffering from muscular dystrophy.
US11723983B2

The invention relates to a glycoprotein-toxic pay-load molecule conjugate, a toxic payload molecule-glycan conjugate, and a pharmaceutical composi-tion. The invention further relates to a method for preparing the glycoprotein-toxic payload molecule conjugate, the method for modulating growth of a cell population and a method of treating tu-mour cells.
US11723978B2

Gancyclovir formulations that are ready-to-use, substantially particulate free, and stable upon storage are disclosed. Methods of manufacture and administration of such compositions are also provided.
US11723975B2

This provides pharmaceutical compositions that comprise (i) an anti-LAG-3 antibody or antigen binding fragment thereof or (ii) an anti-LAG-3 antibody or antigen binding fragment thereof and an anti-PD-1 antibody, anti-PD-L1 antibody, or antigen binding fragment thereof. Also provided are pharmaceutical compositions that comprise a buffering agent, stabilizing or bulking agent, and a surfactant. The disclosure also provides a vial, syringe, intravenous bag, or kit that comprises the compositions, and methods for using the compositions.
US11723973B2

The present invention provides humanized monoclonal antibodies, bi-specific antibodies, antibody conjugates, and fusion proteins that bind to the chemokine receptor CCR4. This antibody is derived from CCR4-IgG1 and recognizes the same epitope. This antibody contains either an IgG4 or a stabilized IgG4 in order to improve binding efficiency and reduce in vivo Fab arm exchange. Binding of the antibodies disclosed herein to CCR4 inhibits ligand-mediated activities and is used to treat symptoms of cancer.
US11723970B2

Poxvirus vectors encoding a synthetic HIV envelope antigen and other HIV antigens, as well as compositions containing such poxvirus vectors and uses of such poxvirus vectors as vaccines to provide improved immunity against HIV, are provided. Also provided are vaccine combinations containing the disclosed poxvirus vectors, adenovirus vectors encoding one or more HIV antigens, and one or more isolated HIV antigenic polypeptides, and methods of using the vaccine combinations to provide improved immunity against HIV.
US11723965B2

The invention provides eTEC linked glycoconjugates comprising a saccharide covalently conjugated to a carrier protein through a (2-((2-oxoethyl)thio)ethyl)carbamate (eTEC) spacer, immunogenic compositions comprising such glycoconjugates, and methods for the preparation and use of such glycoconjugates and immunogenic compositions.
US11723961B2

The present invention provides compositions, methods, and systems for treating inflammatory conditions (e.g., by inhibiting reactive oxygen species) in or on a subject with maspin, maspin derivatives, or maspin mimetics. In some embodiments, such agents are applied to the skin of a subject (e.g., to reduce skin aging).
US11723951B2

The invention relates to polypeptides that comprise a portion of filamentous bacteriophage gene 3 protein (g3p) sufficient to bind to and/or disaggregate amyloid, e.g., the N1-N2 portion of g3p and mutants and fragments thereof, wherein that g3p amino acid sequence has been modified through amino acid deletion, insertion or substitution to remove a putative glycosylation signal. The invention further relates to such polypeptides that are also modified through additional amino acid substitution to be substantially less immunogenic than the corresponding wild-type g3p amino acid sequence when used in vivo. The polypeptides of the invention retain their ability to bind and/or disaggregate amyloid. The invention further relates to the use of these g3p-modified polypeptides in the treatment and/or prevention of diseases associated with misfolding or aggregation of amyloid.
US11723947B2

The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders.
US11723944B2

The present application provides stable peptide-based Botulinum neurotoxin (BoNT) serotype A capture agents and methods of use as detection and diagnosis agents and in the treatment of diseases and disorders. The application further provides methods of manufacturing BoNT serotype A capture agents using iterative on-bead in situ click chemistry.
US11723943B2

The present disclosure relates to health benefits of Chardonnay seed products.
US11723939B2

The present invention relates to a composition for oral use comprising an extract of Tamarindus indica, hyaluronic acid and/or its salts and at least one block copolymer of ethylene oxide and propylene oxide for the treatment of gastric and oesophageal diseases, in particular gastroesophageal reflux.
US11723928B2

This document provides methods and materials for treating multiple system atrophy. For example, methods and materials for using autologous mesenchymal stem cells (e.g., adipose derived mesenchymal stem cells) to treat multiple system atrophy are provided.
US11723926B2

The invention relates to DPP4-binding domains, as well as antibodies and chimeric antigen receptors (CAR) comprising the same. Also disclosed are methods for treating, preventing or alleviating senescence-related diseases or disorders, or for depleting and/or killing senescent cells.
US11723923B2

Provided herein are methods for delaying or inhibiting T cell maturation or differentiation in vitro for a T cell therapy, comprising contacting one or more T cells from a subject in need of a T cell therapy with an AKT inhibitor and at least one of exogenous Interleukin-7 (IL-7) and exogenous Interleukin-15 (IL-15), wherein the resulting T cells exhibit delayed maturation or differentiation. In some embodiments, the method further comprises administering the one or more T cells to a subject in need of a T cell therapy.
US11723915B2

The invention relates to a product for use in the therapeutic or prophylactic treatment of infections, said treatment comprising oral administration of the product, wherein the product is selected from a nutritional formulation, a food product, a dietary supplement, a beverage and a pharmaceutical product, said product containing carrot RG-I polysaccharides having the following combination features: a molecular weight in the range 10-300 kDa; a backbone consisting of galacturonic acid residues and rhamnose residues, said rhamnose residues being contained in alpha(1→4)-galacturonic-alpha(1→2)-rhamnose residues; the following monosaccharide composition: 20-60 mol. % galacturonic acid residues, wherein the individual galacturonic acids can be methylated and/or acetyl-esterified; 8-50 mol. % rhamnose residues; 0-40 mol. % arabinose residues; 0-40 mol. % galactose residues; molar ratio of galacturonic acid residues to rhamnose residues in the range of 5:1 to 1:1; galacturonic acid residues, rhamnose residues, arabinose residues and galactose residues together constitute at least 85 mol. % of the monosaccharide residues in the carrot RG-I polysaccharides. These carrot RG-I polysaccharides can be produced by partially hydrolysing pectic polysaccharides present in a carrot pectin isolate. The effectiveness of carrot RG-I polysaccharides against infections is substantially improved by enzymatically hydrolysing the RG-I polysaccharides to remove at least part of the homogalacturonan component.
US11723906B2

The invention is directed to roles for PARP-1 in disease.
US11723902B2

Methods of treating cancer related conditions using anamorelin are described.
US11723901B2

The present invention relates to the novel use of certain piperidinyl-indole derivatives in the treatment of patients suffering from renal diseases or disorders, and in particular for the treatment of patients suffering from C3G (C3 glomerulopathy) and IgAN (IgA nephropathy).
US11723894B2

The present application provides a combination product for the treatment and/or prevention of psychiatric and/or neurological disorders. The combination product comprises (i) a compound which promotes neurogenesis and has hallucinogenic and/or psychedelic side effects, and (ii) a 5-HT2A receptor antagonist which alleviates and/or removes the hallucinogenic and/or psychedelic side effects caused by the first compound.
US11723889B2

The object of the present invention is to provide a formulation with the effect of effectively suppressing or inhibiting amyloid fibril formation by the dissolution, elimination (discharge), etc. of amyloid fibril formation in vivo. If an agent for suppressing or inhibiting an amyloid fibril formation comprising tranilast or a pharmacologically acceptable salt thereof as an active ingredient is administered by a method such as oral administration, amyloid fibril formation can be effectively suppressed or inhibited in vivo as a result of effects such as amyloid fibril dissolution or elimination (discharge). Therefore, it is possible to prevent or treat amyloid plaques, in which amyloid fibrils formed by the aggregation of amyloid protein have been deposited, and to prevent or treat diseases arising from amyloid fibril deposition, that is, diseases arising from the deposited amyloid fibrils themselves and diseases that cause dysfunction of organs or tissues as a result of amyloid fibril deposition.
US11723887B2

This present invention relates to an improved process to prepare prostacyclin derivatives. One embodiment provides for an improved process to convert benzindene triol to treprostinil via salts of treprostinil and to purify treprostinil.
US11723885B2

Effective methods and compositions to deter abuse of pharmaceutical products (e.g., orally administered pharmaceutical products) including but not limited to immediate release, sustained or extended release and delayed release formulations for drugs subject to abuse.
US11723880B2

Described herein are transdermal formulations of phytocannabinoids and methods of using the same in the treatment of pain and/or inflammation.
US11723873B2

An oral dosage form of ticagrelor includes a core and a semi-permeable membrane coating the core. The core comprises a first drug layer and a push layer. The first drug layer contains ticagrelor that is sufficient to deliver an effective amount of the drug over an intended delivery time. The push layer comprises a swelling agent and an osmogen agent. The semi-permeable membrane has at least one passageway formed therethrough, positionally configured to face the first drug layer, but not to face the push layer, of the core, and functionally configured to allow the ticagrelor to realize an extended release out of the core upon contacting an aqueous environment. The dosage form optionally further includes a second ticagrelor-containing drug layer coating the semi-permeable membrane, thereby providing a starting effective dose upon administration. The dosage form can realize once-a-day administration of ticagrelor of patients in need thereof.
US11723867B2

The present application relates to a method for preparing a pharmaceutical composition, the method comprising providing pharmaceutical compound having a solubility in water of 1 mg/ml or less at 25° C. in a solvent enabling solubilizing the pharmaceutical compound at least partly into the solvent, providing an aqueous dispersion of nanostructured cellulose, and combining the pharmaceutical compound with the aqueous dispersion of nanostructured cellulose in an anti-solvent process to provide nanosized pharmaceutical particles having an average diameter of 50 nm or less, to provide a pharmaceutical composition. The present application also provides pharmaceutical composition, and use of the pharmaceutical composition.
US11723862B2

A composition comprises a therapeutically effective oral pharmaceutical dosage form. The dosage form includes an aqueous carrier material having an acidic pH and a plurality of individual pellets having a first dose of melatonin therein. The individual pellets comprises (i) a solid core; (ii) an active coating over the solid core, the active coating including melatonin and a hydrophilic binder; and (iii) an enteric coating over the active coating. A dissolution pH of the enteric coating is higher than the acidic pH of the aqueous carrier material.
US11723856B2

Polymers comprising at least one cationic functional group and at least one ultraviolet light-absorbing compound are disclosed herein. The polymers exhibit ultraviolet light-absorbing properties and may be used in sunscreen compositions for skin and/or hair.
US11723854B2

The present disclosure provides biophotonic topical compositions and methods useful in phototherapy. In particular, the biophotonic topical compositions of the present disclosure are substantially resistant to leaching such that very low amounts of chromophore(s) present in the biophotonic composition leach out of the composition. The biophotonic compositions and the methods of the present disclosure are useful for promoting wound healing and skin rejuvenation, as well as treating acne and various skin disorders.
US11723852B2

Compositions comprising one or more chelating agents and optionally zinc ion salts are used to inhibit the growth or biofilm formation in bacteria associated with personal care products such as ophthalmic, pedicure, manicure or podiatric solutions. The compositions of the present application can also comprise gelling agents, antimicrobials, antibiotic or a pH adjuster. The compositions may be in the form of a solution, a gel, a cream, a jelly, a powder, a paste, a lotion, soap and a cleaner.
US11723851B2

A personal care deodorant and/or antiperspirant product substantially void of any endocrine disrupting chemicals, and a method of making the same. Embodiments of the deodorant include one or more of the following: a skin conditioning agent, an emollient, a nonaqueous viscosity increasing agent, a surfactant/emulsifying agent, an absorbent, a soothing agent, a deodorant agent, a viscosity-controlling agent, and a scent.
US11723818B2

A patient transport apparatus including a patient litter and a litter support apparatus for supporting the patient litter from a ground surface. The litter support apparatus includes a litter support frame including a pair of litter supports spaced a distance apart to define a loading gap for receiving the patient litter therethrough. A handle system is coupled to the pair of litter supports and includes a handle assembly that is positionable between a closed configuration and an open configuration. The handle assembly extends across the loading gap defined between the pair of litter supports in the closed configuration and is positioned away from the loading gap in the open configuration.
US11723811B2

A low-elastic compression garment includes a central main portion and multiple straps that extend laterally from the central main portion. Notches may be provided where the straps meet the central main portion, and may be formed into the central main portion adjacent to respective straps. With the notches, when the compression garment is in a wrapped position, lateral edges of adjacent straps that are associated with the notches overlap without gaps or bunching of the strap material. The compression garment may include distal and proximal counter pull tabs that extend from opposite edges of the central main portion. When the distal and proximal counter pull tabs are pulled by the user, pulling forces are transmitted in opposing directions to tension the straps. A removable fastening tab is provided respectively at ends of each of the straps. The fastening tabs are repositionable at different locations on the straps, resulting in a compression garment that is both reversible and easily sized for a customized fit.
US11723807B2

A deep insert, inflatable hearing protection earplug is provided that is easy for an untrained user to insert correctly, reliably providing high acoustic attenuation and remaining both secure and comfortable for long durations in a human ear. The earplug comprises a soft elastomer shell that forms a sealed volume filled with an inert fluid. The earplug can comprise a slender, flexible stem that is easily insertable into the ear canal when deflated. The proximal end of the earplug can be situated outside the ear canal, within the concha of the ear, and incorporates a bulb with a hemispherical, bistable cap. After inserting the shaft of the earplug into the ear canal, the wearer applies force with a finger to invert the cap, which transitions elastically from a convex to a concave external geometry, displacing a fixed volume of fluid to inflate a sheath that forms the outer covering of the stem, filling and sealing the ear canal. The sheath can be deflated by pulling on or otherwise engaging a release tab or other feature attached to the cap.
US11723801B2

An active irrigation system for controlling delivery of irrigation fluid to a surgical site includes a chamber having at least one fluid port for introducing an irrigation fluid from a fluid source into the chamber and delivering the irrigation fluid to a surgical site. A variable pressure source is provided in fluid communication with the chamber and is configured to pressurize the chamber. A pressure sensor also in fluid communication with the chamber monitors the pressure within the chamber and a controller adjusts the variable pressure source to maintain the desired irrigation pressure within the chamber.
US11723798B2

An apparatus includes a body, a needle, a catheter, and an actuator assembly. The needle extends distally from the body. The needle has an inner wall defining a needle lumen. The needle lumen is in fluid communication with a fluid port of the body. The catheter is slidably disposed in the needle lumen. The catheter has a catheter lumen. The first actuator assembly is configured to translate the catheter within and relative to the needle. The apparatus may also include an actuator assembly that is configured to rotate the needle relative to the body. The apparatus may be used to first deliver a leading bleb of fluid to the subretinal space in a patient's eye via the needle. The apparatus may then be used to deliver a therapeutic agent to the subretinal space in the patient's eye via the catheter.
US11723794B2

The described apparatuses, devices, and mechanisms are configured to measure the temperature of one or more Abreu brain thermal tunnel (ABTT) terminuses. In addition, some embodiments are configured to provide treatment for the diagnosed conditions and diseases.
US11723785B2

An orientable intravascular device having a “twelve o'clock” marker on a proximal and distal end for treating an aneurysm, including a packaging catheter with an identical fixed non-round shaped inner lumen, a pusher wire having an occlusion device releasably disposed on the distal end of said pusher wire, preloaded at a fixed circumferential orientation, with corresponding markers on the outside of said packaging catheter, a hub having an inner lumen that is shaped to marry with the outer lumen of the packaging catheter to deliver a delivery wire and occlusion stent in a predicted orientation, and maintaining such orientation as the wire and stent are advanced through said delivery catheter, and while said delivery catheter is withdrawn. Methods of using same are disclosed.
US11723781B2

An implant extractor that includes an elongated body having a proximal end for attachment to an extraction device, a first arm extending from the elongated body, and a second arm pivotably connected to the first arm. The second arm includes a moment arm for generating a torque about a distal end of the second arm. The implant extractor further includes a force applicator operatively connected to the first arm and the moment arm to apply a force to one or more of the first and second arms.
US11723768B2

The present disclosure describes devices, systems, and methods for loading, delivering, positioning, and deploying an artificial heart valve device at the mitral annulus. A delivery system includes a delivery member coupled to a handle assembly and extending distally from the handle assembly. The valve device is attached at the distal end of the delivery member, and is constrained within a valve cover of an outer sheath. A delivery catheter is configured to advance the valve relative to the outer sheath, and a suture catheter includes sutures/tethers which maintain proximal tension on the valve prior to deployment.
US11723761B2

The present invention is a dental storage box (1) comprising a 3-dimensional hollow body (10) whose at least one surface is open and at least one outer cover (13) which closes the open surface of said body (10) in a manner providing sealing, in order to preserve a tooth, removed from the place thereof as a result of a trauma, for at least partially increasing the vitality duration of the tooth thanks to a protective liquid (30) provided therein. Accordingly, the subject matter dental storage box (1) is characterized by comprising at least one separator (15) provided inside the body (10) and which separates the protective liquid (30) and at least one cleaning liquid (40) in a manner providing sealing.
US11723755B2

A dental superstructure securable to a protruding dental abutment, related assembly and method of design are provided. The dental superstructure is designed to mimick a tooth and is perforated to create a drop-shaped screw conduit for screw insertion and advancement. The screw conduit includes an insertion portion extending substantially conically outwardly from an inlet to enable advancement of an inserted screw along an insertion axis and a spherical angulation portion extending from and communicating with the insertion portion to allow angulation of the screw from the insertion axis to an implant axis. Buccal and/or lingual contours of the screw conduit may be respectively arched outwardly and inwardly from the insertion axis to adapt to screw advancement needs. The dental superstructure may be part of an assembly for a dental implant in combination with an osseointegrable implant including the protruding dental abutment; and a dental abutment screw.
US11723751B2

Disclosed is a system and method for treating mal-alignment of teeth using super-elastic nickel titanium, heat activated nickel titanium coated or uncoated orthodontic wires with composite resins in order to effectuate desired tooth alignment. The composite resin is formed into beads that hold the wire in place preferably on the lingual surface of the teeth. Alternate embodiments using composite brackets are disclosed. The overall purpose of this invention is to provide a close contact, low profile orthodontic system, in particular, a lingual orthodontic system that is significantly more comfortable than existing orthodontic systems, completely concealed and effective.
US11723749B2

The current document is directed to methods and systems for monitoring a dental patient's progress during a course of treatment. A three-dimensional model of the expected positions of the patient's teeth can be projected, in time, from a three-dimensional model of the patient's teeth prepared prior to beginning the treatment. A digital camera is used to take one or more two-dimensional photographs of the patient's teeth, which are input to a monitoring system. The monitoring system determines virtual-camera parameters for each two-dimensional input image with respect to the time-projected three-dimensional model, uses the determined virtual-camera parameters to generate two-dimensional images from the three-dimensional model, and then compares each input photograph to the corresponding generated two-dimensional image in order to determine how closely the three-dimensional arrangement of the patient's teeth corresponds to the time-projected three-dimensional arrangement.
US11723739B2

The disclosed embodiments relate to systems and methods for a surgical tool or a surgical robotic system. An actuator or a motor of a tool driver is configured to operate a joint of a tool. One or more processors are configured to receive an initial joint command for the joint of the tool, determine a joint torque based on motor torque of the motor or actuator as well as motor to joint torque mapping, calculate a tip force based on an effective length associated with the joint and based on the joint torque, compare the tip force to a predetermined threshold, calculate an admittance control compensation term in response to the tip force exceeding the predetermined threshold, and generate a command for the motor or actuator based on the admittance control compensation term and the initial joint command.
US11723738B2

A small diameter surgical tool implements an agonist-antagonist deflectable joint. The deflectable joint is an actuatable bendable structure that uses push-pull, agonist-antagonist action of a pair of nested tubes to actuate the joint. The tubes are designed to have non-central, offset neutral axes, and they are fixed together at locations distal to the deflectable joint, such as at their distal ends. Axial translations of the tubes relative to each other causes a push-pull, agonist-antagonist action between the tubes, which causes the deflectable joint to bend. In one implementation, a deflectable joint can be created in nested tubes by configuring radial portions of the tube sidewalls extending along the joint to have an axial region of reduced stiffness. As a result, axial agonist-antagonist motion between the tubes can cause bending of the deflectable joint.
US11723735B2

A surgical manipulator assembly comprises a manipulator movably supporting a tool holder and an indicator section operably coupled to the manipulator for indicating state or identity information. The indicator section includes a multiple-color light emitting diode (LED) and a first fastener for operably coupling a second fastener of a sterile drape used to substantially cover the surgical manipulator assembly.
US11723724B2

A method of designing an orthopedic implant comprising: (a) iteratively evaluating possible shapes of a dynamic orthopedic implant using actual anatomical shape considerations and kinematic shape considerations; and, (b) selecting a dynamic orthopedic implant shape from one of the possible shapes, where the dynamic orthopedic implant shape selected satisfies predetermined kinematic and anatomical constraints.
US11723713B2

A cutting element for an electrosurgical device. The cutting element includes an elongate non-conductive body having a first face opposite a second face, the first face and the second face defining an edge there between. A conductive element is disposed only along the edge, the conductive element being configured to cut tissue with monopolar radiofrequency energy.
US11723710B2

Techniques for High-Frequency Irreversible Electroporation (HFIRE) using a single-pole tine-style internal device communicating with an external surface electrode are described. In an embodiment, a system for ablating tissue cells in a treatment region of a patient's body by irreversible electroporation without thermally damaging the tissue cells is described. The system includes at least one single-pole electrode probe for insertion into the treatment region, the single-pole electrode probe including one or more tines. The system further includes at least one external surface electrode for placement outside the patient's body and configured to complete a circuit with the single-pole electrode probe. The system also includes a control device for controlling HFIRE pulses to the single-pole tine-style electrode and the skin-surface electrode for the delivery of electric energy to the treatment region. Other embodiments are described and claimed.
US11723699B2

Systems and methods for fixing bone using an intramedullary nail locked to an encircling anchor including a bushing and a locking member. An exemplary system may include any combination of the nail, one or more bushings, one or more locking members, an instrument to guide installation of the bushing, at least one drill, and a driver that attaches to the bushing. The instrument may define a guide axis and be configured to be coupled to a bone such that the guide axis extends across the bone. The instrument may be used to guide a drill, the bushing, and/or the locking member along the guide axis into the bone. The nail may be configured to be placed along the medullary canal of the bone such that the nail extends through the bushing, and the locking member may be configured to lock the nail to the bushing.
US11723695B2

An implantable device may comprise a barrel, the barrel having an upper portion and a lower portion. The barrel may be configured to transition from a collapsed form having a first height to an expanded form having a second height and wherein the second height is greater than the first height. The implantable device may further include an actuator assembly disposed in the barrel, the actuator assembly comprising a front ramped actuator in engagement with the barrel, a rear ramped actuator in engagement with the barrel, and a central screw that extends from the rear ramped actuator through the front ramped actuator. The implantable device may further comprise a first plate and a second plate.
US11723694B2

An adjustable spinous process implant configured with one or more flexible members that extend from the implant and are further attachable to anchors implanted in adjacent vertebrae. The adjustable spinous process implant comprises a spacer that is shaped to fit between two adjacent spinal processes. The flexible members extend from one or more points on the adjustable spinous process implant and attach the anchors to provide tension and stability to the overall implant construct. The anchors are configured with a tensioning mechanism that enables the flexible members to be tensioned within the anchor.
US11723689B2

A surgical access system comprises a trocar, an insufflating optical obturator slidably insertable into the trocar, and a laparoscope slidably insertable into the obturator. A distal end of the obturator comprises a tip, at least a portion of which comprises a wall with a generally uniform thickness comprising a transparent material. At least one vent hole disposed at the obturator tip is fluidly connected to a gas flow channel defined by an interior surface of the obturator and the laparoscope, which is fluidly connected to an insufflation gas inlet disposed at a proximal end of the trocar. Improved optical characteristics of the trocar system permit precise and accurate visual placement thereof into a body cavity. Accordingly the access system is suitable as a first entry surgical access system. Embodiments of the trocar access are also useful for drug delivery, and/or for fluid and/or tissue aspiration.
US11723685B2

A medical device is disclosed for cutting substances inside a body lumen. The medical device includes: a rotatable tubular drive shaft; a treatment member arranged on a distal side of the drive shaft; a device handle configured to locate the drive shaft; a guide cover located in the device handle and disposed to cover the drive shaft; an outer sheath disposed to cover the guide cover and located in a housing of the device handle; a first sealing member located proximal to a proximal end of the outer sheath and proximal to a fluid connection, the fluid connection configured to supply a saline solution into the outer sheath on the guide cover; and a drainage tube located proximal to the outer sheath and the first sealing member, the drainage tube being located in the housing of the device handle, and the drainage tube is fixed with respect to the housing.
US11723678B2

An obstruction removal device is configured to be inserted through a catheter and at least partially extended into a vasculature from a distal end of the catheter. The obstruction removal device includes: a base member configured to engage one or more guide stops at the distal end of the catheter; a tubular member coupled to the base member and configured to apply a suction force from the catheter to an obstruction to remove the obstruction from the vasculature; and an expandable member surrounding the tubular member. The expandable member is configured to transition from a contracted state to an expanded state after the expandable member is at least partially extended into the vasculature from the distal end of the catheter. The expandable member is further configured to at least partially surround the obstruction as the obstruction is being removed from the vasculature.
US11723670B2

An automatic tourniquet apparatus comprises a tourniquet cuff, a pressure transducer, a user interface, a patient hazard shield and a pressure regulator. The pressure transducer produces a cuff pressure signal. The user interface produces a reference pressure signal. The patient hazard shield is responsive to the cuff pressure signal and the reference pressure signal, and operable during a regulation time period to produce a patient hazard signal if, in one implementation, a current level of pressure in the tourniquet cuff is greater than the reference level of pressure by at least a predetermined overpressure limit. The pressure regulator is responsive to the patient hazard signal, and has a pressurizing element for increasing pressure in the cuff and a depressurizing element for decreasing pressure in the cuff. The pressurizing element is configured to be non-responsive if the patient hazard signal is produced.
US11723667B2

Devices and methods for treatment of a patient's vasculature may include a resilient self-expanding permeable implant having a radially constrained elongated state configured for delivery within a catheter lumen and an expanded state with a longitudinally shortened configuration, and a plurality of elongate filaments which are woven together. Each of the plurality of elongate filaments may have a diameter between about 0.0005 and about 0.005 inches. The implant includes at least some filaments consisting of nitinol and at least some composite filaments that are drawn filled tube wires comprising an external nitinol tube and a highly radiopaque material concentrically disposed within the external tube. The implant has at least about 40% composite filaments relative to a total number of filaments, and wherein a total number of filaments is about 10 to about 300.
US11723661B2

Surgical stapling instruments include mechanisms for identifying and/or deactivating stapler cartridge for use with the instruments. The stapling instrument includes a drive member for actuating a staple cartridge and a locking member movable from a disabled position permitting distal translation of the drive member through a staple firing stroke, to a locking position inhibiting distal translation of the drive member through the staple firing stroke. The staple cartridge may include a switch for maintaining the locking member in the disabled position. The switch may be further configured to operate as a reload detection mechanism for determining the type of reload present in the surgical stapling instrument.
US11723652B2

Disclosed embodiments include apparatuses, systems, and methods for guiding a needle to facilitate suturing, such as in surgical anastomosis. In an illustrative embodiment, an apparatus includes a frame configured to counter-rotatably support two generally parallel rollers. A first roller supported by the frame has a flat surface configured to rollably engage a first face of a shaft of a helically-shaped needle. A second roller supported by the frame has a grooved surface defining a helical groove is configured to at least partially receive a second face of the shaft. The second roller further defines a correcting recess bounded by lateral surfaces at a forward end of the groove that tapers to a width of the groove at the forward end. When the leading end is received into the correcting recess, at least one of the lateral surfaces engages and guides the leading end into the forward end of the groove.
US11723644B2

A surgical access system including a tissue distraction assembly 40 and a tissue retraction assembly 10, both of which may be equipped with one or more. electrodes 23 for use in detecting the existence of (and optionally the distance and/or direction to) neural structures before, during, and after the establishment of an operative corridor 15 to a surgical target site. The tissue retraction assembly 10 has a plurality of blades 12, 16, 18 which may be introduced while in a closed configuration, after which point they may be opened to create an operation corridor 15 to the surgical target site, including pivoting at least one blade 12, 16, 18 to expand the operative corridor 15 adjacent to the operative site.
US11723643B2

A device for use in a surgical distraction and retraction assembly, the assembly including the device and at least one bone anchoring pin for securing the device against a bearing surface. The device has an integral frame defining an internal space, the frame having a first pair of opposing side arms and a second pair of opposing side arms. At least one of said side arms of said first pair of opposing side arms including at least one recess each having one of its ends open to the internal space defined by the frame and an opposite closed end terminating within said at least one side arm. Each said recess retains one said at least one bone anchoring pin and is configured to enable relative movement between the frame and the bone anchoring pins. The relative movement allows selective locking of said at least one anchor pin against the frame at a user selected location to maintain a selected extent of vertebral distraction.
US11723629B2

Accordion to one embodiment, an ultrasound diagnosis apparatus includes a volume data generating unit, an image generating unit, an MPR image generating unit, and a display controller. The volume data generating unit generates, based on position angle information of an ultrasound probe and echo data from the ultrasound probe, functional volume data of a subject accompanied with the position angle information. The image generating unit sequentially generates a sectional image of the subject based on the position angle information and the echo data. The MPR image generating unit generates an MPR image corresponding to the cross-section of the sectional image from the functional volume data based on the position angle information corresponding to the sectional image and the position angle information attached to the functional volume data. The display controller displays the sectional image and the MPR image in parallel or in a superimposed manner on a display.
US11723623B2

Embodiments provide for a support system for a portable ultrasound machine. In one example, the support system includes a carrier for an imaging display and a bracket for a beamformer, where the bracket mechanically couples to the carrier in a plurality of positions depending on a desired use of an operator of the portable ultrasound machine. In this way, operational aspects related to use of the portable ultrasound machine, and satisfaction of a user thereof, may be improved.
US11723621B2

A monitoring system includes a wearable patch device configured to be secured to a body of a patient, the wearable patch device comprising a patch body, a first discrete transducer associated with a first position of the patch body, a second discrete transducer associated with a second portion of the patch body, and a wireless transmitter, and electronics including one or more processors and one or more memory devices and configured to receive signals based on transducer readings of the first and second discrete transducers and determine an amount of blood flow through one or more valves of a heart of the patient based on the signals.
US11723616B2

A method of providing by a diagnostic medical imaging device, medical image data representing a diagnostic medical image of the tissue of the patient. The method comprises segmenting, using an image segmentation criterion, in the diagnostic medical image data a diseased area image data representing a diseased area of the tissue, defining, in the segmented image data of the diagnostic medical image data, at least one treatment location, identifying, in the diagnostic medial image data, a treatment surface of the tissue, positioning the interventional device to face the treatment surface, determining a normal to a local tangent plane of the treatment surface of the tissue, the local tangent plane facing the treatment location, imaging, by an interventional medical imaging device, at least a part of the interventional device and the treatment location from a first direction perpendicular to the normal to obtain first interventional image data, verifying, using the first interventional image data, a position of the interventional device in a direction of the normal and in a second direction perpendicular to the normal and perpendicular to the first direction, imaging, by the interventional medical imaging system, at least a part of the interventional device and the treatment location from a third direction having a component in the first direction to obtain a second interventional image data, and verifying, using the second interventional image data, a position of the interventional device in the first direction.
US11723608B2

One embodiment provides a gamma camera system, including: a stand, a rotatable gantry supported by the stand, and a transformable gamma camera connected by mechanical supports to the rotatable gantry and comprising groups of tiled arrays of gamma detectors and a collimator for each group of tiled arrays of gamma detectors; the transformable gamma camera being configured to subdivide into a plurality of subdivided gamma cameras, each of the subdivided gamma cameras having at least one of the groups of tiled arrays of gamma detectors and corresponding collimator, wherein the subdivision into a plurality of subdivided gamma cameras facilitates contouring with a region of interest for a spatial resolution. Other embodiments are described and claimed.
US11723604B2

The present disclosure pertains to systems and methods for encoding and/or decoding brain activity signals for data reduction. In a non-limiting embodiment, first user data associated with a first sleep session of a user is received. The first user data is determined to include at least a first instance of a first sleep feature being of a first data size. A first value representing the first instance during a first temporal interval is determined. First encoding data representing the first value is determine, the first encoding data being of a second data size that is less than the first data size. Second user data is generated by encoding the first user data using the first encoding data to represent the first instance in the second user data, and the second user data is stored.
US11723601B2

A system and method for intracranial access is disclosed. In particular, a drill stop is shown providing a way to control the penetration of a drill bit as an access hole into the brain is being formed. Access to a desired location is achieved using a catheter guide device. Also disclosed is a mechanism by which multiple diagnostic and treatment devices can be placed at a desired location in brain tissue without the need for more than one access hole. A drainage catheter is disclosed with a mechanism to allow both drainage and to allow intracranial pressure measurement.
US11723592B2

Systems, methods and/or devices for treating diabetes mellitus by alleviating glucotoxicity and restoring pancreatic beta-cell function, comprising at least a first memory for storing data inputs corresponding at least to one or more components in a patient's present insulin dosage regimen, and data inputs corresponding at least to the patient's blood-glucose-level measurements determined at a plurality of times, and a processor operatively connected to the at least first memory. The processor is programmed at least to determine from the data inputs corresponding to the patient's blood-glucose-level measurements determined at a plurality of times whether and by how much to vary at least one of the components of the patient's present insulin dosage regimen. Also disclosed are systems, methods, and/or devices for alleviating glucotoxicity and restoring pancreatic beta-cell function, comprising establishing the patient's current glycemic state relative to a desired glycemic range and determining from at least one of a plurality of the data corresponding to the patient's blood glucose-level measurements whether and by how much to adjust at least one of the components in the patient's present insulin dosage regimen.
US11723591B2

A system and method of treating a sleep disorder, including: detecting signals associated with at least one symptom or sign of the sleep disorder at one or more sensors; processing the signals to create a symbolic representation of the sleep disorder, wherein the symbolic representation indicates a relationship of the signals to the sleep disorder empirically and not based on physiologic mapping of the signals to the sleep disorder; and stimulating a region of a human body to alter the symbolic representation between detected signals and the sleep disorder, wherein the symbolic representation as altered indicates treatment of the sleep disorder.
US11723589B2

The present invention generally relates to compositions comprising anesthesia-reversing agents which facilitate or increase the time of awakening or reverse the effects of general anesthesia-induced unconsciousness. In some embodiments, the anesthesia reversing agent can be selected from any or a combination of methylphenidate (MPH), amphetamine, modafinil, amantadine, caffeine, or analogues or derivatives thereof. In some embodiments, compositions comprising at least one or more anesthesia-reversing agents can be used to facilitate awakening from anesthesia without or decreasing occurrence of delirium, and can be used in methods to treat or prevent the symptoms associated with emergence delirium, as well as treat a subject oversedated with general anesthesia. The invention also relates to methods for administering these compositions comprising anesthesia-reversing agents to subjects and for use.
US11723583B2

The present disclosure relates to a device and method for detecting chemicals from tissue, such as skin, comprising at least a first detector (A) and at least a second detector (B), wherein the first detector (A) and the second detector (B) are the same type of detectors. An attachment portion (C3) including at least the first detector (A) and at least the second detector (B) separated by a defined distance, the attachment portion is configured to be attached on the tissue for detection of the chemicals.
US11723581B2

An electromyography (EMG) sensor for a wearable device, such as a prosthetic device attachable to a residual limb, includes a flexible substrate comprising an elongated portion and an electrode portion. At least two electrodes are disposed at a surface of the electrode portion of the flexible substrate, and leads from the at least two electrodes extend through the elongated portion of the flexible substrate.
US11723580B2

The invention discloses an objective and quantitative detection method for amblyopia by electroencephalogram (EEG). The method comprises the following steps: firstly, carry out binocular dichoptic viewing display, then design a visual evoked stimulation paradigm, establish a brain-computer interface platform, build a test interaction interface, next determine an amblyopia EEG quantitative index. By using a suppression coefficient (SI) to describe the binocular suppression relationship, quantify the degree of amblyopia, and finally obtain amblyopia detection result feedback, where the computer interaction interface module presents a final amblyopia detection result to realize feedback of a user. The operation is simple and rapid, the applicability is high, and the indexes are objective and quantitative.
US11723577B2

Techniques are disclosed for explaining and visualizing an output of a machine learning system that detects cardiac arrhythmia in a patient. In one example, a computing device receives cardiac electrogram data sensed by a medical device. The computing device applies a machine learning model, trained using cardiac electrogram data for a plurality of patients, to the received cardiac electrogram data to determine, based on the machine learning model, that an episode of arrhythmia has occurred in the patient and a level of confidence in the determination that the episode of arrhythmia has occurred in the patient. In response to determining that the level of confidence is greater than a predetermined threshold, the computing device displays, to a user, a portion of the cardiac electrogram data, an indication that the episode of arrhythmia has occurred, and an indication of the level of confidence that the episode of arrhythmia has occurred.
US11723574B2

A catheter comprising an elongated catheter body, and an electrode assembly distal of the catheter body, the assembly comprising a plurality of spines, wherein each spine has a distal end that is connected to the distal end of at least one other spine, wherein each spine has an electrode-carrying portion, the electrode-carrying portions of all spines of the assembly being in a single common plane, and wherein all spines of the assembly have a uniform exposed total length.
US11723565B2

A method and transceiver for calibrating an analyte sensor using one or more reference measurements. In some embodiments, the method may include receiving a first reference analyte measurement (RM1) and determining whether the RM1 is unexpected. In some embodiments, the method may include, if the RM1 was determined to be unexpected, receiving a second reference analyte measurement (RM2). In some embodiments, the method may include determining whether one or more of the RM1 and the RM2 are acceptable as calibration points. In some embodiments, the method may include, if one or more of the RM1 and the RM2 are determined to be acceptable as calibration points, accepting one or more of the RM1 and the RM2 as calibration points. In some embodiments, the method may include calibrating the analyte sensor using at least one or more of the RM1 and the RM2 as calibration points.
US11723555B2

The invention provides a seismocardiograph system, which includes an accelerometer, adapted to obtain accelerometer data from user, and a bandpass filter, adapted to filter the accelerometer data. The system further includes an envelope filter, adapted to suppress S2 peaks in the band pass filtered accelerometer data, wherein the envelope filter comprises: a low-pass filter; and a comb filter, wherein the delay of the comb filter is tuned to a left ventricle ejection time (LVET).
US11723553B2

Method and system for detecting and/or quantifying Δ9-tetrahydrocannibinol (THC) in exhaled breath. In one embodiment, the method involves providing an electrochemical sensing element, the electrochemical sensing element including a working electrode, and also providing a filter that traps THC in exhaled breath. Next, a subject exhales onto the filter, whereby at least some of the THC, if present, is trapped in the filter. Next, the filter is washed with an eluent, whereby at least some of the THC trapped in the filter is eluted in an eluate. Next, the eluate is deposited onto the working electrode of the electrochemical sensing element, and the eluate is dried, whereby any THC present is immobilized on the working electrode. Next, an electrolytic solution is delivered to the electrochemical sensing element, and the THC immobilized on the working electrode is directly electrochemically detected and/or quantified using a pulse voltammetry technique, such as square-wave voltammetry.
US11723545B2

Systems and methods to determine an indication of patient dehydration are disclosed, including receiving first and second physiologic information of a patient, the first physiologic information including heart sound information of the patient and the second physiologic information different than the first physiologic information, and determining the indication of patient dehydration using the received first and second physiologic information.
US11723544B2

A hospitalization management system including a heart failure analyzer that receives diagnostic data including at least sensor data representative of one or more physiological signals sensed from a hospitalized patient using one or more sensors and assesses risk of rehospitalization for the patient using the diagnostic data. The outcome of the risk assessment is used during and following the patient's hospitalization for reducing the risk of rehospitalization.
US11723541B2

A method is disclosed for diagnosing and treating a patient having lesions in both arteries of left and right lower limbs. By determining that a lesion distal to an aortailiac bifurcation is to be treated first, catheters and an operation time can be reduced is to be treated first on a priority basis based on diagnostic data, deciding that a lesion proximal to the bifurcation is to be treated next, then treating the lesions substantially continuously.
US11723537B2

Techniques for transmitting diagnostic information stored in an implantable medical device (IMD) based on patient hospitalization are described. For example, the IMD may transmit higher resolution diagnostic information to a clinician and/or an external device during a hospitalization period to aid the clinician in evaluating heart failure treatment and when discharge is proper. This higher resolution diagnostic information may include one or more patient metrics automatically generated and transmitted by the IMD at least once every two hours. During a post-hospitalization period, the IMD may transmit lower resolution diagnostic information to a clinician that indicates a risk level of re-hospitalization. The lower resolution diagnostic information may include the risk level and/or patient metrics once a day, for example. In this manner, the IMD transmitted diagnostic information may be tailored to the specific heart failure monitoring needed by the patient.
US11723536B2

Ophthalmic imaging systems and related methods provide pseudo feedback to aid a user in aligning the user's eye with an optical axis of the imaging system. An ophthalmic imaging system includes an ophthalmic imaging device having an optical axis, a display device, an eye camera, and a control unit. The display device displays a fixation target viewable by the user. The eye camera images the eye to generate eye image data. The control unit processes the eye image data to determine a position of the eye relative to the optical axis, processes the position of the eye relative to the optical axis to generate a pseudo position of the eye relative to the optical axis, and causes the display device to display an indication that provides feedback to the user that the eye is located at the pseudo position of the eye relative to the optical axis.
US11723535B2

The invention relates to a device and a method for examining the retinal vascular endothelial function of the vessels of the retina at the fundus (F) of a patient's eye. Using a fundus camera, the vessels of the retina are stimulated with flicker light during a stimulation phase and sequences of images of areas of the fundus (F) are recorded, from which vascular parameters are derived which describe the retinal vascular endothelial function of the vessels. By imaging a macula stop (MB), which covers the macula, onto the fundus (F), the fundus (F) can be illuminated with a higher light intensity, which improves the stimulation effect and the image quality and/or reduces the strain on the patient.
US11723531B2

Systems and methods for improving the peripheral vision of a subject are disclosed. In one aspect, embodiments of the present disclosure includes a method, which may be embodied on a system, for improving peripheral vision of a subject using a visual marker on a display screen, the method includes, displaying a peripheral target on the display screen, the peripheral target having a visually discernable characteristic and determining whether the subject is able to correctly identify the peripheral target displayed on the display screen using the peripheral vision. The visual marker is intended for viewing using central vision of the subject and the peripheral target is intended for identification using the peripheral vision of the subject.
US11723522B2

The present disclosure relates generally to the field of medical devices and establishing access to body passageways. In particular, the present disclosure relates to devices, systems and methods to facilitate entry of a guidewire or other endoscopic accessory tool into and/or through patient-specific anatomies. For example, the devices, systems and methods of the present disclosure may rotate a proximal end of a guidewire to transmit mechanical motion to the distal end of the guidewire to facilitate atraumatic access to tortuous or otherwise restricted anatomies.
US11723519B2

A device for visualizing and providing suction for a surgical procedure in an ear may include a handle, a main shaft extending from the handle, an imaging sensor at a distal end of the main shaft, a light source at the distal end of the main shaft, and a suction shaft extending from the handle. The device may also include a spring coupled with the suction shaft and/or the handle, such that when the suction shaft is advanced in a distal direction and then released, the suction shaft retracts automatically. The suction shaft may have a distal curved portion, and the device may have a thumb depress portion that allows a user to spin the suction shaft to suction in different directions. Some embodiments may include a suction shaft with a sharp distal tip that is configured for placing an ear tube in the tympanic membrane.
US11723509B2

The disclosure relates to a device for dispensing a cleaning agent into a dishwasher, having a cover element for closing and releasing at least one opening of a store for storing the cleaning agent and/or an operating agent, at least one actuating element being provided which has an actuation path (W) for opening and/or fixing the cover element so that an accidental opening or unlocking is effectively prevented. According to the disclosure this is achieved in that the actuation path (W) is oriented away from the store and transversely to the opening.
US11723506B2

The invention discloses a surface cleaning apparatus comprising: a source of suction; the cleaning head comprises a housing and a cleaning roller. The cleaning head is provided with a cleaning liquid output for applying the cleaning liquid and at least one steam output for applying steam relative to the surface to be cleaned by the rolling brush; wherein the steam outlet steam outlet is arranged at the lower portion of the housing and configured to heat the surface by overflowing the steam to the surface to accelerate the evaporation of residual cleaning liquid on the surface. The apparatus introduces steam for heating the surface, thereby it can accelerate evaporation surface on the residual cleaning solution and shorten user latency.
US11723498B2

An example of a vacuum pod may include a handle, a vacuum pod body, a dust cup removably coupled to the vacuum pod body, and a fluid conduit fluidly coupled to the dust cup. The fluid conduit may include a flexible hose configured to transition between an expanded and a retracted position and a coupling configured to be removably coupled to the vacuum pod body. A first end of the flexible hose may be coupled to the vacuum pod body and a second end of the flexible hose may be coupled to the coupling. When the coupling is coupled to the vacuum pod body, the flexible hose may be in the retracted position.
US11723497B1

A toilet seat lifting system includes a foot-operated bellows connected to a hinged rod which is surrounded by a sleeve. The rod is then extended by the air produced by the bellows and the rod is attached to the toilet seat with adhesive or suction cup. The rod includes a hollow outer rod and an inner rod that is inserted within the outer rod. The outer rod is then sealed against the inner rod through an air tight seal. When the bellows is actuated, air is supplied through the bottom rod and released within the outer rod. Since the outer rod is air tight, the pressure created by the air within the rod forces a latch at the top of the outer rod to open and release the pressure. The opening of the latch in turn actuates the lifting of the toilet seat.
US11723486B2

A beverage dispensing system that can dispense both cold and hot drinks from either cold drink capsules or hot drink capsules. The cold or hot drink capsule is inserted into the system, and the lid is manually closed. if a cold drink capsule has been inserted, a mechanism cracks the capsule along a predetermined seam, injects cold mixing fluid into the capsule, and then rotates the capsule to pour out or further flush out the cold drink into a cup. If a hot drink capsule has been inserted, the lid is closed, and a rotating needle pierces the top of the capsule. The capsule is then punctured from the bottom. Hot water can then be injected into the top of the capsule, and the hot drink can be removed from the bottom into a cup.
US11723481B2

Embodiments of the disclosure are directed to a touchless automatic food locker apparatus, system, and method providing automated self-serve food lockers. Embodiments include arrays of modular food lockers having a public access door and a kitchen access door opposed to each other, assembled as a wall between the public space and the kitchen. Each food locker kitchen access door is adapted to receive a food item disposed into the locker. Heating and cooling elements maintain the appropriate food item temperature in the locker. Sensors, lighting, and UV lighting coupled to the locker detects a state of the item in the locker. The locker further includes credentialed access by the customer to the food locker from the public access door by an assembly coupled to the food locker utilizing mobile communication and intelligent analysis to reduce waiting time, keep food products fresh, and assure quality product delivery.
US11723473B2

The invention relates to a device (5) for supporting and for movably guiding a chair (6) in a slotted guide (8, 8.1, 8.2), which is provided in a housing (7) and is designed as an elongated hole guide, having a carriage (10) that can be moved in the slotted guide (8, 8.1, 8.2) and supports a chair receptacle (9) of the chair (6). In order to be able to use this device in a more varied manner, according to the invention, the slotted guide (8, 8.1, 8.2) has at least two slotted guide tracks (13, 14), between which an adjustable track switch (12) is provided in order to transfer the chair (6) out of the one slotted guide track (13) into the other slotted guide track (14), and vice versa.
US11723470B1

A head support apparatus and method with a wrap with a top, a bottom, a front, a back, a length, an inside and an outside and a first end and a second end. A connector on the first end and the second end where the connector on the first end is connectable with the connector on the second end. Cushion material, with a width, on the inside of the wrap where the cushion material width is greater along the length and front to back than at the first end and second end of the wrap and an indentation in the front of the wrap and in the cushion material such that a user's jaw is supported underneath the jaw and a user's head is laterally supported on two sides when said wrap is placed around a user's neck.
US11723469B2

An ergonomic method for working in confined work spaces is disclosed. The method, in some cases, includes the steps of: a) providing a support structure that is generally in the configuration of a rectangular prism having six faces, a length, width, and a height in which the length, width, and height differ from one another so that the structure provides three different height positions when the support structure is placed on the floor of the workspace; b) placing the support structure with one of its faces in contact with a contoured floor surface in a confined work space; and c) sitting or standing on the support structure.
US11723465B2

A display board, for writing and drawing with an interchangeable whiteboard, blackboard, or electronic surface that is pressure sensitive to a marker, chalk, or stylus through the use of a pressure sensitivity matrix. A software system implemented with the pressure sensitive matrix will be able to learn from the user's natural writing behavior, natural spaces and pauses in writing, and their writing size, and with these metrics, will be able to identify or predict a long pause in the action of writing. When this pause happens, the surface physically shifts upwards through the use of two linear actuators; the shift amount being determined by the user's writing size. The board is also able to shift upwards once the writer progresses to the opposite vertical edge of the drawing surface or can shift either upwards or downwards manually with two buttons on the side of the board.
US11723460B1

A locker includes a pair of spaced-apart upstanding sidewalls and at least one shelf extending between the sidewalls, the shelf and sidewalls defining a compartment. A tray is carried on the shelf in the compartment and supported by a pair of rollers and coupled to a pair of rails mounted on the sidewalls above the shelf, wherein the tray slides forward and backward relative to the shelf and rotates about the rollers.
US11723453B2

A method (200) for manufacturing a brush head (10) includes: (i) positioning (210) a first end (23) of each of a plurality of bristle tufts (21) into a tuft plate (110) comprising a plurality of cavities (120) each configured to receive at least one of the plurality of bristle tufts; (ii) applying (220) a force, via a profile plate (300), to a second end (25) of the plurality of bristle tufts, wherein the profile plate comprises a predetermined shape complementary to a desired profile configuration of the bristle tufts; and (iii) applying (230) heat to each of the first ends of the plurality of bristle tufts, via a die plate (400) comprising at least one cavity (410) configured to receive at least one of the plurality of the first ends, at a temperature sufficient to at least partially melt each of the first ends into the cavity.
US11723443B2

Embodiments of the present disclosure provide a locking assembly for an attachment system of a consumer product. More specifically, embodiments of the present disclosure are directed to an attachment unit that is configured to be inserted and removed from a housing of a consumer product. The attachment unit and/or the housing include an expansion component or other such locking assembly configured to releasably secure the attachment unit within the housing.
US11723432B2

A sole structure for an article of footwear includes a forefoot region disposed adjacent an anterior end, a heel region disposed adjacent a posterior end, and a mid-foot region disposed intermediate the forefoot region and the heel region. The sole structure further includes fluid-filled bladder having a first segment extending along a medial side in the heel region, a second segment extending along a lateral side in the heel region, and a web area disposed between the first segment and the second segment. Additionally, the sole structure includes an outer sole member having an upper portion extending from a first end in the forefoot region to a second end in the heel region. The second end of the outer sole member is received on a first side of the web area. The outer sole member also includes a rib extending downwardly from the upper portion and defining a cavity.
US11723430B2

A shoe comprising an outsole, where the outsole is comprised of a rubber composition comprised of (A) diene-based elastomer comprising: (1) from about 20 to about 45 phr of high Tg SSBR pre-extended with vegetable oil, wherein said SSBR has a Tg in a range of from about −20° C. to about +10° C. and a bound styrene content in a range of from about 25 to about 50 percent and a vinyl 1,2-content in a range of from about 10 to about 80 percent based on butadiene content, (2) from 55 to about 80 phr of at least one additional diene-based elastomer comprising of at least one of polybutadiene, cis 1,4-polyisoprene rubber, and acrylonitrile-butadiene rubber, and (B) about 20 to about 70 phr of reinforcing filler comprised of a combination of carbon black and silica where the filler is comprised of from about 50 to about 100 weight percent silica.
US11723427B1

A method for producing a supporting glove includes the steps of applying a specific amount of a first polymer mixed liquid to a knitted glove; drying the first polymer mixed liquid applied to the knitted glove; applying a coagulant solution to the knitted glove after drying; applying a specific amount of a second polymer mixed liquid to the knitted glove after applying the coagulant solution; and drying the second polymer mixed liquid applied to the knitted glove. A first polymer film is formed to cover a yarn knitted into the knitted glove over the entire thickness direction of at least the part of the knitted glove. A second polymer film is formed to continuously cover the first polymer film to form at least a part of an outer surface and not reaching an inner surface of the knitted glove.
US11723424B2

An active-insulation paneling component and garments including an active-insulation paneling component are disclosed. The active-insulation paneling component includes insulated panels separated by gussets. The gussets are configured to expand upon an outward pulling force to allow the active-insulation paneling component and/or garment to expand even where the active-insulation paneling component and/or garment are not manufactured from elastic materials.
US11723418B2

The present invention is a fistula sleeve for covering and protecting a fistula on the inside of an arm. The sleeve grips the wrist and adjustably and snuggly fits around the wider contours of the arm without imparting pressure on the fistula. The sleeve partially opens to expose the fistula for dialysis and daily care. A narrower wrist region secures around the wrist. An elongated forearm region wraps around the forearm, and a smooth central region covers the fistula. The wrist and forearm regions are independently secured. Securement strips have semi-rigid backings that stiffen the side portions of the sleeve help secure and remove the sleeve with one hand, and form a spine to help maintain the alignment of the sleeve on the arm. A double layer of material is stitched together along its perimeter, while the inner layer is free to slide relative to the outer layer in the smooth central area that engages the fistula. The sleeve stretches laterally to grip and secure around the wrist, while allowing the forearm portion to snuggly fit around the contours of the forearm and accommodate the fistula in a non-pressure generating manner.
US11723414B2

A control method and device, and an electronic cigarette. The method includes: obtaining the maximum output power during the secure output of an atomizer connected to a body; detecting whether the currently-set target power of the atomizer is higher than the maximum output power; and if the target power is higher than the maximum output power, executing a preset operation, the preset operation including at least one of controlling, the atomizer to output at power lower than or equal to the maximum output power and displaying a first reminder message, according to a cigarette lighting signal. The method resolves the problem that dry burning would easily occur in an atomizer, and has the function of protecting the atomizer and preventing the shortening of the life of a heating component caused by the burning of the heating component due to high power output of the atomizer.
US11723408B2

An aerosol-generating device configured to heat an aerosol-forming substrate to form an inhalable aerosol is provided, the aerosol-generating device including a heating chamber configured to heat the aerosol-forming substrate, the heating chamber including a first end having an opening, a second end having a base, and a side wall extending between the opening and the base, a cavity being defined by inner surfaces of the base and the side wall, and a peripheral portion of the base being contoured to provide a chamfered or filleted intersection between the inner surfaces of the base and the side wall; a heating assembly; and a power supply.
US11723405B2

A liquid storage tank of an electronic vapor provision device includes one or more boundary walls defining an interior volume of the tank for accommodating source liquid to be vaporized in the electronic vapor provision device; and one or more baffles, each baffle protruding from an inner surface of the boundary wall into the interior volume to impede a flow of source liquid between portions of the interior volume between which the baffle is located. The tank may be included in an electronic vapor provision device or in a component for an electronic vapor provision device such as a cartomizer.
US11723397B2

The techniques disclosed in the present specification relate to devices, systems, and methods using the same that generate cigarette smoke and then separate and collect substances of the cigarette smoke generated into particulate and gaseous substances for the preparation of a whole cigarette smoke condensate, which may comprise: a cigarette mount on which one or more cigarettes are mounted; an automatic ignition device for igniting the one or more cigarettes; a cigarette smoke collection unit for collecting substances of cigarette smoke generated from the ignited one or more cigarettes; one or more cigarette smoke intake lines configured to suck the cigarette smoke; one or more cigarette smoke exhaust lines configured to discharge the cigarette smoke; and one or more collection unit connecting lines connected to the cigarette smoke collection unit.
US11723395B2

Encapsulated tobacco beads and processes of making the encapsulated tobacco beads are disclosed. According to an embodiment, a process of making encapsulated tobacco beads comprises mixing tobacco particles and menthol in an aqueous solution to form a wet mass; extruding the wet mass to form extrudates; spheronizing the extrudates to form tobacco beads; drying the tobacco beads; contacting the beads with a solution comprising a cation; and introducing the contacted tobacco beads into a solution of coating material in a concentration effective to induce ionic gelation of the coating material around the beads, to form encapsulated tobacco beads having gel coatings. According to another embodiment, an encapsulated tobacco bead comprises a core comprising tobacco particles and encapsulated menthol, an inner coating layer comprising hydroxypropyl methylcellulose or pectin, and an outer coating layer comprising an ionically-crosslinked gel.
US11723387B2

Novel cultivars of Stevia rebaudiana plant, with a novel genetic trait of self-compatibility, and the advantageous use of this genetic trait in Stevia rebaudiana crossing breeding for increasing steviol glycosides production, including food and beverage products and other consumables, are disclosed.
US11723382B2

The present invention aims to provide feedstuffs for ruminants with high nutritional value and high digestion efficiency. According to the present invention, feed pellets for ruminants containing a kraft pulp derived from a lignocellulosic material are provided, wherein the kraft pulp has a Canadian standard freeness of less than 400 ml.
US11723377B2

Described herein are methods of sanitizing and preserving produce and other agricultural products, for example for consumption as Ready-to-Eat. The methods can comprise treating the products with a sanitizing agent and forming a protective coating over the products.
US11723367B2

An anti-microbial formulation for seed and crop application includes about 170 ppm hypochlorous acid; about 25 ppm hypochlorite ion; about 2.5 ppm ozone; about 2.5 ppm chlorine dioxide; between about 10 ppm and about 100,000 ppm alkyl polyglycoside; and a remainder of water. A method of manipulating the pH of the formulation and a method of treating seeds and crops with the formulation to restrict or eliminate microbial growth and proliferation is also described herein.
US11723357B2

The disclosure provides, in various embodiments, systems, devices and methods relating to ex-vivo organ care. In certain embodiments, the disclosure relates to maintaining an organ ex-vivo at near physiologic conditions. In certain embodiments, the disclosure relates to testing properties of an ex-vivo heart or an organ care system, adjusting a property of the organ care system in response to certain results of the testing, and re-testing the ex-vivo heart or the organ care system. In certain embodiments, the disclosure relates to synchronizing at least one cycle of a pumping of a perfusion fluid with a state of the ex-vivo heart.
US11723356B2

A method of repelling mosquitos from a locality or proximity where humans or animals will be present and/or inhibiting the mosquito from seeking a blood meal, may include positioning lighting at a location and in an orientation that will at least one of generate a photo-taxis repellent response and inhibit blood seeking by the mosquito, such that the mosquito at least one of (i) may be discouraged from entering a defined zone which the lighting protects, and (ii) may have a reduced tendency to seek a blood meal within the zone. The lighting may be LED lighting and may generate an intense light of at least 100 lux, with a colour temperature of greater than 5000K and may have a cool white spectra with two peaks, a first peak at about 450 nm-470 nm and a second peak at about 500 nm-700 nm.
US11723352B2

A fishing rod according to one embodiment includes a rod body extending in a front-and-back direction along a central axis, a fitting having a mounting part, where the mounting part is mounted on an outer peripheral surface of the rod body at a first position determined in a circumferential direction around the central axis, and a fiber-reinforced resin layer surrounding the rod body so as to cover the mounting part. The fiber-reinforced resin layer has a first portion covering the rod body along an entire length thereof in the circumferential direction around the central axis and a second portion extending in the axial direction backward from an axially back end of the first portion and extending in the circumferential direction less than 180° clockwise from the first position and also less than 180° anti-clockwise from the first position.
US11723342B2

A composition comprising lignocellulosic fibrous material for horticultural use is provided having one or more solvents and a fiber, wherein the fiber has been processed by ruminant digestion and anaerobic digestion. A method for preparing a composition comprising lignocellulosic fibrous material for horticultural use is also disclosed including the steps of providing excrement from a ruminant which has undergone ruminant digestion, introducing the ruminant excrement into an anaerobic digester, modifying the ruminant excrement to a first wet product, modifying the first wet product to generate a first dry product, and densifying the first dry product to, in turn, generate the composition comprising lignocellulosic fibrous material for horticultural use.
US11723328B2

A hydroponic tower cleaning and debris removal system is provided that is configured to automatically clean and remove plant and material debris from within a hinged, hydroponic tower as well as the plant containers contained within such a hydroponic tower. The hydroponic tower cleaning system utilizes a drive system to force the tower through the apparatus; an alignment system to ensure that the tower remains in proper alignment throughout the cleaning process; a brush system that initiates separation of plant debris from the tower/plant containers and ensures that the plant roots are torn apart; a plunger system to eject plant debris from within the plant containers; an air delivery system to blow away the debris; and rollers to maintain tower face alignment during the cleaning process.
US11723327B2

A system for providing a growth environment for a plant positioned in an automated plant growing system is disclosed. Light sources with each light source positioned in the automated plant growing system to expose the plant to the light sources and to generate light to trigger photosynthesis in the plant. A controller that monitors a growth parameters associated with the plant to determine whether the growth parameters deviate beyond a corresponding growth threshold. Each of the growth parameters provides an indicator as to a growth status of the plant and the growth status of the plant decreases when the growth parameters deviate beyond the corresponding growth threshold. The controller automatically adjusts an environmental parameter when the growth parameters deviate beyond the growth thresholds. Each of the environmental parameters impact the growth environment of the plant positioned in the automated plant growing system.
US11723320B2

In one embodiment of an arbor stake stabilization member, a body includes an annular ring of a biodegradable material having an axial passageway therethrough. A locking member is coupled to the annular ring and extends radially inward into the axial passageway. A plate of a biodegradable material extends circumferentially outwardly from the annular ring. The perforated plate includes multiple openings. In use, the arbor stake stabilization member may be placed underground and on or above a rootball of a tree. The locking member is sized to accept an arbor stake therethrough in an interference fit. The arbor stake may extend from the top of the rootball through the rootball and into the undisturbed soil at a point below the rootball. Over time, the arbor stake stabilization member biodegrades.
US11723315B2

A method for promoting the accumulation of cannabinoid substances is disclosed. The method comprises the step of adding an irradiation of green light, which has a peak wavelength at 505-526 nm, into the indoor growing environment of cannabis to improve the levels of tetrahydrocannabinol (THC) and cannabidiol (CBD), cannabinoid substances in cannabis. While maintaining the light intensity and other growth conditions, the yields and/or levels of THC and CBD, cannabinoid substances in cannabis, can be increased by up to 21.35%.
US11723313B2

An electric pole pruner having a spring returned cutting head and equipped with a drive unit having an electric motor coupled to a drum via an epicyclic gear assembly is configured to reduce rotation speed and to increase torque. A string element is coupled to the drum of the drive unit, and to the cutting head so as to actuate the cutting head. The pole pruner further includes a locking arrangement to selectively lock or release a ring gear of the gear assembly so as to convert rotation of the electric motor into rotation of the drum when the ring gear is locked, and to convert rotation of the drum into rotation of the ring gear when the ring gear is released.
US11723310B2

An agricultural machine includes a hitching support, at least one tool or group of tools, at least one support arm which is connected to the hitching support by a first joint and to the tool or tool group, and which is mounted so as to pivot about a transfer axis between operational and raised positions, and a safety device making it possible to carry out a safety movement under the effect of pressure. The safety device includes a lift connected to the hitching support by a second joint. The second joint is offset relative to the first joint in the direction of travel. The safety movement can include a second movement phase during which the lift is able to move the tool or the group of tools away from the ground.
US11723300B2

A biasing system for use with an associated run selector device includes a valve body member movable within a housing between opposite first and second run selection positions selecting respective first and second commodity distribution runs of the associated run selector device. The biasing system includes a first biasing element on the housing, and a second biasing element on the valve body member. The first and second biasing elements are movable relative to each other between opposite first and second biasing system positions together with the associated valve body member being moved relative to the housing between the opposite first and second run selection positions. The first and second biasing elements are mutually biased against each other to urge each other apart and towards a one or the other of the opposite first and second biasing system positions.
US11723299B2

A closing wheel assembly for a seed row planter unit resides behind the gauge wheel assembly and furrow disks of the planter unit. The closing wheel assembly includes a coupler with a pair of closing wheels mounted thereon. A single pin removably extends through the coupler and through the gauge wheel assembly to detachably mount the closing wheel assembly to the gauge wheel assembly. Different closing wheel assemblies can be quickly mounted on the row unit, depending upon the type of seed being planted. The closing wheels are laterally adjustable via a rotatable threaded bushing so as to be centered behind the furrow disks.
US11723298B2

The present invention relates to the efficient use of application agents in the cultivation of crop plants. Based on application-agent-specific information and information on a partial-area-specific requirement of a field for the application agent, a partial-area-specific and application-agent-specific application map is prepared that indicates for individual partial areas of the field whether and how the application agent is to be used.
US11723297B2

In the case of a soil cultivation device with multiple harrow tines, the harrow tines are fastened to levers, which are mounted to pivot on tie bars of the supporting frame via carriers. The operating position of the harrow tines is defined by the levers being adjacent to tie bars, and the harrow tines are prestressed into the operating position by springs assigned to them in the form of pneumatic cylinders.
US11730069B2

The present disclosure includes memory cell structures and method of forming the same. One such method includes forming a memory cell includes forming, in a first direction, a select device stack including a select device formed between a first electrode and a second electrode; forming, in a second direction, a plurality of sacrificial material lines over the select device stack to form a via; forming a programmable material stack within the via; and removing the plurality of sacrificial material lines and etching through a portion of the select device stack to isolate the select device.
US11730065B2

Provided is a magnetic device including a conductive layer extended in a first direction and providing a spin Hall effect on a placement plane defined by the first direction and a second direction, a free layer disposed on the conductive layer, a fixed layer disposed on a portion of the free layer, a tunnel barrier layer disposed between the free layer and the fixed layer, a first electrode disposed on the fixed layer, a first charge storage layer disposed on the free layer so as not to overlap the fixed layer, and a first gate electrode disposed on the first charge storage layer. The first electrode and the first gate electrode are arranged in the second direction.
US11730061B2

A transducer (140) having a mechanical impedance over an operative frequency range and having a desired power coupling (145) to a load over the operative frequency range comprises a piezoelectric device (141) having a frequency distribution of modes in the operative frequency range; and an overmould (143). The overmould (143) is arranged to surround at least part of the piezoelectric device (141); and the parameters of the overmould (143) are selected to provide a required impedance matching between the mechanical impedance of the transducer (140) and the mechanical impedance of the load. An alternative transducer comprises a mounting means for holding a discrete portion of at least a part of the periphery of the piezoelectric device wherein the parameters of the mounting means are selected to provide a required boundary condition for the periphery of the piezoelectric device whereby the desired power coupling between the transducer and the load is provided.
US11730055B2

A compound of formula (I): (Core)n-(X)m wherein Core is a core group; n is 0 and m is 1, or n is 1 and m is at least 1; and X is a group of formula (II): wherein: R1, R3 and R5 are each independently H or a substituent; R2 and R4 are each a substituent; one of R1-R5 is a direct bond or divalent linking group linking the group of formula (II) to Core in the case where n is 1; x and y are 0, 1, 2, 3 or 4; and the compound of formula (I) is substituted with at least one ionic substituent. The compound may be used as an n-dopant to dope an organic semiconductor.
US11730053B2

According to one or more embodiments, an organic light-emitting device includes: a first electrode; a second electrode; and an organic layer between the first electrode and the second electrode. The organic layer includes an emission layer. The organic layer may include a first compound represented by Formula 1 and a second compound represented by one selected from Formulae 2-1 to 2-4:
US11730049B2

A display device having a display area and a non-display area disposed in the vicinity of the display area and including a bending area, the display device includes: a substrate; a first organic insulating layer disposed on the substrate; and a trench structure disposed in the non-display area, the trench structure including sidewalls formed by the first organic insulating layer and a bottom surface located in the bending area, wherein the bending area is disposed on a side of the display area.
US11730042B2

The display device includes a substrate, a display region arranged on the substrate and including a plurality of pixels, a first wiring provided on the substrate, an insulating layer overlapping a portion of the first wiring, an oxide conductive layer provided on the first wiring and electrically connected to the first wiring, a sealing layer overlapping the display region and at least an end of the oxide conductive layer and sealing the plurality of pixels, a sensor electrode provided on the sealing layer and overlapping the display region, and a second wiring passing over the at least end of the oxide conductive layer provided with the sealing layer and electrically connecting the sensor electrode and the oxide conductive layer.
US11730032B2

A display device includes: a base layer comprising a top surface, a bottom surface opposite the top surface, and a plurality of side surfaces connecting the top surface and the bottom surface, wherein a display area and a non-display area adjacent to the display area are defined; an outer line overlapping the non-display area, on the top surface, and adjacent to any one of the plurality of side surfaces; a light emitting element layer overlapping the display area, on the top surface, and comprising a light emitting element; and a connection line connecting the outer line and the light emitting element, wherein the outer line comprises a center line extending from the connection line in a first direction and a branch line extending from the center line in a second direction crossing the first direction.
US11730030B2

A display device includes: pixel circuits in a display area, the pixel circuits each comprising a thin film transistor and a capacitor, the thin film transistor including a semiconductor layer and a gate electrode on the substrate and the capacitor including a first capacitor plate and a second capacitor plate; signal lines electrically connected to the pixel circuits, the signal lines passing through the display area; a lower metal layer between the substrate and at least one of the pixel circuits; a pad portion in the peripheral area; and a plurality of wirings in the peripheral area, the plurality of wirings electrically connecting the pad portion to the signal lines, wherein the plurality of wirings further comprise: a first wiring at a same layer as the lower metal layer; and a second wiring above the first wiring with a first insulating layer between the first wiring and the second wiring.
US11730006B2

Disclosed are an organic light emitting device and a display device using the same in which a light emitting layer includes a host and a plurality of dopants. In the light emitting layer, energy is transferred from a host and other dopants to one dopant by energy transfer system, thus it is possible to increase luminous efficacy of a single color and to increase lifetime of emission.
US11729981B2

The present technology provides a semiconductor device and a method of manufacturing the same. The semiconductor device includes a channel structure, insulating structures surrounding the channel structure and stacked to be spaced apart from each other, interlayer insulating films surrounding the insulating structures, respectively, and a gate electrode extending from between the interlayer insulating films to between the insulating structures and surrounding the channel structure. The insulating structures may include protrusion portions extending to cover edges of the interlayer insulating films facing the channel structure, and the gate electrode may extend between the protrusion portions which are adjacent to each other.
US11729980B2

A method addresses low cost, low resistance metal interconnects and mechanical stability in a high aspect ratio structure. According to the various implementations disclosed herein, a replacement metal process, which defers the need for a metal etching step in the fabrication process until after all patterned photoresist is no longer present. Under this process, the conductive sublayers may be both thick and numerous. The present invention also provides for a strut structure which facilitates etching steps on high aspect ratio structures, which enhances mechanical stability in a high aspect ratio memory stack.
US11729970B2

Numerous embodiments for reading a value stored in a selected memory cell in a vector-by-matrix multiplication (VMM) array in an artificial neural network are disclosed. In one embodiment, an input comprises a set of input bits that result in a series of input pulses applied to a terminal of the selected memory cell, further resulting in a series of output signals that are summed to determine the value stored in the selected memory cell. In another embodiment, an input comprises a set of input bits, where each input bit results in a single pulse or no pulse being applied to a terminal of the selected memory cell, further resulting in a series of output signals which are then weighted according to the binary bit location of the input bit, and where the weighted signals are then summed to determine the value stored in the selected memory cell.
US11729969B1

A semiconductor device and a method of operating the same are provided. The semiconductor device includes a transistor and a fuse structure electrically connected to the transistor. The fuse structure includes a first fuse element, a second fuse element, and a fuse medium. The second fuse element at least partially overlaps the first fuse element. The fuse medium connects the first fuse element and the second fuse element. The fuse medium includes an electrically conductive material.
US11729966B2

A DRAM device includes an isolation region defining source and drain regions in a substrate, a first bit line structure connected to the source region, a second bit line structure disposed on the isolation region, an inner spacer vertically extending on a first sidewall of the first bit line structure, an air gap is between the inner spacer and an outer spacer, a storage contact between the first and second bit line structures and connected to the drain region, a landing pad structure vertically on the storage contact, and a storage structure vertically on the landing pad structure. The sealing layer seals a top of the first air gap. The sealing layer includes a first sealing layer on a first sidewall of a pad isolation trench, and a second sealing layer on a second sidewall of the pad isolation trench and separated from the first sealing layer.
US11729961B2

Asymmetric, semiconductor memory cells, arrays, devices and methods are described. Among these, an asymmetric, bi-stable semiconductor memory cell is described that includes: a floating body region configured to be charged to a level indicative of a state of the memory cell; a first region in electrical contact with the floating body region; a second region in electrical contact with the floating body region and spaced apart from the first region; and a gate positioned between the first and second regions, such that the first region is on a first side of the memory cell relative to the gate and the second region is on a second side of the memory cell relative to the gate; wherein performance characteristics of the first side are different from performance characteristics of the second side.
US11729960B2

A semiconductor device with a large storage capacity per unit area is provided. A semiconductor device includes a memory cell. The memory cell includes a first conductor; a first insulator over the first conductor; a first oxide over the first insulator and including a first region, a second region, and a third region positioned between the first region and the second region; a second insulator over the first oxide; a second conductor over the second insulator; a third insulator positioned in contact with a side surface of the first region; and a second oxide positioned on the side surface of the first region, with the third insulator therebetween. The first region includes a region overlapping the first conductor. The third region includes a region overlapped by the second conductor. The first region and the second region have a lower resistance than the third region.
US11729959B2

Disclosed is a mounting substrate manufacturing system including: a component mounting system including: a component mounting device; a housing body stocker that stores a housing body; a component supply device that pulls out a carrier tape from the housing body stored in the housing body stocker and transports the carrier tape to the component mounting device; and a replacement device that includes an end effector for holding the housing body, and replaces the housing body stored in the housing body stocker, wherein the housing body stocker includes at least a pair of partition members that partition a storage space for storing the housing body, at least one of the partition members adjacent to each other includes an assist portion that assists a replacement operation of replacing the housing body, and the replacement device recognizes a position for a replacement operation by bringing the end effector or the housing body held thereby into contact with the assist portion.
US11729954B2

A system for providing continuous cooling to a storage rack, including a storage rack, including a first storage node and a second storage node; a first cooling loop including a first cooling distribution unit (CDU); a second cooling loop including a second cooling distribution unit (CDU); a first inlet switching valve coupled between the first storage node and each of the first and the second CDUs; a second inlet switching valve coupled between the second storage node and each of the first and the second CDUs; wherein, when the first cooling loop experiences a failure, a state of the first inlet switch and a state of the second inlet switch is adjusted to i) prevent the first CDU from providing cooling of the first storage node and the second storage node, ii) allow only the second CDU to provide cooling of the first storage node and the second storage node.
US11729953B2

A cooling system includes an inlet port and an outlet port to be coupled to one or more electronic devices, a main loop having a heat exchanger coupled to the inlet port and the outlet port, and a buffer loop coupled to the inlet port and the outlet port. The main loop having a heat exchanger to receive fluid from the inlet port, to extract heat generated by the electronic devices and carried by the fluid, and to return the fluid to the electronic devices via the outlet. In an embodiment, a cooling system includes a buffer loop, configured in parallel with the main loop, with a buffer unit to temporarily buffer at least a portion of the fluid, and a first pressure controllable valve, coupled to the main loop and the buffer loop, to selectively distribute at least a portion of the fluid to at least one of the main loop or the buffer loop based on a fluid pressure of the fluid. In an embodiment, a cooling system includes a bypass loop coupled between the first pressure controllable valve and the outlet port to operate as a direct bypass loop from the inlet port to the outlet port, bypassing the heat exchanger and the buffer unit. Pressure is measured and used for controlling those loops under different working scenarios.
US11729951B2

A cooler device includes a cold plate and a manifold with fluid wicking structure. The cold plate includes an array of bonding posts and an array of fluid channels. Each bonding post of the array of bonding posts has a first height and is in contact with the manifold with fluid wicking structure. Each fluid channel of the array of fluid channels has a second height that is less than the first height. The array of fluid channels include a MIO secondary wick structure. The array of bonding posts is orthogonal to the array of fluid channels. The manifold with fluid wicking structure includes a plurality of spacer elements and a plurality of mesh layers. Each one of the plurality of spacer elements alternate with each one of the plurality of mesh layers in a stacked arrangement.
US11729942B2

A light sintering device is provided. The light sintering device can comprise: a housing having, therein, a cooling hollow portion in which cooling water flows; a beam guide mounted on one side of the housing so as to form one wall of the cooling hollow portion, and guiding sintered light; and an optical filter mounted on the other side of the housing so as to face the beam guide, thereby forming the other wall of the cooling hollow portion, and filtering out a specific wavelength of the sintered light.
US11729939B2

A cooling assembly includes a panel defining an opening, a cooling unit including an output and coupled to the panel such that the output at least partially covers the opening of the panel, and spring-loaded latch assemblies coupled to the panel and configured to couple the cooling assembly to an enclosure.
US11729937B2

An environment detecting module, for securing a shell of a server, includes a sensing module, configured to sense an environment status by a polling method and generate a sensing signal according to the environment status; a connection module, configured to electrically connect the environment detecting module to a host terminal with a first connection status or a second connection status; and a microcontroller unit, coupled to the sensing module and the connection module, configured to determine a power source of the environment detecting module according to the first connection status or the second connection status, and to determine a first mode or a second mode of the environment detecting module according to the power source.
US11729932B2

An example of a foldable display device includes a display panel having a first area, a second area, and a foldable area therebetween; a first support plate supporting the first area of the display panel; a second support plate supporting the second area of the display panel; a central support disposed under the foldable area of the display panel and configured to move vertically; a first peripheral support slidable while supporting the first support plate; a second peripheral support slidable while supporting the second support plate; and a hinge body disposed under the central support. The central support ascends toward the display panel during an unfolding operation and descends toward the hinge body during an in-folding operation. The first peripheral support and the second peripheral support move toward the central support during the unfolding operation, and move away from the central support during the in-folding operation.
US11729931B2

A metrology device includes a housing, a lower support structure, a PCB coupled to the lower support structure, and a cover coupled to the lower support structure and the housing. The housing supports the cover in three coordinate directions. The lower support structure includes a first pillar that supports the PCB and mechanically couples with the cover. The first pillar causes the PCB to stand off from the lower support structure and causes the cover to stand off from the PCB. The metrology device also includes a second pillar that extends from the lower support structure to a base to cause the lower support structure to stand off from the base. The cover has a non-circle shape, and a cross section of the housing at a same elevation of the housing as an elevation of the cover within the housing is a circle.
US11729925B2

A mounting bracket for electrical boxes that can include a mounting body with a plurality of mounting features. The plurality of mounting features can include a first set of mounting openings that can have respective elongate directions extending in parallel. The mounting body can have a mounting body axis extending across a shortest between opposing first and second sides of the mounting body. The elongate directions of the first set of mounting openings can be disposed at an acute angle relative to the mounting body axis. The first set of mounting openings can be configured to receive a plurality of fasteners to attach the mounting bracket to a first electrical box.
US11729924B2

A display apparatus includes a display, a housing including a peripheral portion having a first side to which the display is attached, a back plate attached to s second side of the peripheral portion of the housing, and a plurality of double-sided adhesive tapes attached to the peripheral portion. Each of the plurality of double-sided adhesive tapes includes an end portion having an opening. The peripheral portion includes an adhesive-applied region applied with adhesive and a region not applied with the adhesive, and the adhesive-applied region extends from the opening in one of the plurality of double-sided adhesive tapes to the opening in the adjacent one of the plurality of double-sided adhesive tapes.
US11729920B2

A display device including: a display panel configured to display an image; and a winder configured to fix a first end portion of the display panel thereinto, wherein the winder includes a first fixing portion including a first external surface which is curved, and a second fixing portion that includes a second external surface which is curved and that faces the first external surface, wherein the first end portion of the display panel may be interposed between the first external surface and the second external surface.
US11729917B2

A method for optimized filling holes and manufacturing fine lines on a printed circuit board (PCB) carries out the two processes separately. The inner wall of the hole is metalized with reduced graphene oxide (rGO) and then electroplated to fill the hole with copper. The processes are individually performed and thus operating parameters are considered independently. As a result, the copper-plating fillings are evenly compact and the fine lines have square profiles.
US11729893B2

A fracturing well site system includes an electric-driven apparatus, a fuel-driven apparatus, an electric-power supply apparatus and a grounding system. The grounding system includes a first grounding terminal which is spaced from each of the electric-driven apparatus, the fuel-driven apparatus and the electric-power supply apparatus by a preset distance. The fuel-driven apparatus and at least one of the electric-driven apparatus and the electric-power supply apparatus are connected to the first grounding terminal, and the first grounding terminal is configured to ground the fuel-driven apparatus and the at least one of the electric-driven apparatus and the electric-power supply apparatus.
US11729892B2

A control device includes a plurality of buttons having a backlight or indicia indicating a function of the buttons. Each button has a button body that is translucent and configured to be backlit by a lighting element. A front surface of the button body is opaque outside of the area of the indicia. The button body has a post that extends from a rear surface of the button body and is aligned with an actuator. Selection of a button by a user, such as by pressing the button, results in the selected button displaying a greater illumination intensity than the other buttons.
US11729891B2

Disclosed is a method for controlling a plurality of wireless lighting devices. In an example embodiment of the present disclosure, the method includes the steps of: acquiring coordinate information having the plurality of wireless lighting devices mapped to coordinate values of a coordinate system; generating lighting control information indicating a response of at least one of the plurality of wireless lighting devices to produce a lighting shape of the coordinate system; and transmitting the lighting control information, wherein the lighting control information includes response information and function information, the response information indicates a lighting response of the wireless lighting device, and the function information indicates a response or non-response of the at least one wireless lighting device based on the coordinate values.
US11729885B2

The present disclosure relates to a driving circuit individually performing drive control of light-emitting elements having cathodes with the same potential. The driving circuit includes driving circuit units provided in one-to-one correspondence with the light-emitting elements. Each driving circuit unit includes a switching element, a first energy-storage element, a current-control element, and a current-interrupting element. The current-control element connects in parallel to the semiconductor light-emitting element. In the first energy-storage element, a first electrode connects to a first node, and a second electrode connects to a first constant-potential line. In the switching element, a first current terminal connects to a second electrode, and a second current terminal connects to a second node. The second nodes connect to the second constant-potential line without short-circuiting each other by the current-interrupting element. The current-interrupting element interrupts or suppresses current during a period in which the switching element is in ON-state.
US11729882B2

If there is an interruption of power to an electrical load while the electrical load is operating at low end, the electrical load may not turn back on when power is restored. This undesired operation may be avoided by detecting the application of power to the electrical load, and automatically increasing the magnitude of a control signal being applied to the electrical load by a sufficient amount for a short period of time after power has been applied. This way, the electrical load may be turned back on to low end, instead of erroneously operating in an electronic off condition.
US11729881B2

A lighting device driving circuit with high operating efficiency is provided, which includes a rectifying module, a constant-voltage module, an input signal collecting module, a constant-voltage signal collecting module and a constant-voltage control module. The rectifying module receives a power signal from a power source input terminal to generate a rectified voltage signal. The constant-voltage module receives the rectified voltage signal to generate a constant-voltage signal. The input signal collecting module receives the power signal or the rectified voltage signal to generate a first feedback signal. The constant-voltage signal collecting module receives the first feedback signal and the constant-voltage signal to generate a second feedback signal. The constant-voltage control module generates a control signal according to the second feedback signal so as to control the constant-voltage module to adjust the constant-voltage signal and drive a load.
US11729870B2

An apparatus and method for electromagnetic heating of a hydrocarbon formation. The apparatus includes an electrical power source; at least one electromagnetic wave generator for generating alternating current; at least two transmission line conductors positioned in the hydrocarbon formation; at least one waveguide for carrying the alternating current from the at least one electromagnetic wave generator to the at least two transmission line conductors; and a producer well to receive heated hydrocarbons from the hydrocarbon formation. The transmission line conductors are excitable by the alternating current to propagate a travelling wave within the hydrocarbon formation. At least one of the transmission line conductors include a primary arm and at least one secondary arm extending laterally from the primary arm. The at least one secondary arm includes at least one electrically isolatable connection for electrically isolating at least a portion of the secondary arm.
US11729867B2

An induction heating type cooktop includes an upper plate coupled to a top side of a case and configured to place an object to be heated on a top of the upper plate, a working coil disposed inside the case to heat the object, a thin film disposed on at least one of a top surface or a bottom surface of the upper plate, an insulator disposed between the bottom surface of the upper plate and the working coil, and a temperature sensor configured to measure a temperature of at least one of the thin film or the upper plate by a plurality of thermocouples.
US11729852B2

A method for a control device to control a connection between a first device and a second device using short-range wireless communication, the method comprising: transmitting, to the first device, a first message including a first operation code for reconnection after an initial connection between the first device and the second device is established, wherein the first operation code includes a first code instructing storage of an address of the second device in a first white list including addresses of devices connected to the first device at least once; transmitting, to the second device, a second message including a second operation code for the reconnection, wherein the second operation code includes a second code instructing storage of an address of the first device in a second white list including addresses of devices connected to the second device at least once; and instructing the first device and the second device to form a connection between the first device and the second device, wherein each of the first white list and the second white list includes addresses of devices connected without the control device when a connection is released after the initial connection.
US11729848B2

This disclosure provides mechanisms for User Equipment, UE, capability signaling and coordination for Long Term Evolution (LTE) and New Radio (NR) tight-interworking without increasing the complexity of LTE capability reporting. This disclosure proposes a capability signaling and coordination framework in order to coordinate at least band combinations and Layer 2 buffer capabilities across the master and the secondary nodes which are of different Radio Access Technologies (RATs), such as LTE and NR.
US11729829B2

This application discloses a communication method. The method includes: comparing, by a second transmit end device, a second bandwidth carrying at least one second service transmission and a first bandwidth, wherein the first bandwidth is used by a first transmit end device within a first specified time period on an unlicensed frequency band to complete first service transmission, the at least one second service transmission started in a remaining time period of the first specified time period after the first service transmission is completed; performing channel listening on the second bandwidth based on a result of the comparison; and performing, by the second transmit end device, the second service transmission on the second bandwidth if the second bandwidth is found to be in an idle state. In addition, a corresponding transmit end device is disclosed. This application discloses a channel listening mechanism applicable to a flexible-bandwidth scenario.
US11729822B2

A method for transmitting and receiving a signal in a wireless communication system and a device supporting same, according to one embodiment of the present invention, comprise: receiving information for a PUSCH starting symbol #K; and transmitting a PUSCH in a predetermined position on the basis of the result of carrying out a CAP. The predetermined position is determined on the basis of a parameter related to the length of a CPE, and the length of the CPE is less than or equal to the length of an OFDM symbol.
US11729816B2

In an aspect of the disclosure, a method, a computer-readable medium, and an apparatus are provided. The apparatus may be a UE. The apparatus may be a UE. The UE determines to transmit a preamble sequence to a base station at a random access occasion in a random access procedure when the UE is in a connected state. The UE determines that the random access occasion is in a same predetermined time period as an uplink channel or a sounding reference signal that is scheduled to be transmitted to the base station. The UE refrains from transmitting the preamble sequence or refraining from transmitting the uplink channel or the sounding reference signal.
US11729802B2

The present disclosure provides techniques for addressing switching times of Integrated Access and Backhaul (IAB) child nodes. For example, a parent IAB node may determine a switching time for the child IAB node to switch from transmitting on a backhaul/uplink to a parent node (with transmit power control) to transmitting on an access/downlink to a user equipment (UE) or other child IAB node. The parent IAB node may then configure the IAB child node according to the determined switching time (e.g., by scheduling the IAB child node accordingly or setting one or more timing advance parameters).
US11729797B2

A UE in a wireless communication system is provided. The UE comprises a transceiver configured to receive SS/PBCH block over downlink channels using a set of parameters based on an operation mode. The operation mode is configured for the SS/PBCH block as a first operation mode in which the SS/PBCH block is used on a LAA Scell or a second operation mode in which the SS/PBCH block is at least used on a Pcell. The set of parameters is configured as a first set of parameters for the SS/PBCH block when the operation mode of the SS/PBCH block is configured as the first operation mode or a second set of parameters for the SS/PBCH block when the operation mode of the SS/PBCH block is configured as the second operation mode. The first and second set of parameters include different information each other.
US11729782B2

Systems, apparatuses, methods, and computer-readable media are provided for uplink beam management and power control in wireless communications systems. Disclosed embodiments include beam management and power control enhancements for Physical Uplink Shared Channel (PUSCH), Sounding Reference Signal (SRS), and Physical Uplink Control Channel (PUSCH) transmissions. Other embodiments may be described and/or claimed.
US11729777B2

Disclosed are a channel detection apparatus and method, as well as a user equipment and a base station comprising the channel detection apparatus. The channel detection apparatus is used for performing channel detection over a plurality of carriers in an unlicensed frequency band, and comprises at least one processing circuit. The plurality of carriers comprise a first carrier and a second carrier. The processing circuit is configured to: perform channel detection of whether a channel is idle on the first carrier; and trigger, when it is detected that the channel is occupied during the channel detection on the first carrier, channel detection of whether a channel is idle on the second carrier.
US11729771B2

Methods, systems, and devices for wireless communications are described. A base station may determine a default operating mode based on the geographic location (e.g., zone) of the base station, for user equipment (UEs) operating in that zone to use. The operating mode may be a full duplex (FD) operating mode or a half duplex (HD) operating mode. A UE operating in the zone may receive, from the base station, an indication of the default operating mode corresponding to the zone, and may select an operating mode based on the indication. The mode selected by the UE may be the same as or different than the indicated default operating mode. For example, the UE may determine to use either FD mode or HD mode based on operation parameters, interference measurements, signaling from a base station or other UEs, one or more measurement thresholds, or some combination thereof.
US11729769B2

Methods, systems, and devices for wireless communications are described. A user equipment (UE) may receive a configuration for a group-common physical downlink shared channel (PDSCH), where the group-common PDSCH is repeated for a number of repetitions. Accordingly, the UE may determine this number of repetitions and then monitor for the group-common PDSCH based on the number of repetitions. In some implementations, the group-common PDSCH may include a semi-static repetition scheme, where the number of repetitions is indicated via a group aggregation factor. Additionally or alternatively, the group-common PDSCH may include a dynamic repetition scheme, where the number of repetitions is indicated via a group repetition number. Additionally, the techniques described herein may enable the configuration for the repeated group-common PDSCH to include gaps between each repetition of the group-common PDSCH and for the UE to transmit acknowledgment feedback for the repetitions of the group-common PDSCH.
US11729764B2

A terminal is disclosed including a processor that assumes a position of an additional demodulation reference signal (DMRS) based on a value corresponding to whether frequency hopping is enabled or disabled; and a transmitter that transmits the additional DMRS according to an allocation duration of an uplink shared channel (PUSCH). In other aspects, a radio communication method and a base station are also disclosed.
US11729762B2

A method includes determining whether a first access point of a plurality of access points and a second access point of the plurality of access points should communicate simultaneously over a shared channel in a first network and in response to determining that one of the plurality of access points won contention of a transmission opportunity for the shared channel, dividing the transmission opportunity into a plurality of time slots. The method also includes scheduling transmissions of the first and second access points into the plurality of time slots according to the determination whether the first and second access points should communicate simultaneously over the shared channel and communicating, to the second access point and over a wired network or a second network different from the first network, an indication of whether the second access point should communicate during a first time slot of the plurality of time slots.
US11729753B2

A WTRU may receive downlink control information (DCI) indicating a start of a frame. The DCI may be received on a control channel, such as the Physical Downlink Control Channel (PDCCH) from an eNB, base station, AP, or other infrastructure equipment operating in a wireless communications system. The WTRU may decode the DCI and may determine a transmit time interval (TTI) duration, which may be expressed in terms of an integer number of basic time intervals (BTIs). The WTRU may determine a downlink (DL) transmission portion and assignment and an uplink (UL) transmission portion and UL grant based on the received DCI. Additionally, the WTRU may determine the start of the UL portion based on an offset (toffset). The WTRU may receive data in a DL portion of the frame and may transmit in an UL portion of the frame based on the determined UL grant and TTI duration.
US11729750B2

Aspects described herein relate to resource allocation in an integrated access and backhaul (IAB) system. In an example, the aspects include determining, by a central unit (CU), a configuration of not-available (NA) resources for a parent node, wherein the NA resources of the parent node correspond to a set of one or more resources configured at the parent distributed unit (DU) as being unavailable for uplink and downlink communications between the parent DU and a child node; and modifying, by the CU, the first child DU resource configuration to create a modified child DU resource configuration.
US11729739B2

In an embodiment, there is provided a 3GPP AAA Server, configured to, for the support of reporting or retrieval of location information, referred to as WLAN location information, of a WLAN AN where a User Equipment (UE) is attached for access to a 3GPP Packet Core Network via Untrusted WLAN access:—provide new WLAN location information or an indication of the absence of WLAN location information to a function such as the ePDG that terminates the secured link with the said UE over Untrusted access to 3GPP Packet Core Network, in case of UE mobility.
US11729735B2

Certain aspects of the present disclosure relate to communication systems, and more particularly, to interpreting a timing advance (TA) command for members of a timing advance group (TAG), such as different uplink component carriers and/or different bandwidth parts, having different numerologies, such as different subarrier spacing (SCS). A method that may be performed by a user equipment (UE) includes receiving, from a base station (BS), a TA command. The UE interprets the TA command differently for different members of a same TAG, associated with different numerologies. The UE applies a timing adjustment when transmitting an uplink transmission to the BS based, at least in part, on the interpretation.
US11729729B2

The present disclosure relates to a pre-5th-Generation (5G) or 5G communication system to be provided for supporting higher data rates Beyond 4th-Generation (4G) communication system such as Long Term Evolution (LTE). A terminal and method of the terminal in a wireless communication system are provided. The terminal includes at least one transceiver and at least one processor operatively connected to the at least one transceiver. The at least one processor is configured to acquire synchronization information of a first beam which is a serving beam, update the synchronization information based on the first beam or at least one second beam, determine at least one channel quality of the at least one second beam based on the updated synchronization information, and update the serving beam based on the at least one channel quality.
US11729722B2

Various aspects related to various apparatuses, methods, and computer-readable medium are described herein. Some aspects may enable an apparatus to protect downlink (DL) communication(s). Some aspects may enable an apparatus to perform DL communication(s). Some aspects may enable an apparatus to communicate regarding uplink (UL) communication(s). Some aspects may enable an apparatus to perform operation(s) related to an allocation vector. Some aspects may enable an apparatus to perform operation(s) related to random access. Some aspects may enable an apparatus to perform UL communication(s). The written description and appended drawings provide detailed descriptions regarding these and many other aspects.
US11729711B2

The disclosure relates to a slice management entity for a radio access network (RAN), the slice management entity comprising a processor configured: to receive RAN slice information including at least one key performance indicator (KPI), a slice identifier (ID), and/or network slice selection assistance information (NSSAI) and the context changes, to determine a configuration comprising a pre-configuration for at least one slice of the RAN based on the RAN slice information, and to transmit a RAN slice configuration message to the RAN based on the configuration.
US11729709B2

Methods and apparatus for providing a resource element identification system to process received uplink transmissions. In an embodiment, a method is provided that includes receiving one or more symbols from an uplink transmission. Each symbol comprises resource elements. The method also includes categorizing the resource elements into a plurality of categories to generated categorized resource elements, and forwarding the categorized resource elements to downstream processing functions.
US11729705B2

The technology relates to a wireless communication apparatus and a wireless communication method for enabling a wireless terminal station to easily select an appropriate connection destination from among a plurality of wireless base stations. A first wireless communication apparatus includes a communication section configured to transmit to a wireless terminal station a broadcast signal including network connection information regarding a wireless communication system having a plurality of base stations communicating with each other, the first wireless communication apparatus functioning as one of the plurality of wireless base stations. A second wireless communication apparatus includes a communication section to receive a broadcast signal including network connection information regarding a wireless communication system, from a plurality of wireless base stations constituting the wireless communication system and communicating with one another, the second wireless communication apparatus functioning as a wireless terminal station.
US11729704B2

In one implementation, a NAS layer (202) of a radio terminal (1) obtains, from an AS layer (208) of the radio terminal (1), either or both of: information regarding one or more access barring categories (401) broadcasted by a serving network (2); and the number of the one or more access barring categories. If barring information corresponding to a first access barring category (404) to which an application that triggers a session establishment (403) belongs is not broadcasted by an eNB (2), the NAS layer (202) replaces the first access barring category (404) with a particular access barring category among the one or more access barring categories (401) broadcasted by the serving network (202).
US11729699B2

A data communication network controls network access for User Equipment (UE) over a non-Third Generation Partnership Project (non-3GPP) access node. The non-3GPP access node transfers a UE access control message to a non-3GPP Interworking Function (IWF). The non-3GPP IWF transfers an N2 message indicating the UE access control message to a 3GPP Access and Mobility Management Function (AMF). The 3GPP AMF transfers an N1 message indicating the UE access control message to the UE. The UE processes the UE access control message from the non-3GPP access node.
US11729686B2

In a re-allocation process of a first user plane function network element to a second user plane function network element, a session management function network element sends a respective session modification request to each anchor user plane function network element of a plurality of anchor user plane function network elements, where each session modification request includes information about the second user plane function network element; and indicates to only a first anchor user plane function network element in the plurality of anchor user plane function network elements to send an end marker; or sends the end marker to only the first anchor user plane function network element.
US11729683B2

A method can include, by operation of first communication circuits, determining a quality of a plurality of communication frequencies according to wireless communications of a first protocol type; recording a quality of the communication frequencies; selecting communication frequencies for use by second communication circuits based on the quality of the communication frequencies; and wirelessly transmitting and receiving data with the second communication circuits according to a second protocol different than the first protocol; wherein the first and second communication circuits are collocated on the same device. Related devices and systems are also disclosed.
US11729681B2

A wireless communication device is configured for use in a wireless communication system. The device in this regard is configured to receive a command that commands the device to perform a link switch from a source link to a target link responsive to fulfillment of a condition. The command may indicate a target link configuration relative to a source link configuration. The device is also configured to store information from which the target link configuration indicated by the command is determinable irrespective of any change to the source link configuration occurring after receipt of the command. In some embodiments, the device is configured to, responsive to fulfillment of the condition, perform a link switch from the source link to the target link using the target link configuration as determined from the stored information.
US11729670B2

Certain aspects of the present disclosure provide techniques that may allow a device participating in a setup procedure to efficiently propose a range of values for a negotiated parameter. The techniques may reduce setup time, for example, allowing a responder to accept a value within the proposed range which may eliminate overhead associated with some of the back and forth message exchange of typical negotiations.
US11729665B2

Methods, systems, and devices for wireless communication are described that provide for generation of an encoded transport block (TB) that includes a number of systematic code blocks (CBs) and a number of parity CBs. The systematic CBs may be transmitted to a receiver, and the receiver may attempt to decode the systematic CBs. In some cases, one or more parity CBs may be transmitted with the systematic CBs, and the systematic CBs may be successfully decoded even in the event that one or more of the systematic CBs are not successfully received. In some cases, a receiver may provide feedback that requests that additional CBs be transmitted to decode the systematic CBs that were received, and it is not necessary to retransmit the missing systematic CBs. In some cases, a quantized value of a number of additional CBs needed to decode the TB may be transmitted.
US11729664B2

An apparatus comprising at least one processor and at least one memory including computer program code, the at least one memory and the computer program code being configured to, with the at least one processor, cause the apparatus at least to perform determining, per a communication service to which resources are to be allocated, a metric value using a first predefined set of rules, determining, per a sensing service to which resources are to be allocated, a metric value using a second predefined set of rules, sorting communication services to which resources are to be allocated and sensing services to which resources are to be allocated based on the metric values to a sorted order using a third rule, and allocating resources for the communication services and the sensing services based on the sorted order.
US11729662B2

Aspects of the present disclosure provide techniques for packet delay budget (PDB) coordination between two integrated access and backhaul (TAB) nodes for a radio link control (RLC) channel in an TAB network. An TAB node may dynamically adjust its configured one-hop RLC channel PDB based on channel conditions or buffer loading associated with the TAB node. The TAB node may then indicate bonus PDB at a next-hop node or request additional PDB from the next-hop node.
US11729657B2

A control apparatus (40) is configured to acquire a required end-to-end performance required for an end-to-end path from a first end node to a second end node, and determine each required segment performance required for a respective one of the path segments based on the required end-to-end performance. The control apparatus (40) is further configured to communicate with a node included in each path segment or communicate with an entity controlling the path segment to enforce a corresponding one of the required segment performances in the path segment. The control apparatus (40) is further configured to update a required segment performance currently enforced in at least one path segment based on an achievement status of each of the required segment performances in the respective path segments. It is thus, for example, possible to contribute to guaranteeing the required end-to-end performance even when quality of each path segment changes.
US11729654B2

Methods, systems, and devices for wireless communications are described. A remote unit (RU) of a base station may report, to a distributed unit (DU) of the base station, a message indicating that the RU supports an RU processing capability that is one of a first processing capability or a second processing capability. The first processing capability corresponds to additional physical layer signal processing at the RU than does the second processing capability. The RU may receive one or more uplink signals from a user equipment (UE) or accept one or more downlink signals from the DU, or both and process the one or more signals in accordance with the RU processing capability. The RU may forward the processed uplink signals from the RU to the DU via an application programming interface (API) that supports both the first processing capability and the second processing capability (e.g., a generalized API).
US11729647B2

An apparatus of a management service equipment includes processing circuitry. To configure the management service equipment for measuring a plurality of key performance indicators (KPIs) in a 5G network with a plurality of network functions (NFs), the processing circuitry is to retrieve using a data analytic function of the management service equipment, a plurality of performance measurements associated with a cell of a radio access network (RAN) within the 5G network. A KPI of the plurality of KPIs associated with the cell is generated using the data analytic function of the management service equipment, based on the plurality of performance measurements. The KPI is encoded for transmission to a service application executing on a user equipment (UE) active within the cell of the RAN or executing within a cloud architecture.
US11729640B2

Methods and apparatus for configuring a front end to process multiple sectors with multiple radio frequency frames. In an exemplary embodiment, a method includes decoding instructions included in a job description list, and configuring one or more processing functions of a transceiver to process a radio signal associated with a selected sector based on the decoded instructions. The configuration of the processing functions is synchronized according to time control instructions included in the job description list.
US11729637B2

A method for expediting Secondary Cell (SCell) or Primary cell of a secondary cell group (PSCell) addition or activation is proposed. A User Equipment (UE) receives a command that indicates adding or activating an SCell or a PSCell, wherein the command comprises information of a temporary Reference Signal (RS). The UE detects the temporary RS according to the information, and uses the temporary RS to add or activate the SCell or the PSCell.
US11729634B2

The present invention relates to a wireless communication system and, more particularly, to a method and a device therefor, the method comprising the steps of: receiving scheduling information relating to uplink data; and transmitting the uplink data through a time slot having a plurality of symbols by using the scheduling information, wherein: when a reference signal for beam-arrangement is not transmitted in the time slot, a transmission beam direction of the uplink data remains the same in the time slot; and when the reference signal for beam-arrangement is transmitted in the time slot, the transmission beam direction of the uplink data is changed according to a transmission beam direction of the reference signal for beam-arrangement, in a symbol at which the reference signal for the beam-arrangement is transmitted in the time slot.
US11729632B2

A base station may transmit a beam refinement reference signal prior to a paging physical downlink control channel (PDCCH) monitoring occasion to improve reception of a paging downlink control information (DCI). A user equipment (UE) may receive at least one transmission indicating the beam refinement reference signal transmitted prior to the PDCCH monitoring occasion. The UE may receive the beam refinement reference signal prior to the paging PDCCH monitoring occasion based on the at least one transmission. The UE may receive a downlink control information on the paging PDCCH monitoring occasion based on the beam refinement reference signal.
US11729630B2

A technique is directed to methods and systems of virtual site inspections. In some embodiments, a network operator navigates a drone which captures image data of equipment and layout of a site. The image data is processed and used to generate a 3D model of the site. A network operator virtually installs new equipment in the virtual representation of the site, and presents the 3D model of the site, with the new equipment in the proposed location, to a permitting authority. The permitting authority can review the 3D model of the new equipment at the site and approve or deny authorization for the network operator to physically install the equipment at the site. After the new equipment is installed, a network operator can capture image data of the installed equipment at the site to prove to the permitting authority that the equipment was installed at the site according to regulation.
US11729629B2

An electronic device that transmits traffic in a wireless network is described. During operation, the electronic device transmits, using a first transceiver, a first type of traffic in a shared frequency band that is unlicensed. Then, the first transceiver reserves time for transmitting a second type of traffic in the shared frequency band. The reserved time may be determined in response to a request to reserve the time from a second transceiver in the electronic device transmitting the second type of traffic in the shared frequency band. Next, the first transceiver permits, in the reserved time, transmission by the second transceiver of the second type of traffic in the shared frequency band. Furthermore, the first transceiver prevents transmission of the first type of traffic during the reserved time, thereby segregating the first type of traffic from the second type of traffic in the shared frequency band.
US11729622B2

The disclosure provides a method of processing communication service provider information by a terminal, the method including identifying a type of a secure element installed in the terminal; obtaining communication service provider information in the secure element through an application corresponding to the identified type of the secure element; and displaying the obtained communication service provider information.
US11729608B2

A solution for selecting an optimal user Plane entity (with Control and User Plane Separation (CUPS)) per UE during seamless roaming. In one embodiment, a method is provide that is performed by a control plane entity in a mobile core network that supports inter public land mobile network (PLMN) roaming among two or more PLMNs. The method includes obtaining a create session request from an entity in a second PLMN to which a user equipment has roamed from a first PLMN; selecting a particular user plane entity among a plurality of user plane entities based on one or more user equipment related parameters; and establishing a session with the particular user plane entity to serve user plane traffic in the mobile core network for the user equipment.
US11729606B2

A method for sending and receiving multi-carrier information in a communication system supporting a multi-carrier includes sending by a base station system information to the terminal via a broadcast message, the system information regarding multi-carriers that the base station is able to support; receiving a unicast message from the terminal, the unicast message including information related to carriers that the terminal is able to support or prefers in the multi-carrier list included in the system information; and sending multi-carrier allocation information including a primary carrier and a second carrier that the terminal will use, to the terminal via a unicast message.
US11729596B2

A communication device and method can include one or more processors operatively coupled to memory, a sensor and an output device, where the one or more processors to perform operations of identifying target person locations using internet searching and short range communication enabled devices such as Bluetooth LE devices.
US11729595B2

A piece of hygiene equipment includes a transmitting section configured to transmit an outbound radio signal carrying transmission payload data; a receiving section configured to receive an inbound radio signal carrying reception payload data; a processing section configured to transmit an outbound radio signal carrying specific transmission payload data and/or to receive an inbound radio signal carrying specific reception payload data for determining a communication partner to which outbound radio signals are to be transmitted and from which inbound radio signals are to be received; and a memory section. The processing section is configured to determine said communication partner and to store information on the determined communication partner in said memory section.
US11729591B2

A method and apparatus for differentiated service offerings based on a geo-location are disclosed. In one embodiment, the method comprises: receiving geo-location information from a plurality of remote devices; generating one or more events in response to determining that the geo-location information for each remote device of the plurality of remote devices indicates that said each remote device has entered or exited one of a set of one or more geo-fences; and triggering an action with respect to said each remote device, the action for managing at least one service for said each remote device based on geo-location of the one or more remotes, including determining a level of service and/or type of service for said each remote based on its respective geo-location.
US11729587B1

A system of a wireless telecommunications network performs a process initiated in response to an indication of a chargeable event (e.g., a registration procedure). The system obtains a current location of the wireless device, determines that the current location is different from a home location, and queries a database of a home charging function (CHF) for charging information of a subscriber associated with the wireless device. The system then dynamically stores the charging information at a database of a local CHF thereby eliminating the need to check with the home CHF when responding to every subsequent chargeable event, which reduces the service latency otherwise experienced by the wireless device.
US11729586B2

Methods and apparatus for use in establishing a group session in a mobile network for subscribers associated with a group are described. In one illustrative example, an access and mobility management function (AMF) entity receives, from a user equipment (UE), a request for registration which includes network slice selection assistance information (NSSAI). The NSSAI includes a group identifier associated with a group of subscribers. The AMF entity sends, to a unified data management (UDM) entity, a request for subscriber data which includes the group identifier. The AMF entity receives, from the UDM, a response to the request for subscriber data which includes a plurality of subscriber identifiers corresponding to the subscribers of the group. For a group session, the AMF entity creates a context associated with the group identifier and stores the context locally.
US11729558B2

A hearing device includes a housing elongated along a longitudinal axis, having an oval cross section, and configured to house electrical components. A loudspeaker disposed outside the housing in an intended wearing state of the hearing device is interconnected with at least a part of the electrical components. A plug connector is connected to the loudspeaker and carries at least six contact elements for interconnecting the loudspeaker with corresponding electrical components. A plug connector receptacle for receiving the plug connector interconnects the contact elements. The plug connector receptacle is disposed in a surface of the housing oriented toward a lower side in the intended wearing state. The plug connector and the plug connector receptacle define a plug-in direction extending from a front side to a rear side in the intended wearing state.
US11729556B2

Two coils are wrapped in one of numerous different implementations. In one implementation, the two coils are wrapped about a portion of a bobbin that has at least three flanges. The first coil is disposed about a first portion of the bobbin between the first flange and the second flange, and a second coil is disposed about a second portion of the bobbin between the second flange and the third flange.
US11729555B2

An electrodynamic actuator (1a, 1b) is disclosed, which is designed to be connected to a plate like structure (2) and which comprises a coil arrangement (3a, 3b) with at least one voice coil (4a, 4b), a magnet system (5) with a movable magnetic circuit part (7, 7a . . . 7f) and a static magnetic circuit part (6a . . . 6F) and a spring arrangement (12) coupling the static magnetic circuit part (6a . . . 6F) to the movable magnetic circuit part (7, 7a . . . 7f) and allowing a relative movement between the same. Both the spring arrangement (12) and the magnet system (5) provide a total restoring force (FT) directed towards an idle position (P0) of the movable magnetic circuit part (7, 7a . . . 7f). A part of a total restoring force gradient (ΔFT/Δz) caused by the magnet system (5) is at least 10% of the total restoring force gradient (ΔFT/Δz) in said idle position (P0) of the movable magnetic circuit part (7, 7a . . . 7f). In addition, an output device (17) with the electromagnetic actuator (1a, 1b) mounted to a plate like structure (2) is disclosed.
US11729554B2

An apparatus for generating a description of a combined audio scene, includes: an input interface for receiving a first description of a first scene in a first format and a second description of a second scene in a second format, wherein the second format is different from the first format; a format converter for converting the first description into a common format and for converting the second description into the common format, when the second format is different from the common format; and a format combiner for combining the first description in the common format and the second description in the common format to obtain the combined audio scene.
US11729548B2

An audio processing apparatus includes an attachment unit for a lens including a noise source, a first microphone for ambient sound, a second microphone for sound occurring from the noise source, a first conversion unit for Fourier transform of an audio signal output from the first microphone to generate a first audio signal, a second conversion unit for Fourier transform of an audio signal output from the second microphone to generate a second audio signal, a generation unit which generates noise data using the second audio signal and a parameter concerned with noise of the noise source, a subtraction unit which subtracts the noise data from the first audio signal, and a third conversion unit which performs inverse Fourier transform of an audio signal output from the subtraction unit. The generation unit uses, as the parameter, a parameter associated with a type of the lens attached to the attachment unit.
US11729538B2

A sensor module comprising a housing defining an internal cavity, the housing including an aperture, at least one microphone positioned in the internal cavity spaced from the aperture, a first barrier proximate the aperture, and a second barrier positioned between the at least one microphone and the first barrier.
US11729535B2

An optical switch is proposed, for routing an optical transmission signal according to an optical control signal, including one or more optical control ports; three or more optical transmission ports; a light director; and a thermally driven light mill; where the light mill and the light director are arranged with respect to each other, to the one or more control ports and to the three or more transmission ports such that: illumination of a respective one of the one or more control ports by a control beam carrying the control signal drives the light mill to rotate towards a respective position in which the light director is arranged so as to direct a transmission beam carrying the transmission signal, entering the switch via a respective one of the transmission ports, to exit the switch via a respective other of the transmission ports.
US11729531B2

An image sensor includes a pixel including a photoelectric conversion device configured to convert sensed light into charges and a floating diffusion node configured to store charges provided from the photoelectric conversion device, a timing generator configured to generate a reset signal including, prior to a light-sensing period, a first reset signal pulse for enabling an erasing of charges stored in at least one of the photoelectric conversion device and the floating diffusion node, and generate a transfer signal including, subsequent to the light-sensing period, at least two transfer signal pulses, each transfer signal pulse enabling a moving of charges stored in the photoelectric conversion device to the floating diffusion node, and a readout circuit configured to generate output data by summing results of performing at least two samplings for the floating diffusion node based on the at least two transfer signal pulses.
US11729524B2

Provided is a depth sensor which includes a pixel and a row driver that controls the pixel, the pixel including a first tap, a second tap, a third tap, and a fourth tap, an overflow transistor, and a photoelectric conversion device. Each of the first tap, the second tap, the third tap, and the fourth tap includes a photo transistor, a transfer transistor, and a readout circuit. In a first integration period of a global mode, the row driver activates a second photo gate signal controlling the photo transistor of the second tap and a third photo gate signal controlling the photo transistor of the third tap. In a second integration period of the global mode, the row driver activates a first photo gate signal controlling the photo transistor of the first tap and a fourth photo gate signal controlling the photo transistor of the fourth tap.
US11729523B2

In a method of testing an image sensor, at least one test image is captured using the image sensor that is a device under test (DUT). A composite image is generated based on the at least one test image. A plurality of frequency data are generated by performing frequency signal processing on the composite image. It is determined whether the image sensor is defective by analyzing the plurality of frequency data.
US11729522B2

An optical device for capturing an image of a scene, the optical device comprising: a plurality of image sensors each operable to capture a respective initial image of the scene; a lens arrangement operable to receive light from the scene and to form each initial image on each respective image sensor, each image sensor being located at a different respective distance from the lens arrangement; and an image processor operable to generate the captured image of the scene on the basis of image data from one or more of the captured initial images.
US11729514B2

An image processing method and apparatus. The method includes: obtaining a source image; determining spot superposition positions according to pixel values of the source image, where values of pixels of the source image that are located in the spot superposition positions are greater than a preset first threshold; and blurring the source image, and performing, in the spot superposition positions of a source image, image fusion on the source image and spot images to obtain a processed image, where the spot superposition positions and the spot images fused with in the spot superposition positions are in a one-to-one correspondence.
US11729512B2

An image capturing device, configured to illuminate an object by an illumination means and capture reflected light from the object as a reflection image by a capturing means, includes an irradiation angle range determination means. The irradiation angle range determination means determines, assuming that a group of pieces of unevenness existing at the same position on the surfaces of a plurality of individuals of an object is an unevenness group, an irradiation angle range for irradiating the object by the illumination means, on the basis of a statistic value of the inclination angles of the unevenness group in which variations in the inclination angles of the unevenness between individuals is larger than other unevenness groups, among the plurality of unevenness groups.
US11729511B2

Provided in embodiments of the disclosure are methods, apparatuses, and devices for spatial modeling. In one embodiment, a method comprises acquiring a panoramic image captured in a space; determining wall lines in the panoramic image based on Manhattan-World structural features of wall surfaces; and constructing a three-dimensional model for the space based on the wall lines.
US11729509B2

Disclosed are a 360-degree panorama image selective displaying camera and method, including a 360-degree panoramic image camera body that is provided, on an outside thereof, with at least one wide-angle lens module and a triggering section, at least one image displaying processing unit arranged inside the 360-degree panoramic image camera body, and a displaying-position triggering sensing mechanism. The image displaying processing unit is connected to the wide-angle lens module to process and output a 360-degree panorama image photographed and captured by the wide-angle lens module. The displaying-position triggering sensing mechanism corresponds to the triggering section of the 360-degree panoramic image camera body, so that a pressing touch applied externally to the triggering section causes the displaying-position triggering sensing mechanism to detect the pressing touch position and direction of the triggering section and generate a triggering-position selection sensing signal to the image displaying processing unit, and the image displaying processing unit is allowed to correspondingly and selectively retrieve, enlarge, cut, and stitch a selectively retrieved image, which corresponds to the pressing touch position and direction of the triggering section, among the photographed subjects, to the primitive 360-degree panorama image as a combined output.
US11729506B2

An imaging element includes a memory that stores first image data obtained by being captured by the imaging element and is incorporated in the imaging element, and a first processor that is configured to perform image data processing on the first image data and is incorporated in the imaging element. The first processor is configured to receive vibration information related to a vibration exerted on the imaging element within a frame output period defined by a first frame rate, and output second image data obtained by assigning the vibration information to a specific position set in the first image data within the frame output period.
US11729505B2

An electronic device comprises a camera module and an image signal processor. The camera module generates and outputs gyro data and frame data for an input image. The image signal processor comprises a motion vector module which calculates motion vector information, a gyro-based motion estimator which extracts camera rotation information of the camera module from the gyro data, a motion vector-based motion estimator which extracts frame rotation information from the frame data, an optical image stabilization (OIS) two-dimensional (2D) translation information estimator which estimates OIS 2D translation information based on the motion vector information, the camera rotation information, and the frame rotation information, and a camera path optimizer which filters out a low-frequency component from the OIS 2D translation information and calculates stabilized camera motion information of the camera module using the filtered OIS 2D translation information and the camera rotation information.
US11729504B2

An electronic device for auto focus is provided. The electronic device includes determining, by the electronic device, at least one region of interest (ROI) in a scene displayed in one of a viewfinder and a captured image frame and determining, by the electronic device, at least one sub ROI in the at least one ROI by performing a first level of auto focus using at least one first image sensor. Further, the method includes determining, by the electronic device, at least one focused sub ROI by performing a second level of auto focus on the at least one sub ROI using at least one second image sensor and rendering, by the electronic device, a focus transition for the at least one focused sub ROI to one of the viewfinder and the captured image frame.
US11729499B2

An electronic device according to various embodiments comprises: an antenna; a camera module; at least one capacitor; a switching circuit; and a controller operatively coupled to the antenna, the camera module, the at least one capacitor, and the switching circuit, wherein the controller, in a state where the at least one capacitor that is connected in parallel to a power supply node inputted to the camera module is connected to a first node by the switching circuit, identifies a wireless signal related to the antenna, and in response to an identification of the wireless signal, controls the switching circuit to thereby connect the at least one capacitor from the first node to a second node distinguished from the first node.
US11729493B2

An image capture apparatus according to an embodiment of the present technology includes an image generation unit, an edge detection unit, and a color control unit. The image generation unit generates a captured image by capturing a subject. The edge detection unit detects an edge portion included in the generated captured image. The color control unit controls a color of a highlighted display for highlighting the edge portion for each detected edge portion based on color information about the edge portion in the captured image.
US11729476B2

A media rendering device and method for reproduction control of scene description is provided. The media rendering device retrieves media content that includes a set of filmed scenes and text information. The text information includes video description information and timing information. The video description information describes a filmed scene in the set of filmed scenes. The media rendering device further extracts the timing information to reproduce the video description information from the text information of the filmed scene. The media rendering device further controls the reproduction of the video description information in either a textual representation or in a textual and audio representation at a first-time interval indicated by the extracted timing information of the filmed scene.
US11729473B2

Various embodiments described herein support or provide for predicting a rating for a media asset for one geographic region based on a reference rating of the media asset for another geographic region.
US11729472B2

A system and method for providing content to a user outside of a home region. A portable device displays content to a user through a network connection. A home content provider provides content to the portable device from the home region. Some of the content provided is region restricted content. A location verifier determines that the portable device and the user are both physically located within the home region. The location verifier issues to the user a location token when the user and the portable device are in the home region. A token verifier verifies the location token when the user requests the region restricted content outside of the home region. The token verifier further instructs the home content provider to provide region restricted content to the user when the user has the location token.
US11729465B2

Providing object-oriented-zoom by identifying, in a transmitter, a region-of-interest in a captured video part, communicating to a receiver the video stream, and an identification of the region-of-interest, marking, on a display of the receiver, the region-of-interest over the captured video stream on a screen display, receiving from a selection of the displayed region-of-interest forming a selected object, communicating the selection to the transmitter, dividing the video stream, in the transmitter, into a first part including the selected object, and a second part including at least a part of the captured video stream less the first part, communicating the first and second parts to the receiver, displaying the first and second parts simultaneously, where the first part is displayed in a substantially constant location of a screen display of the receiver, and where the second part is displayed around the first part to fill the screen display of the receiver.
US11729463B2

Method for subsequently displaying a stream of images in a display area of a display device, wherein a first area within the display area is determined around a point of regard. A first image of the stream of images is displayed in the display area such that a first part of the first image, which is displayed in the first area, is displayed according to a first parameter value of at least one parameter and a second part of the first image, which is displayed in at least one second area outside the first area, is displayed according to a second parameter value of the at least one parameter. Moreover, the determining of the point of regard is performed as predicting the point of regard for a certain future point of time, at which the first image is displayed.
US11729452B2

A media content playback device for a vehicle and a method therefor are provided. The media content playback device includes: a media information identifying device that requests a user terminal to transmit media information and identifies the media information, when there is a request to play media content, when communicatively connected with the user terminal; a cover art obtaining device that obtains a cover art image based on the media information; and a controller that displays the cover art image on a playback screen of the media content, when playing the media content.
US11729441B2

Method to generate frames on demand starts with a system receiving a request for a media content item from a client device. The request includes a media content identification and a main user identification. The system transmits to the client device a playlist including a first set of media content item segments. While the first set of media content item segments is being displayed on the client device, the system renders a second set of media content item segments using the media content identification and the main user identification. Rendering the second set of media content item segments can include rendering a main user avatar based on the main user identification and incorporating the main user avatar into the second set of media content item segments. The system then updates the playlist to include the second set of media content item segments. Other embodiments are disclosed herein.
US11729436B2

A method, apparatus, and system for detecting a video bitstream, and a non-transitory computer-readable storage medium are disclosed. The method may include: receiving a first feature value generated by a source node which transmits a video bitstream, where the first feature value is feature information of the video bitstream generated by the source node according to a preset rule; receiving a second feature value generated by another node which transmits the video bitstream, where the second feature value is feature information of the video bitstream generated by the another node according to the preset rule; determining whether the first feature value is consistent with the second feature value via comparison; and generating an alarm in response to a comparison result that the first feature value is inconsistent with the second feature value.
US11729435B2

A content distribution server, includes: a communicator that receives live contents transmitted through a network NW from a distributor terminal used by a distributor of a live content; a designator that designates an area in the live content, where another content is superimposed and played; a selector that selects the other content to be played in the area designated; and a controller that generates a distribution content by superimposing the other content selected by the selector in the area designated by the designator in the live content, wherein the communicator distributes the distribution content to a viewer terminal through the network NW.
US11729434B2

Systems and methods enable video on demand playback startup times to be reduced. A redirect database is populated with redirect locators. A request from a device for an item of primary video content is received. A static manifest file is generated including locators corresponding to the requested item of primary video content and redirect database entries storing redirect locators to default interstitial media. The static manifest file is transmitted to the device. Potential items of interstitial media are identified by sources of interstitial media, and a first item of interstitial media is selected. A redirect locator in the redirect database is replaced with a redirect locator corresponding to the selected interstitial media. A request is received from the device directed to the redirect database location storing the redirect locator corresponding to the selected interstitial media. The selected interstitial media is streamed to the device.
US11729433B2

Methods, systems, and media for selectively presenting broadcast content based on user interests are provided. In some implementations a method for selectively presenting broadcast content is provided, the method comprising: receiving user information; associating one or more athletes, each on a roster of a team in a sports organization, with the user based on the user information; identifying broadcast programs that a user device can present; determining broadcast programs that depict a game between teams in the sports organization that are relevant to an athlete associated with the user based on program metadata; receiving event metadata for the relevant broadcast programs that is indicative of events in the game depicted therein; determining that a portion of the first broadcast program is relevant to a first entity based on the event metadata; and causing the user device to present the portion of the first broadcast.
US11729432B2

An object recognition computer for a vehicle includes at least one processor and at least one memory storing program code executable by the at least one processor to perform operations. The operations are configured to receive video streams from a plurality of cameras spaced apart within the vehicle and each having a field-of-view capturing at least one passenger seat. For each of the video streams, the operations retrieve from a data structure information that defines a region within video frames of the video stream where object recognition is to be performed to attempt to identify a defined object associated with the at least one passenger seat. The operations then perform object recognition limited to within the defined region to identify the defined object. Notifications can be selectively generated to passengers and/or crew based on the object recognition.
US11729425B2

A method for decoding a video signal based on reduced transform includes the steps of: obtaining, from the video signal, a transform index indicating transform kernels applied to horizontal and vertical directions of a current block; determining a region in which a transform is applied to the current block based on the transform kernels indicated by the transform index and a size of the current block; deriving, as zero, coefficients of a remaining region other than the region to which the transform is applied within the current block; and performing an inverse transform on the region to which the transform is applied using the transform kernels indicated by the transform index.
US11729417B2

A decoding method is presented. At least one high level syntax element is decoded that indicates whether generalized bi-prediction applies for predicting blocks of a slice. A block is then decoded from said slice using generalized bi-prediction in the case where said at least one high level syntax element indicates to apply generalized bi-prediction.
US11729416B2

An embodiment of a semiconductor package apparatus may include technology to determine a residual error based on coding unit information, and determine a candidate coding unit and an associated rate distortion cost based on the residual error. An embodiment may additionally or alternatively include technology to partition a first coding unit into two or more smaller coding units based on a partition message, accelerate processing of at least one of the two or more smaller coding units, and estimate motion fora frame based at least partially on results of the accelerated processing. Other embodiments are disclosed and claimed.
US11729411B2

Disclosed are an inter prediction mode-based image processing method and an apparatus therefor. Particularly, a method for processing an image on the basis of inter prediction may comprise the steps of: determining whether a motion vector scale adaptation is applied to a block; up-scaling a down-scaled MVD (Motion Vector Difference) when the motion vector scale adaptation is applied to the block; deriving a MV (Motion Vector) for the block, using the up-scaled MVD and a MVP (Motion Vector Predictor); and generating a predictive block of the block, using the derived MV.
US11729406B2

Certain aspects of the present disclosure are directed to methods and apparatus for compressing video content using deep generative models. One example method generally includes receiving video content for compression. The received video content is generally encoded into a latent code space through an encoder, which may be implemented by a first artificial neural network. A compressed version of the encoded video content is generally generated through a trained probabilistic model, which may be implemented by a second artificial neural network, and output for transmission.
US11729405B2

A method for video processing is provided. The method includes determining, for a conversion between a current video block of a video that is a chroma block and a coded representation of the video, parameters of a cross-component linear model (CCLM) based on two or four chroma samples and/or corresponding luma samples; and performing the conversion based on the determining.
US11729402B2

An image decoding method performed by a decoding apparatus according to the present document comprises the steps of: acquiring a flag indicating whether a picture header (PH) network abstraction layer (NAL) unit exists; acquiring a PH on the basis of the flag; and decoding a current picture related to the PH on the basis of the PH.
US11729398B2

When intra prediction is to be used, an encoder determines whether an adaptive basis selection mode is to be used and whether a size of the current block matches a determined size. When the adaptive basis selection mode is to be used and the size matches the determined size, the encoder fixes the first transform basis for the current block to a first determined transform basis in the adaptive basis selection mode, and generates first transform coefficients by performing first transform of residual signals of the current block using the first determined transform basis; quantizes the first transform coefficients when an intra prediction mode for the current block is a determined mode; and generates second transform coefficients by performing second transform of the first transform coefficients using a second transform basis, and quantizes the second transform coefficients, when the intra prediction mode is not the determined mode.
US11729392B2

The present invention relates to a video encoding method, to a video decoding method, and to an apparatus using same. The video encoding method according to the present invention comprises the steps of: setting a tile and a slice for the inputted current picture; performing encoding based on the tile and the slice; and a step of transmitting the encoded video information. The current picture may include one or more tiles and one or more slices. The largest coding units (hereinafter, referred to as LCUs) in the slice may be arranged based on a tile scan.
US11729383B2

An image encoding/decoding method is disclosed. An image decoding method of the present invention may comprise deriving slice mode information on a slice included in a current picture, deriving slice identification information on the basis of the slice mode information, and decoding the slice on the basis of the slice identification information.
US11729367B2

Disclosed are a wide viewing angle stereo camera apparatus and a depth image processing method using the same. A stereo camera apparatus includes a receiver configured to receive a first image and a second image of a subject captured through a first lens and a second lens that are provided in a vertical direction; a converter configured to convert the received first image and second image using a map projection scheme; and a processing configured to extract a depth of the subject by performing stereo matching on the first image and the second image converted using the map projection scheme, in a height direction.
US11729365B2

Systems and methods in accordance with embodiments of the invention are configured to render images using light field image files containing an image synthesized from light field image data and metadata describing the image that includes a depth map. One embodiment of the invention includes a processor and memory containing a rendering application and a light field image file including an encoded image, a set of low resolution images, and metadata describing the encoded image, where the metadata comprises a depth map that specifies depths from the reference viewpoint for pixels in the encoded image. In addition, the rendering application configures the processor to: locate the encoded image within the light field image file; decode the encoded image; locate the metadata within the light field image file; and post process the decoded image by modifying the pixels based on the depths indicated within the depth map and the set of low resolution images to create a rendered image.
US11729363B2

Various implementations disclosed herein include devices, systems, and methods that that modify audio of played back AV content based on context in accordance with some implementations. In some implementations audio-visual content of a physical environment is obtained, and the audio-visual content includes visual content and audio content that includes a plurality of audio portions corresponding to the visual content. In some implementations, a context for presenting the audio-visual content is determined, and a temporal relationship between one or more audio portions of the plurality of audio portions and the visual content is determined based on the context. Then, synthesized audio-visual content is presented based on the temporal relationship.
US11729360B2

Embodiments of the present disclosure, relating to the technical field of projection, provides a projection device. The projection device includes: an imaging module, configured to project images; a position adjustment module, connected to the projection module, and configured to adjust a position of the projection module; a controller, connected to the projection module and the position adjustment module, and configured to control the projection module to project images, and control the position adjustment module to adjust the position of the projection module.
US11729355B2

A method of collaborating between a first computer associated with a first display at a first location and a second computer associated with a second display at a second location may include establishing a connection between the first and second computers, opening a virtual canvas on the first computer, the virtual canvas to be displayed on the first and second displays simultaneously, and sending an object between the first and second computers by sending data associated with the object on the virtual canvas stored on the first computer to the second computer to be stored locally, thereby creating a shared canvas on which objects are at a single location. Video conferencing may include sending a first live video stream from the first display to the second display to be viewed in a first video conference window separate from the virtual canvas on the second display and vice versa.
US11729341B2

An image forming apparatus includes: a scanner to read each of a first output product serving as a model and a second output product output from the image forming apparatus; a memory that stores a color conversion lookup table to be used when color conversion is performed from a RGB color system into a CMYK color system; and circuitry to correct the color conversion lookup table based on a number of pixels and an amount of change per hue, using read information on the first output product, and re-correct the corrected color conversion lookup table, using read information on the second output product.
US11729338B2

According to aspects of the present disclosures, when receiving an enabling request of a cloud cooperation function, a controller of an MFP notifies a user using an LCD module and change its state to an approval waiting state. When an approval operation by a user is confirmed, the MFP shifts access permission state and notifies a mobile terminal of the fact. When a constant connection between the MFP and a server is established, the MFP transmits a creation request for creating a server access token to the server. Then, the MFP receives the server access toke and transmits the same to the mobile terminal.
US11729336B2

An information processing apparatus capable of communicating using a first communication method and communicating using a second communication method performs, in a case where attempting processing fails to establish a connection with a communication apparatus using the first communication method without using an external apparatus, communication with the communication apparatus by the second communication method and transmits a job to the communication apparatus via the connection with the communication apparatus using the first communication method, the communication being used to establish the connection with the communication apparatus using the first communication method.
US11729330B2

An image reading apparatus includes a transport unit which transports a document, and reading units which read an image of the document which is transported. It is assumed that an operation of reading an image when specific setting information is not input to a control device of the image reading apparatus is set to a first reading mode, and an operation of reading an image when specific setting information is input to the control device is set to a second reading mode. In this case, in the second reading mode, image data of an image with a resolution which is equal to that in the first reading mode is generated, while causing the reading units to read an image from a document which is transported by the transport device at a lower speed than that in the first reading mode.
US11729327B2

A sheet conveying device includes a reception processing portion and a conveyance control portion. The reception processing portion receives an input operation to input conveyance route information that indicates which of a first conveyance route, leading to a first discharge portion via a first conveyance path that extends straight from a sheet placement portion, and a second conveyance route, leading to a second discharge portion, which is different from the first discharge portion, via a second conveyance path that includes a curved portion branching off from the first conveyance path, each sheet included in a sheet stack placed on the sheet placement portion is conveyed along. The conveyance control portion sequentially conveys each sheet included in the sheet stack placed on the sheet placement portion along either the first conveyance route or the second conveyance route according to the conveyance route information input through the input operation.
US11729317B1

Disclosed herein are embodiments of systems, methods, and products comprises an analytic server for electronic requests routing and distribution. The server receives a plurality of requests from a plurality of electronic user devices. Aiming to routing the plurality of requests to appropriate agents, the server trains an artificial intelligence model for each agent based on historical data. For each request, the server executes the artificial intelligence model to determine a score indicating the probability of the agent converting the request to a successful sale. The server determines an entropy value for each request based on the scores and order the requests into a queue based on the entropy values. The server also calculates a capacity for each agent based on historical agent data. For each request in the queue, the server routes the request to an agent based on at least one of the score and capacity of the agent.
US11729310B2

The present disclosure describes a system, method, and computer readable medium for providing information to a receiving party in a communications network. The method includes receiving a message from a sending party and performing a lookup of information relating to the sending party in a database via an Internet Protocol connection. The lookup is based on an identifier of at least one of the sending party and the receiving party. Subsequently, the information is provided to the receiving party based on the availability of the information in the database.
US11729308B2

A communication system is presented for a mobile device having a mobile application stored on the mobile device. The mobile application has a graphical user interface and a touchscreen. A controller is configured to interface with the mobile application. The controller includes a processor and tangible, non-transitory memory on which instructions are recorded. The controller is adapted to selectively execute a stealth mode for message transmissions between a user of the mobile device and a remote assistance unit. The stealth mode is activated based in part on a signal from the mobile application and includes muting each audio stream in the mobile device and disabling vibrate notifications. A first phase of inquiries is submitted to the user, via the graphical user interface, along with one or more pre-populated replies. The stealth mode includes alerting an advisor in the remote assistance unit.
US11729304B2

A communications node includes an apparel item in the form of a harness that includes a primary portion. A halo element extends from the primary portion and is configured to be worn about the neck. A fastener that demountably couples the primary portion to the halo element. An antenna element positioned within the apparel item. An A/V hub is affixed to the halo portion and configured to receive audio/video input. The apparel item also includes a communications device and battery. A control circuit is communicatively coupled to the antenna element, the A/V hub, the communications device, and the battery. The A/V hub demountably and communicatively couples to an audio/video source. The control circuit is configured to establish a self-organizing WAN with computing devices that connect directly, dynamically, and non-hierarchically to the WAN. The antenna elements include a graphene polymer conductive composition. The apparel item is multilayered and reflects RF radiation.
US11729300B2

Programmatically defined fields of metadata for a network packet may be generated. Instructions indicating different portions of data from different headers of a network packet may be stored at a packet processor. When a network packet is received, the different portions of the data may be extracted from the different headers of the packet according to the instructions and provided to other stages of the packet processor for processing. Different portions of the same programmatically defined field may be utilized at different stages in the packet processor. The programmatically defined field may be used to generate a hash value that selects an entry in a lookup table describing a forwarding decision for a network packet.
US11729299B2

The present invention provide a method for processing data packet and apparatus and the method includes: receiving or sending compression configuration information of an application layer packet; and performing compression processing or decompression processing on the application layer packet according to the compression configuration information. By using the foregoing method, compression and decompression processing of the application layer packet can be implemented, thereby reducing overheads of packet transmission and improving utilization of a network resource.
US11729297B2

A method for fetching a content from a web server to a client device is disclosed, using tunnel devices serving as intermediate devices. The client device accesses an acceleration server to receive a list of available tunnel devices. The requested content is partitioned into slices, and the client device sends a request for the slices to the available tunnel devices. The tunnel devices in turn fetch the slices from the data server, and send the slices to the client device, where the content is reconstructed from the received slices. A client device may also serve as a tunnel device, serving as an intermediate device to other client devices. Similarly, a tunnel device may also serve as a client device for fetching content from a data server. The selection of tunnel devices to be used by a client device may be in the acceleration server, in the client device, or in both. The partition into slices may be overlapping or non-overlapping, and the same slice (or the whole content) may be fetched via multiple tunnel devices.
US11729295B2

Method, apparatus and computer program product for dynamic link processing engine. For example, the apparatus includes at least one processor and at least one non-transitory memory including program code. The at least one non-transitory memory and the program code are configured to, with the at least one processor, determine link invocation information associated with a link invocation; determining, based on the link invocation information, a link display characterization for the link invocation; and in response to determining that the link display characterization indicates that the expected output associated with the link invocation comprises display-oriented data: determine, based on the link invocation information, a dynamic redirection characterization for the link invocation; and in response to determining that the dynamic redirection characterization indicates that the display-oriented data associated with the link invocation is associated with the target application, perform an inter-application redirection between the invoking application and the target application.
US11729294B2

Systems and methods for processing a DNS query to identify and implement pre-processing information by a DNS server component in anticipation of a corresponding content request from a client computing device are provided. The pre-processing information can correspond to identification of content to be preloaded or other actions to be implemented by one or more computing devices in association with an anticipated client content request. Based on identification of the content or future actions, a DNS server component can provide the pre-processing information to one or more computing devices, such as computing devices of a CDN service provider and/or an original content provider, in advance of a corresponding request for content from the client computing device in order to improve performance associated with responding to the client request.
US11729291B2

An announcement protocol may allow disparate, and previously incompatible, content delivery network caches to exchange information and cache content for one another. Announcement data may be stored by the respective caches, and used to determine whether a cache is able to service an incoming request. URL prefixes may be included in the announcements to identify the content, and longest-match lookups may be used to help determine a secondary option when a first cache determines that it lacks a requested content.
US11729286B2

A system receives a temporal graph comprising nodes having respective identifiers and edges. Each of the edges has a direction pointing from a first node to a second node and indicates an association of the first node with the second node. The system generates a sequence of nodes and a sequence of edges by traversing the temporal graph. The system determines, for each node of the sequence of nodes, a respective set of feature values including an indegree, an outdegree, and a total degree. The system determines, for each edge of the sequence of edges, an edge feature comprising a sum of the total degree of a first node preceding the edge and the total degree of a second node following the edge. The system forms an edge feature values sequence for the sequence of edges and determines an edge network embedding for each edge of the sequence of edges.
US11729285B2

Systems and methods are disclosed for associating a plurality of Internet-enabled devices with a common user profile for targeting Internet content or advertising. One method includes: receiving, from a plurality of Internet-enabled devices, a plurality of requests for electronic content or advertising; extracting, from each of the plurality of requests, a source IP address and a unique identifier associated with the respective Internet-enabled device; for each source IP address for which requests were received over a predetermined time period from a number of Internet-enabled devices below a threshold number of devices, identifying each possible pair of devices from which requests were received; and for each possible pair of devices, calculating a probability that the pair of devices are owned or operated by a common user.
US11729283B2

Method and apparatus for analyzing an online behavior of a user accessing a web server include: collecting, when a user terminal accesses a web server and forms a session, log data corresponding to a behavior performed by the user terminal in the session in real time; detecting log data corresponding to a trigger log among the log data; extracting, when the trigger log is detected, log data cumulated up to a detection time point of the trigger log from a start time point of the session and generating cumulative log data; and performing pattern analysis on the cumulative log data and generating behavior information corresponding to the behavior of the user terminal.
US11729282B2

A system and method for providing zone-specific media to a user. As a non-limiting example, various aspects of this disclosure provide a system and method that flexibly selects and provides media content (e.g., audio content), where such content is selected based, at least in part, on a user location (e.g., location within a premises).
US11729276B2

There are provided systems and methods for a rapid online variable sourcing infrastructure for decision system. Specifically, endpoints may be injected into domain servers serving as a template for sourcing new data variables. When new variables are involved, a first endpoint is injected for registering variables exposed to the domain server, and a second endpoint may be injected to fetch data values at run time, e.g., during the actual decision computation. In this way, data pipeline latency can be avoided during the sourcing process, as the data variables can be sourced from domain servers at run time.
US11729271B2

An enhanced shipping container apparatus that maintains packages is described having integrated fire suppression. The apparatus has a container base supporting the packages, multiple container walls coupled to the container base, and a container top coupled to each of the container walls. A fire suppression panel is integrated as part of one or more of the walls and top portion, and has a support sheet of fire resistant material; an interior exposed sheet of temperature sensitive material; a sealed boundary connecting the support sheet and interior exposed sheet on peripheral edges (where the sealed boundary, support sheet and interior exposed sheet define a holding cavity), and integrated fire suppression material in the holding cavity. The temperature sensitive material of the interior exposed sheet releases the integrated fire suppressant material from within the holding cavity when the temperature sensitive material of the interior exposed sheet is exposed to a threshold temperature.
US11729250B2

Systems and method for web control adaptation and hooking for virtual private network integration are provided herein. A client application executing on a client device can modify a scheme support function of a web control application to return a first value in response to a first scheme type. The first value can indicate that the web control application does not support the first scheme type. A custom scheme function can be registered to handle the first scheme type and can intercept requests of the first scheme type. The custom scheme function can transmit the requests to one or more URLs corresponding to one or more applications through a virtual private network (VPN). The custom scheme function can forward, to the web control application for rendering on the client device, the data corresponding to the application retrieved by the custom scheme function through the VPN.
US11729247B2

A method may include: providing a browser extension to user devices that is configured to: monitor data associated with website pages visited by the user devices; and in response to detecting that data associated with a website page is indicative of a presence of a platform, transmit a notification to an entity system, the notification including an identification of the website page and an identification of the platform; and in response to receiving the notification: generating and/or updating a database indicative of operation of the platform on one or more website pages based on the identification of the website page and the identification of the platform; quantifying a number of website pages on which the platform is operated based on the database; and determining a level of traffic to the website page.
US11729246B2

A URL address determining method includes receiving a URL address extracted from a target server; requesting a response corresponding to the URL address from the target server; when receiving response data from the target server, extracting a response URL address corresponding to the URL address from the response data; and determining a resource indicated by the URL address by using the response URL address.
US11729243B2

Various embodiments herein provide adaptive streaming mechanisms for distribution of point cloud content. The point cloud content may include immersive media content in a dynamic adaptive streaming over hypertext transfer protocol (DASH) format. Various embodiments provide DASH-based mechanisms to support viewport indication during streaming of volumetric point cloud content. Other embodiments may be described and claimed.
US11729241B2

Described embodiments include a system that includes a network interface and a processor. The processor is configured to identify, via the network interface, a state of congestion in a communication channel between a base station belonging to a cellular network and a client device, to calculate, responsively to the state of congestion, a maximum sustainable encoding bit rate (MSEBR) for a video that is being downloaded by the client device, from a server, via the communication channel, the video being encoded at a plurality of different predefined bit rates, and to inhibit the client device, in response to calculating the MSEBR, from downloading a segment of the video that is encoded at any one of the predefined bit rates that exceeds the MSEBR. Other embodiments are also described.
US11729231B2

Methods and systems for secure multi-party generation of random bits are disclosed. These random bits can be generated securely, even if some parties (i.e., less than a corruption threshold) are dishonest or malicious. Methods and systems can use secure environments in order to securely generate and store cryptographic keys. Using broadcast protocols such as Dolev-Strong, a generator computer can distribute a public protocol instance key to other participant computers. Each participant computer can generate a random bit and encrypted the random bit with the public protocol instance key, and broadcast its encrypted random bit to the other participant computers. Once each participant computer has received the encrypted random bits from all other participant computers, the private protocol instance key can be released to the participant computers, enabling the participant computers to decrypt the encrypted random bits, and calculate an output random bit based on the encrypted random bits.
US11729228B2

A computer-implemented method includes displaying first content within an interface of a group-based communication channel of a group-based communication platform on a first user device associated with a member of the group-based communication channel; receiving a request from the first user device to share the first content outside of the group-based communication platform; in response to the request from the first user device, generating a link to the first content for sharing outside of the group-based communication platform; receiving a request to view the first content from a second user device, wherein the request to view the first content originated outside of the group-based communication platform and is associated with the link; and displaying the first content on the second user device.
US11729224B2

A method and system for establishing optimized data streams in a network can be configured for crafting resource-draining Session Description Protocol (SDP) bodies on a call queue.
US11729223B1

In some implementations, a network device (e.g., an Internet protocol multimedia subsystem (IMS) application server (IMS-AS) may receive, via a first communication interface, from a call session control function (CSCF) device, a request to register for an Internet protocol multimedia subsystem (IMS) service. The network device may provide via a second communication interface between the network device and a unified data management (UDM) device, and to the UDM device, a request for IMS service information associated with the IMS service. The network device may receive based on providing the request for IMS service information, via the second communication interface, and from the UDM device, IMS service information. The network device may cause, based on the IMS service information, the IMS service to be provided to a user device associated with the request to register for the IMS service.
US11729222B2

Embodiments provide a system and method for extracting configuration-related information for reasoning about the security and functionality of a composed system. During operation, the system determines, by a computing device, information sources associated with hardware and software components of a system, wherein the information sources include at least specification sheets, standard operating procedures, user manuals, and vulnerability databases. The system selects a set of categories of vulnerabilities in a vulnerability database, and ingests the information sources to obtain data in a normalized format. The system extracts, from the ingested information sources, configuration information, vulnerability information, dependency information, and functionality requirements to create a model for the system. The system displays, on a screen of a user device, one or more interactive elements which allow the user to view or select the information sources and the categories of vulnerabilities, initiate ingesting the information sources, and view the extracted configuration information.
US11729221B1

Disclosed herein are embodiments of systems and methods that dynamically reconfigure a multi-tiered system of network devices and software applications in response to an ongoing and/or anticipated cyber-attack. The dynamic reconfiguration of the network devices may consist of a wide range of processes, which may include generating new network addresses for individual network devices; reconfiguring the network devices by creating firewalls, changing protocols between the network devices in a multi-tier reconfiguration solution, changing the cloud infrastructure provider of the network devices, even when the underlying network infrastructure ecosystem differs across cloud service providers (CSPs); and maintaining a secure and updated data model of a record of reconfigured network devices and their dependencies to allow legitimate users of the network devices to understand reconfiguration actions that are hidden from malicious users such as hackers and cyber-attackers.
US11729220B2

A method includes receiving, at an access node of a local network, a connection request from a device and in response to the connection request, establishing a connection with an identity provider. The device, the access node, the local network, and the identity provider are members of an identity federation. The method further includes receiving an indication that the device previously violated a network policy of a network different from the local network and after the device is authenticated with the identity provider, determining, by the access node and based on the indication, whether to allow the device to communicate over the access node.
US11729213B2

Systems, methods, and computer media for securing software applications are provided herein. Using deceptive endpoints, attacks directed to API endpoints can be detected, and attackers can be monitored or blocked. Deceptive endpoints can be automatically generated by modifying valid endpoints for an application. Deceptive endpoints are not valid endpoints for the application, so if a deceptive endpoint is accessed, it is an indication of an attack. When a deceptive endpoint is deployed, accessing the deceptive endpoint can cause an alert to be generated, and an account, user, or device associated with accessing the deceptive endpoint can be blocked or monitored.
US11729204B1

A method for performing cyber-security analysis includes storing a semantic graph with nodes representing monitored computer-based entities, and edges representing monitored relationships. Each edge has an associated tally. A set of threat scores associated with multiple computer-based entities is stored in the memory. The semantic graph is updated in response to receiving event data. The updating includes decomposing the event data into a set of entities and a set of associated relationships, updating the tally of one of the edges based on the set of relationships, modifying an alert attribute of a monitored computer-based entity when the event data includes an applicable alert, and modifying a threat score of at least one computer-based entity based on the event data when the event data includes an applicable alert, to define a set of modified threat scores. The updated semantic graph is monitored for cyber-security risks within the multiple computer-based entities.
US11729203B2

Systems and methods are disclosed that are useful for minimizing organization risk in the case of a cybersecurity attack, through computer-based simulation of cybersecurity attacks, incident response tracking and incident response training provided responsive to the simulation outcome. A server is configured to execute a simulated cybersecurity attack on a plurality of users and their computer systems on a company network associated with a company, tracking responses such as interactions with at least one of the computer systems or network components to the simulated cybersecurity attack and validating whether one or more responses of a predetermined set of responses have occurred to minimize the impact of the simulated security attack on the entity.
US11729202B2

Disclosed is a method, a device, a system and/or a manufacture of reducing project failure probability through generation, evaluation, and/or dependency structuring of a critical event object. In one embodiment, a system for building a failure dependency hierarchy includes an orchestration server and a network. The orchestration server initiates a session and provisions computing resources. An object generation routine receives a failure event criterion. An object initiation routine then generates a failure event object associated with the failure event criterion. A risk assessment routine generates a risk value by inputting a probability data and an impact data into a risk assessment function. A dependency routine stores in a referential attribute a unique identifier of a second failure event object to define a failure dependency. A user assignment routine associates the unique identifier of a user profile with the failure event object to assign responsibility for preventing the failure event.
US11729200B2

Aspects of the disclosure relate to dynamic message analysis using machine learning. Using one or more automated methods, a computing platform may identify relationships between message sender domains and message recipient domains. After identifying the relationships, the computing platform may apply a security scoring process to a message sender domain to compute a weighted security score for the message sender domain. The computing platform may determine a weighted grade for the message sender domain based on the weighted security score for the message sender domain. Based on the weighted grade for the message sender domain, the computing platform may execute one or more enhanced protection actions associated with the message sender domain.
US11729187B2

Devices and methods for protecting server devices from physical attacks use an encrypted overlay network to securely communicate between a trusted network and one or more host computer devices in communication with the trusted network. The devices and methods may generate VPN tunnels to communicate directly with individual host computer devices. The devices and methods may securely transmit data packets between the trusted network and the host computer devices using the VPN tunnels.
US11729184B2

System and methods for detecting covert payloads of data within an IP network are provided. Activity of at least a portion of the IP network is monitored for datagrams comprising error messages. A selection of the datagrams including the error messages occurring with a regularity above a predetermined threshold are identified.
US11729179B2

In one embodiment, in access gateway comprising at least one computer processor, a method for real-time data protection may include: (1) receiving a user login comprising a user identifier; (2) retrieving, using an in-memory entitlements graph, a role definition for the user identifier, wherein the role definition comprises allowed actions, entitled assets, and a system account; (3) receiving a selection of a requested asset from the entitled assets and a requested action from the allowed actions; (4) verifying the user's entitlement to access the requested asset and perform the requested action with the system account using the in-memory entitlement graph based on the user identifier, the system account, the requested asset, and the requested action; and (5) authorizing the user's entitlement to access the requested asset and perform the requested action with the system account substantially at a time of requested access.
US11729178B2

Systems and methods for generating account permissions for an account on a computing system are provided. In some embodiments, application programming interface (API) interactions involving an external application and the computing system are used to generate a corresponding set of account permissions for the account. API permissions for the external application may also or instead be used to generate the set of account permissions for the account. The set of account permissions may enable the account to access the same resources on the computing system as the external application, which may avoid granting the account overly broad access to the computing system.
US11729177B2

A computer-implemented method includes receiving an authentication request from an external device for authenticating an application on the external device, and receiving a plurality of information items in connection with the authentication request from a plurality of different externally residing information sources. The authentication request is then evaluated, which includes evaluating each of the plurality of information items, to determine an authentication status of the application. Based on the authentication status, the device is then selectively permitted access to private information through the application. A computer system and/or machine-readable media may be provided to perform some or all steps of the method.
US11729160B2

One embodiment of the present invention provides an enhanced authentication system. During operation, the system can obtain, from a remote device of a client, an authentication request prior to the exchange of application layer web traffic associated with a piece of resource protected by the system. The system can then determine, in the authentication request, an indicator indicating whether certificate-based authentication is enforced for the client. If certificate-based authentication is enforced for the client, the system can initiate certificate-based authentication for the client. On the other hand, if certificate-based authentication is not enforced for the client, the system can send information associated with a user interface to the client. The user interface can allow the client to select an authentication method from a set of authentication methods supported by the system.
US11729151B2

A computerized process is described for transferring content from a first entity to a second entity including first transferring separately and via a database entity for each content: a content identifier, content rights, a content encryption key, a content initialization vector, a content encryption count, and a first entity identifier. Included with the transferred content is a transfer identifier, which is encrypted. After transferred content is received by the second entity, the transfer identifier is used to retrieve the content rights, content encryption key, content encryption initialization vector, content encryption count, and first entity identifier from the database entity. After receiving the content, both actions taken on the content and disposition of the content at the second entity are controlled according to the content rights by the first entity and the status of the content is reported to the first entity via a database entity.
US11729149B2

Techniques are provided herein for coordinated data obfuscation. In one example, a first network device in a network obtains, from a controller in or having communication to the network, an obfuscation parameter that is further obtained by one or more second network devices in the network. Personally Identifiable Information (PII) of the first network device has a given logical relationship to PII of the one or more second network devices. Based on the obfuscation parameter, the first network device obfuscates the PII of the first network device to generate obfuscated PII of the first network device. The obfuscated PII of the first network device has the given logical relationship to obfuscated PII of the one or more second network devices. The first network device provides the obfuscated PII of the first network device to a server configured to collect the obfuscated PII of the one or more second network devices.
US11729138B1

Systems and methods for facilitating communication between multiple private networks with conflicting IP addresses are provided. The system comprises a virtual computing device configured to allocate blocks of shadow IP addresses to first and second private networks. A first bridge device is connected to the first private network and configured to receive a packet from a first host in the first private network. The packet comprises a destination address corresponding to a second host in the second private network. The first bridge device is configured to route the packet to the virtual computing device if the destination address is in a block of shadow IP addresses. A second bridge device is connected to the second private network and configured to receive the packet from the virtual computing device and translate the destination address to a corresponding native IP address.
US11729136B2

To serve User Equipment (UEs) in a wireless communication network, a control-plane transfers a co-located User Plane Function (UPF) request for a wireless access point ID to a naming system. The naming system detects a co-location translation fault for the wireless access point ID and transfers the wireless access point ID to a controller. The controller determines co-located UPFs for the wireless access node. The controller transfers co-location translation information for the wireless access point ID and co-located UPF IDs to the naming system. The control-plane transfers another co-located UPF request for the wireless access point ID to the naming system. The naming system translates the wireless access point ID into the set of co-located UPF IDs. The naming system transfers the co-located UPF IDs to the control-plane. The control-plane signals the co-located UPFs to serve the UE over the wireless access point.
US11729134B2

Detection of algorithmically generated domains is disclosed. A DNS query is received. Markov Chain analysis is performed on a domain included in the received query. A determination of whether the received query implicates an algorithmically generated domain is made based at least in part on a result of the Markov Chain analysis.
US11729132B2

An apparatus for facilitating instant messaging communications between clients of different instant messaging service provider networks is provided. The apparatus includes translation logic for translating received communications related to an instant messaging service, the received communications associated with an external instant messaging service provider network and formatted according to a secondary protocol. The translation logic translates the received communication from the secondary protocol to a primary protocol, the primary protocol native to a receiving service provider network. The communication may then be routed to a client of the primary network according to the native, primary protocol.
US11729126B2

A computing device and computer-implemented method to provide user-control short message service (SMS). The method begins with converting by a server, one or more user preferences into each third-party specific filter for one of a plurality of third-party servers. Next, a server, accesses data using at least one of API calls, web scraping, file transfer protocol (FTP), http methods, or a combination thereof, data using the third-party specific filter in a plurality of third-party formats from the plurality of third-party servers, wherein the data in the plurality of third-party formats from the plurality of third-party servers Next, the data in the third-party format is filtered, which has been accessed according to user preferences, the user preferences including a mobile device identifier. Next, the data in the third-party format is converted which as specified by the user preferences into a format compatible with the SMS protocol or an instant message for receipt by a messaging app. Finally, the data is sent in which has been converted into the SMS format or instant message to the mobile device as specified by the mobile device identifier.
US11729124B2

A system in which existing email protocols are leveraged to exchange information between two or more client devices. An email includes an embedded serialized object that comprises instructions to inform one or more behaviors of an email client application performed upon receiving the email or at a later time.
US11729123B2

Systems and methods for sending content are provided. One embodiment of a method includes identifying content provided to a user, receiving an indication that the user desires to share the content to a recipient, and determining a content provider that provided the content to the user and a preferred content provider of the recipient. Some embodiments are configured for determining an address associated with the recipient and providing instructions for the preferred content provider to provide the content to the recipient.
US11729121B2

A network of chatbots is provided. The network may include a user-facing router for receiving queries and a plurality of chatbots. Each chatbot included in the plurality of chatbots may identify a single logical grouping of a domain, identify a limited number of intents from each other chatbot included in the plurality of chatbots and communicate with each other chatbot included in the plurality of chatbots. When the router receives a query, the router may receive the query with an associated domain. The router may select a chatbot based on the received domain. The router may direct the query to the selected chatbot. The selected chatbot may determine that the domain associated with the query is incorrect. The selected chatbot may identify a second chatbot based on a hook included in the query and identified within the selected chatbot. The selected chatbot may transfer the query to the second chatbot.
US11729116B2

Systems and methods for handling soft zoning violations comprise assigning a first target device and an endpoint device that is coupled to a switch port of a Fibre Channel (FC) switch to a zone(s). In embodiments, in response to the endpoint device logging into the FC switch, sampled traffic that originates at the endpoint device and ingresses at the switch port may be obtained. In response to determining that the sampled traffic comprises a second traffic that is intended for a second target device that has not been assigned to the zone(s), some action to restrict the second traffic may be performed such as to restrict the non-assigned traffic and prevent devices from sending potentially harmful traffic to other devices that are not assigned to a same zone.
US11729115B2

A network switch includes a receive port configured to receive data and two or more parallel first paths each configured to receive a first copy of the data, perform a check on the first copy, and generate a protection for the first copy. One or more first voter elements are configured to receive second copies of the data and to crosscheck the second copies. A processing section is configured to process one or more of the second copies. Two or more parallel second paths are each configured to receive a third copy of the data and perform multiple checks on the third copy including a check based on the protection. One or more second voter elements are configured to receive fourth copies of the data and to crosscheck the fourth copies. A send port is configured to send one or more of the fourth copies to a next network element.
US11729107B2

A distributed computing system, such as may be used to implement an electronic trading system, supports a notion of fairness in latency. The system does not favor any particular client. Thus, being connected to a particular access point into the system (such as via a gateway) does not give any particular device an unfair advantage or disadvantage over another. That end is accomplished by precisely controlling latency, that is, the time between when request messages arrive at the system and a time at which corresponding response messages are permitted to leave. The precisely controlled, deterministic latency can be fixed over time, or it can vary according to some predetermined pattern, or vary randomly within a pre-determined range of values.
US11729101B1

A load balancing component may obtain, from a plurality of packet forwarding components of the network device, indications of load balancing metrics associated with a plurality of communication links that the plurality of packet forwarding components use to forward packet data. The load balancing component may determine, based on the load balancing metrics, aggregate load balancing metrics associated with respective communication links of the plurality of communication links. The load balancing component may identify an imbalance in load balancing metrics. The load balancing component may determine, based on the imbalance, a load balancing schedule that indicates traffic distributions for the plurality of packet forwarding components. The load balancing component may provide indications of the traffic distributions to the plurality of packet forwarding components to permit the plurality of packet forwarding components to forward packet data based on the indications of the traffic distributions.
US11729098B2

An example first server host includes processor circuitry to: connect a virtual network interface card (vNIC) of the first server host to a first physical network interface card (pNIC) and a second pNIC of the first server host; establish an inter-switch link between first and second switches, the first switch and the first server host in a first network fabric, the second switch and a second server host in a second network fabric; and cause transmission of a first and second network packets from the vNIC of the first server host, the first and second network packets to be delivered to the second server host via the inter-switch link, the first network packet to be transmitted via the first pNIC when utilization of the first pNIC does not satisfy a threshold, the second network packet to be transmitted via the second pNIC when the utilization satisfies the threshold.
US11729082B2

This disclosure describes techniques for providing information associated with an inter-cluster segment. For instance, system(s) may determine dependencies for first services associated with a first cluster and second dependencies for second services associated with a second cluster. The system(s) may then determine information for interconnections between the first cluster and the second cluster. The information may include at least dependencies for third services included in the inter-cluster segment and/or performance information for the third services. The system(s) may then generate a user interface that includes the first dependencies for the first services, the second dependencies for the second services, and the information for the inter-cluster segment. This way, a user is able to use the user interface to identify both problems occurring within the clusters and/or problems that are caused by the third services in the inter-cluster segment.
US11729078B2

Devices and method are disclosed for a load allocation and monitoring for a resource to be allocated in a network, where the resource to be allocated is a critical resource in terms of supply security for a population group and/or a system, and the critical resource comprises electric power, where the network is subdivided into network units, and each network unit has a network unit controller. In some examples, the method includes storing network unit control methods, network unit parameter data sets, and subnetwork monitoring methods in at least one blockchain; allocating a subnetwork monitoring unit to one part of the network; and transmitting a network unit control method and a network unit parameter data set to each network unit controller of the part of the network, and the transmitting of the network unit control methods and the network unit parameter data sets is cryptographically secured against reading and tampering with the network unit control methods and the network unit parameter data sets in such a manner that the corresponding reading and tampering are precluded to the greatest extent possible and occurs in such a manner that the proper functioning of each network unit controller of the part of the network is ensured; and monitoring the proper function of each network unit controller of the part of the network by means of the subnetwork monitoring unit using a corresponding subnetwork monitoring method.
US11729074B1

Embodiments of the present invention are directed to facilitating performing online data decomposition. In accordance with aspects of the present disclosure, an incoming data point of a time series data set is obtained. Thereafter, an iterative process of estimating trend and seasonality is performed to decompose the incoming data point to a set of data components based on a particular set of previous data points of the time series data set and corresponding data components. Generally, the set of data components for the incoming data point include a trend component, a seasonality component, and a residual component. The set of data components is provided for analysis of the incoming data point, such as, for example, to identify data anomalies.
US11729064B1

A method including determining, by a first device during communication with a second device for establishing a meshnet connection between the first device and the second device, that both the first device and the second device are operating as an initiating device that is responsible for transmitting an initiation communication for establishing the meshnet connection; comparing, based at least in part on determining that both the first device and the second device are operating as an initiating device, a communication condition associated with the first device with a communication condition associated with the second device; and determining, based at least in part on a result of comparing the communication condition, that the first device is to operate as the initiating device or that the second device is to operate as the initiating device. Various other aspects are contemplated.
US11729060B2

A method for forming a cluster of nodes. The method includes obtaining first information associated with a predetermined number of nodes in the cluster. The method also includes determining an administrative role of the first node based on the obtained first information. The method also includes, as a result of determining that the administrative role of the first node is a first role, broadcasting a first broadcast message, thereby enabling a plurality of nodes that are not in the cluster to receive the first broadcast message, wherein the plurality of nodes that are not in the cluster includes at least a second node, the first broadcast message comprising second information for controlling the timing at which each node within the plurality of nodes transmits to the first node a response message responsive to the broadcast message. The method also includes receiving a first response message responsive to the first broadcast message, wherein the first response message was transmitted by the second node. The method also includes, after receiving the first response message, adding the second node to the cluster.
US11729058B1

In an approach to improve the management of multi-cloud environment resources embodiments of the present invention execute provisioning and rerouting mechanisms to maintain continuity in the multi-cloud computing environment despite changes to one or more predetermined factors or an identified problem. Additionally, embodiments predict a future need of a system based on collected data and the executed provision and rerouting mechanisms and analyze use history within the multi-cloud computing environment. Moreover, embodiments identify one or more solutions to address the future needs of the system based on the analysis of the use history; and proactively and autonomously implement the one or more identified solutions based one or more predetermined criteria in the multi-cloud computing environment.
US11729053B1

In some implementations, a system enables users to create dynamically configurable applications that can be dynamically configured and adjusted. An application that runs on the server system in a first configuration is configured using a first configuration template. Data indicating (i) that the application is being accessed on a computing device in the first configuration, and (ii) a request to adjust the first configuration of the application is received. Operations are then performed while the application is being accessed on the computing device in the first configuration. A second configuration template that specifies a second configuration of the application corresponding to the request included in the received data is generated. The application is adjusted using the second configuration template to run in the second configuration. An instruction is provided to the computing device to enable the computing device to access the application running in the second configuration.
US11729049B2

Methods, systems, and devices for wireless communication are described. In some wireless communication systems, a user equipment (UE) may receive control signaling from a base station based on an uplink beam failure. The control signaling may indicate one or more uplink beams for uplink communications, and the one or more uplink beams may be decoupled from a downlink beam for downlink communications by the UE. The UE may transmit a feedback message acknowledging the one or more uplink beams for the uplink communications based on receiving the control signaling. The UE may switch from one or more current uplink beams to the one or more uplink beams indicated via the control signaling during a time period after receiving the control signaling. The UE may transmit the uplink communications using the one or more uplink beams based on the feedback message.
US11729045B2

An aggregated networking device failover system includes an aggregation connected device coupled to first and second aggregated networking devices. The aggregation connected device receives a first aggregation communication from the first aggregated networking device that identifies its first MAC address as an actor MAC address, and a second MAC address of the second aggregated networking device as an alternate actor MAC address. The aggregation connected device then associates the first and second MAC addresses with an aggregated link to the first and second aggregated networking devices. Subsequent to associating the first and second MAC addresses with the aggregated link, the aggregation connected device receives a second aggregation communication from the second aggregated networking device that identifies its second MAC address as an actor MAC address, and the aggregated link remains available in response to that second/actor MAC address being associated with the aggregated link.
US11729044B2

Examples described herein relate to a management system that determines which services to redeploy on one or more platforms. A platform can receive a configuration to perform during a failure of connectivity with a management system. The platform can monitor activity of one or more services. The platform can, based on failure of connectivity with the management system and recovery of connectivity with the management system, provide the monitored activity of one or more services to the management system to influence services re-deployed by the management system. In some examples, based on failure to re-establish a connection with the management system within an amount of time, the platform can connect with the management system using a secondary management interface.
US11729041B2

Systems, devices, and methods of the present invention enhance data transmission through the use of polynomial symbol waveforms (PSW) and sets of PSWs corresponding to a symbol alphabet is here termed a PSW alphabet. Methods introduced here are based on modifying polynomial alphabet by changing the polynomial coefficients or roots of PSWs and/or shaping of the polynomial alphabet, such as by polynomial convolution, to produce a designed PSW alphabet including waveforms with improved characteristics for data transmission.
US11729036B2

Disclosed is a method and apparatus for transmitting and receiving a synchronization signal and a transmission system. In the method, a transmitting node determines a frequency band range in which a carrier is located, and configures or assumes synchronization channel information on the carrier according to the frequency band range, where the synchronization channel information includes at least one of: a subcarrier spacing or orthogonal frequency division multiplexing (OFDM) symbol information of a synchronization channel; and the transmitting node transmits the synchronization signal using the synchronization channel information.
US11729030B2

A de-skew circuit, a de-skew method and a receiver are provided. The de-skew circuit includes N data synchronization circuits and a controller. An nth data synchronization circuit among the N data synchronization circuits includes an nth command detector and an nth buffer. The nth command detector changes an nth command detection signal when an nth input data stream satisfies a single channel condition. The nth buffer stores the nth input data stream in response to a voltage change of the nth command detection signal. The controller receives the nth command detection signal and changes a pop signal when a global channel condition is satisfied. The nth buffer outputs an nth timing-aligned data stream in response to a voltage change of the pop signal.
US11729029B2

A mixed signal receiver includes a first sample and hold (S/H) circuit having a first S/H input terminal to receive an analog input signal and a first S/H output terminal directly coupled to a first common node; a first data slicer having a first slicer input terminal coupled to the first common node; and a first data-driven charge coupling digital-to-analog converter (DAC) including: (i) a DAC input terminal to receive a first digital signal from a first digital output of the first data slicer, (ii) a DAC output terminal directly coupled to the first common node, (iii) a plurality of capacitor modules configured to be pre-charged during a sample phase, and (iv) logic components, wherein when the logic components toggle a voltage on the plurality of capacitor modules, charge is capacitively coupled to or from the first common node during an immediately subsequent hold phase.
US11729023B2

Aspects of this disclosure relate to using artificial intelligence (“AI”) to control integration of software developed by a third-party into an enterprise computing environment subject to more rigorous regulatory and security testing than typically provided by the third-party. AI software development automation tools will deploy third-party scripts to edge servers. Deploying to edge servers allows for integration of the third-party tags into testing environment pipelines. Local storage associated with third-party tags will be at a top-level domain, allowing third-party software tags to be treated as first party without the reputational and technical risks of cross-site storage.
US11729020B2

A transmitting/receiving device for a bus system and a method for reducing an oscillation tendency in the case of coupled-in interferences, in particular, in the transition between different bus states. The transmitting/receiving device has a transmitting stage for transmitting a transmit signal to a first bus wire of a bus of the bus system, and for transmitting the transmit signal to a second bus wire of the bus, and an oscillation reduction module for damping an oscillation of a bus signal arising at terminals for the bus wires when the transmitting/receiving device acts as the transmitter of the transmit signal. The oscillation reduction module includes a first resistor, which is switchable between the first bus wire and a terminal for ground, and the oscillation reduction module including a second resistor, which is switchable between the second bus wire and a terminal for a voltage supply of the bus system.
US11729015B2

Systems, components, and methods for use in a commercial kitchen intelligence system. A network appliance and a plurality of kitchen components are coupled to a data communication network. The network appliance establishes a VPN connection with a portal remote to the commercial kitchen. The network appliance establishes communication with a point-of-sale (POS) system for receipt of POS data. The network appliance facilitates communication among the kitchen components on the data communications network independent of different protocols by which the kitchen components are configured to communicate.
US11729010B2

A message-limiting mechanism for enabling computing devices to self-organize into groups based on network proximity can entail the transmission of values based on hierarchical evaluation such that only a computing device having a most extreme value continues to transmit. The values utilized can be randomly generated and their broadcast can facilitate the identification of computing devices that are proximate, by network distance. Each computing device can retain a most extreme value received, unless a value generated by that computing device itself is more extreme, in which case the computing device can continue periodic broadcasts of its value. Each computing device can report its retained values, or its own value if no values were retained, and groupings can be generated based on the values reported by the computing devices. The grouping of computing devices can then facilitate the identification of peers, including for purposes of downloading content from such peers.
US11729009B1

A system and method and for monitoring an online meeting includes receiving an indication that the online meeting has been started, retrieving meeting metadata associated with the online meeting, meeting content data from the online meeting, and user data associated with one or more meeting invitees; providing at least one of the meeting metadata, meeting content data and the user data to a machine-learning model for detecting a meeting stage for the online meeting in real-time, determining and based on at least one of the detected meeting stage, meeting content data or the user data that a notification about the online meeting should be provided to one of the meeting invitees, generating data for the notification, and providing the data for the notification for display to the meeting invitee.
US11729005B2

Provided is an information processing apparatus including a physical unclonable function (PUF) to generate a unique key using a process variation in a semiconductor manufacturing process, and an encryption unit to encrypt a password and/or bio-information received from a user using the unique key.
US11728999B2

A first computing device may authenticate itself to a second computing device by providing a verifier value based on a private key. The verifier value may be sent to the second computing device, and a session key may be determined based on the private key. A secure message may comprise routing information associated with the first computing device and a hash value based on the routing information and the session key, and the first computing device may communicate with the second computing device using the session key.
US11728996B2

Embodiments disclose systems and methods to broadcast a message among virtual DP accelerators (DPAs). In one embodiment, in response to receiving a broadcast instruction from an application via a communication switch, the broadcast instruction designating one or more virtual DP accelerators of a plurality of virtual DP accelerators to receive a broadcast message, a system encrypts the broadcast message based on a broadcast session key for a broadcast communication session. The system determines one or more public keys of one or more security key pairs each associated with one of the designated virtual DP accelerators. The system encrypts a plurality of the broadcast session key based on the determined one or more public keys. The system broadcasts the encrypted broadcast message, and the one or more encrypted broadcast session keys to the virtual DP accelerators.
US11728994B2

Example embodiments of systems and methods for data transmission between contactless card and receiving devices are provided. In an embodiment, the contactless card may be configured to create a cryptogram based on a plurality of keys and a counter. The cryptogram may be transmitted to the receiving device. The contactless card may be configured to transmit a one-time password to the client device. The counter value may be adjusted each time the one-time password is generated, and the counter may be configured to increment in a non-monotonic sequence, the sequence associated with one or more cryptographic algorithms.
US11728992B2

The disclosed technology is generally directed to secure transactions. In one example of the technology, an enclave is used for executing a cryptlet binary of a first cryptlet. The enclave is a secure execution environment for which results of a secure execution are capable of being attested to have run unaltered and in private, the enclave stores an enclave private key, and the first cryptlet is associated with at least a first counterparty. A cryptlet binding that is associated with the first cryptlet is generated. The cryptlet binding includes counterparty information that is associated with at least the first counterparty. Cryptlet binding information is provided to a cryptlet binding key graph. A location of a hardware security module (HSM) that stores a key that is associated with the first counterparty is received from the cryptlet binding key graph.
US11728989B2

A first apparatus performs a pairing providing process of displaying a provision string on the first apparatus and transmitting the provision string to a server apparatus, the provision string being of a given number of digits that changes every given amount of time in such a manner that, every given amount of time, the provision string is subjected to carrying and a new character is added to the rightmost digit of the provision string. A second apparatus transmits an acceptance string to the server apparatus, the acceptance string being input from the second apparatus based on the provision string displayed on the first apparatus. The server apparatus compares the provision string with the acceptance string, and determines that pairing is established between the first apparatus and the second apparatus when the provision string and the acceptance string match each other.
US11728987B2

Secure vehicular part communication is described herein. An example apparatus can include a processing resource, a memory having instructions executable by the processing resource, and a vehicular communication component coupled to the processing resource. The vehicular communication component can be configured to, in response to receiving a part public key and a part signature from a part communication component associated with a vehicular part, verify an identity of the vehicular part based on the part signature. The vehicular communication component can be configured to, in response to verifying the identity, generate a vehicular public key. The vehicular communication component can be configured to encrypt vehicular data using the part public key. The vehicular communication component can be configured to provide the vehicular public key and the vehicular data to the part communication component. The vehicular communication component can be configured to receive, from the part communication component, part data encrypted using the vehicular public key.
US11728978B2

Some embodiments of the present specification provide a method and an apparatus for establishing a trusted channel between a user and a trusted computing cluster. According to the method, when a user wants to establish a trusted channel with a trusted computing cluster, the user only negotiates a session key with any first trusted computing unit in the cluster to establish the trusted channel. Then, the first trusted computing unit encrypts the session key using a cluster key common to the trusted computing cluster to which the first trusted computing unit belongs, and sends the encrypted session key to a cluster manager. The cluster manager transmits the encrypted session key in the trusted computing cluster, so that other trusted computing units in the cluster obtain the session key and join the trusted channel. Thus, the user establishes a trusted channel with the entire trusted computing cluster.
US11728973B2

An access management system and method provisions credentials to access a resource, such as external web user accounts. Credentials are generated, encrypted and stored. To access the resource, encrypted credentials are decrypted, masked, and served to users, such that they are not visible to the user requiring access. The user is unaware of the credentials used to authenticate and unable to access the provisioned web resources outside set parameters.
US11728967B2

A circuit includes a cipher accessing a plurality of read-write memory units configured to handle data tables obtained from a modified mask; wherein the modified mask is being determined from an initial mask and a random value, the random value selecting one or more modifications of the initial mask amongst a plurality of predefined modifications including permutation operations. Developments of the invention describe the use of mathematically optimal or equivalent masks; the use of random values; a range of permutation operations comprising offset shifting and/or rotation and/or XOR operations and/or coprime construction; the use of round masks; the use of a Physically Unclonable Function; the refresh or update of modified masks and/or round masks; and verifications of the optimality and/or integrity of masks. System features (e.g. CPU, co-processor, local and/or remotely accessed external memory storing masks, volatile memory) and computer program products are described.
US11728964B2

A method begins by a processing module of a storage unit of a storage network identifying a first storage format used to store a plurality of encoded data slices in a first memory of the storage unit and continues with the processing module determining to utilize another storage format for storage of the plurality of encoded data slices. The method then continues, with the storage unit selecting a second storage format for storage of the plurality of encoded data slices and initiating migration of the plurality of encoded data slices from the first storage format to storage using the second storage format. Finally, the method continues with updating a performance metric for at least a portion of the storage network while initiating migrating the plurality of encoded data slices.
US11728962B2

Clock generation circuitry includes quadrature locked loop circuitry having first injection locked oscillator circuitry, second injection locked oscillator circuitry, and XOR circuitry. The first injection locked oscillator circuitry receives a first input signal and a second input signal and outputs first clock signals. The first input signal and the second input signal correspond to a reference clock signal. The second injection locked oscillator circuitry is coupled to outputs of the first injection locked oscillator circuitry, and receives the first clock signals and generates second clock signals. The XOR circuitry receives the second clock signals and generates a first clock signal, a second clock signal, a third clock signal, and a fourth clock signal. The frequencies of the first clock signal, the second clock signal, the third clock signal, and the fourth clock signal are greater than the frequency of the reference clock signal.
US11728949B2

In wireless communications for multi-users, an access point may generate a first frame for allocating resources to a plurality of stations. The first frame may contain an indication as to whether a station(s) is allocated at least one of a set of resource units (RUs) of a plurality of RUs, such as a center 26-tone RU. The set of resource units may be based on a channel bandwidth of the wireless communications. The indication may be contained in a common block field of signal fields, such as a common block field of high efficiency (HE) signal content channel(s) of an HE signal field. The station(s) may receive the first frame and determine whether the one of the set of RUs is allocated. The station(s) may transmit a second frame to the access point based on resource allocation information in the first frame. Other methods, apparatus, and computer-readable media are also disclosed.
US11728947B2

Methods, systems, and devices for wireless communication are described in which a user equipment (UE) may transmit one or more uplink communications to multiple transmission-reception points (TRPs). Transmission parameters for each repetition may be based on parameters (e.g., a number of antenna ports, a spatial domain filter or beam, a rank or number of layers, or any combinations thereof) that are determined from an indication of whether the repetitions are to use different sounding reference signal (SRS) resource sets, and indicated SRS resource of each SRS resource set. The indication may include a same number of bits regardless of whether one SRS resource set is used or multiple SRS resource sets are used, and may be based on a prior configuration of the UE.
US11728943B2

Infrastructure equipment for transmitting data to and receiving data from a mobile device on a communications network is described. The infrastructure equipment comprising: transmitter circuitry configured to transmit the data to the mobile device; and controller circuitry configured to control the transmitter circuitry to transmit a first position reference signal in a first subframe and a second position reference signal in a second subframe, wherein the second position reference signal is a time adjusted version of the first position reference signal, the amount of time adjustment being determined by the sample time at which the mobile device samples the position reference signal.
US11728942B2

This disclosure provides methods, devices and systems for data parsing for resource unit (RU) aggregation. A wireless communication device (such as an access point (AP) or a station (STA)) may allocate a set of RUs for a receiving device in a basic service set (BSS). The set of RUs may be associated with multiple bandwidth segments of a bandwidth allocation and may be non-contiguous or contiguous. The wireless communication device may determine a data parsing and encoding scheme for a set of information bits. The data parsing may be implemented at a medium access control (MAC) layer or physical (PHY) layer and the encoding may correspond to a joint encoding or a separate encoding for each RU of the allocation. The wireless communication device may then distribute the coded bits to the set of RUs for transmission.
US11728941B2

A wireless device may receive, during a slot, sidelink data over multiple antenna ports and sidelink control information. The sidelink data is scheduled by the sidelink control information received during the slot. A rank number used for the sidelink data is a same rank number used for transmission of the sidelink control information.
US11728938B2

In a terminal, based on a first parameter included in each of a plurality of downlink control signals, the first parameter indicating a cumulative count of code block groups (CBGs) configuring each of a plurality of transport blocks (TBs) assigned by the plurality of downlink control signals, a HARQ-ACK generation unit generates a response signal (HARQ-ACK) for each of the code block groups. A transmission unit collectively transmits the response signals for each of the code block groups.
US11728933B2

Methods, systems, and devices for wireless communications are described that support group-based acknowledgment feedback techniques. Two or more different groups of downlink transmissions may each have an associated transport block (TB) level or code block group (CBG) level group-based acknowledgment feedback, and a base station may transmit downlink control information to a UE that indicates one or more parameters that are used to determine which downlink transmissions are to be reported in the group-based feedback at a TB level, CBG level, or combinations thereof. Based on the parameters in the downlink control information, the UE may determine the feedback to be reported, and a timing for when to transmit the feedback to the base station.
US11728927B2

This disclosure describes systems, methods, and devices related to fixed-to-fixed shaping encoding. A device may determine a mapping table associated with uniformly distributed bits into amplitudes with desired probabilities. The device may predict a number of output bits for an input block. The device may apply padding as needed based on the predicted number of output bits.
US11728918B2

Methods, systems, and devices for wireless communications are described. A user equipment (UE) may transmit an uplink payload in a wireless communications system. The UE may identify a set of sequences configured for conveying a payload including a set of bits, where each sequence of the set of sequences is orthogonal to each other sequence of the set of sequences. The UE may select a first sequence from the set of sequences based on a mapping between the set of sequences and payload values corresponding to the set of bits. The UE may transmit the payload including the set of bits using the first sequence.
US11728908B2

A test system includes a radio frequency (RF) shielded chamber and an antenna array in the RF shielded chamber. The antenna array includes groups of antenna elements and power combiners. Each group of antenna elements is matched to a matching group of antenna elements by virtue of being coupled to a respective power combiner for both the group and the matching group. The antenna array is configured, by virtue of spacing apart the antenna elements by at least half of a wavelength of a test signal for testing a wireless device in the RF chamber, so that power delivered to output ports of the antenna array is substantially uniform regardless of where the wireless device is placed within the RF chamber.
US11728901B2

Optical signal receivers, systems, and methods of operating the same include a non-line of sight optical signal receiver configured to receive and detect a complex modulated optical signal through a non-line of site propagation path from an optical transmitter, comprising an optical resonator configured to receive the complex modulated optical signal through the non-line of sight propagation path, and to convert the complex modulated optical signal to an intensity modulated signal, and a detector configured to convert the intensity modulated signal into an electrical signal, the electrical signal having an amplitude indicative of an intensity of the intensity modulated signal from the optical resonator, and to provide a detected signal.
US11728895B2

Related to an optical communication module, the optical communication module comprises a main body, an optical communication assembly and a second circuit board. The main body comprises a housing and a first circuit board disposed on the housing. The housing and the first circuit board together form an airtight cavity of the main body, and the first circuit board comprises two first electric interfaces. The optical communication assembly is accommodated in the airtight cavity and comprises a substrate, an optical communication element and a second electric interface. The optical communication element disposed on the substrate. One of the two first electric interfaces of the first circuit board is electrically connected to the second electric interface. The second circuit board comprises a third electric interface and the other one of the two first electric interfaces of the first circuit board is electrically connected to the third electric interface.
US11728893B1

A method, system, and apparatus for parsing incoming frames; classifying the frames by information contained in a header of the ethernet frame; and performing an action on the classification.
US11728892B2

In order to make a communicable distance in an optical cable of an optical signal which is subjected to amplitude modulation longer, a re-modulation device is provided with: an acquisition unit that acquires, from a first modulation optical signal obtained by performing first amplitude modulation on an optical signal with second data sent from a modulation transmission device to a demodulation reception device, the second data; and a re-modulation unit that, when determining passing of the first modulation optical signal, sends, to the demodulation reception device, a second modulation optical signal obtained by performing second amplitude modulation on the inputted optical signal with the second data.
US11728890B1

A resource allocation method is provided for a non-orthogonal multiple access distribution of access network users communicatively coupled to a single transport medium. The method includes steps of allocating a first frequency and time domain resource to a first user and a second frequency and time domain resource to a second user of the access network users, obtaining channel information regarding a particular communication channel of the access network for which resources are allocated, grouping the first user with the second user based on an overlap of the first frequency and time domain resource with the second frequency and time domain resource, and assigning the first user to a different power allocation resource than the second user within the frequency and time domain overlap.
US11728889B2

An optical reception device includes a coefficient update section which optimizes a dispersion coefficient used in compensation of wavelength dispersion of a received signal obtained by receiving an optical signal according to a coherent detection method and a phase rotation amount used in compensation of a nonlinear optical effect of the received signal, and a transmission characteristic estimation section which estimates a transmission characteristic of a transmission line by using the optimized dispersion coefficient and the optimized phase rotation amount.
US11728879B2

There is presented a wireless device for dual-polarization beamforming. The wireless device comprises an antenna array. The antenna array comprises antenna elements of mutually orthogonal polarizations and a baseband chain. The antenna elements of both polarizations are operatively connected to the baseband chain. There is also presented a method for dual-polarization beamforming as performed by such a wireless device.
US11728878B2

The present disclosure provides methods and systems for locally suppressing interference in RF communications by satellites and related methods of using such systems. In some aspects, the interference suppression is performed by one or more small form factor satellites (e.g., CubeSats).
US11728877B2

Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a user equipment (UE) may receive, from a base station, information associated with identifying a communication diversity configuration. The UE may receive, from the base station, a transport block on a downlink in accordance with the communication diversity configuration. Numerous other aspects are provided.
US11728875B2

Selective radiation of radio frequency (RF) reference beams in a wireless communications system (WCS) based on user equipment (UE) locations is disclosed. The WCS may include a radio node that communicates RF communications signals in a coverage area via RF beamforming. Thus, the radio node is required to periodically radiate a number of RF reference beams in different directions of the coverage area to help UEs to identify a best-possible RF beam(s). However, radiating the RF beams in different directions periodically can increase power consumption of the radio node, particularly when the UEs are concentrated at a handful of locations in the coverage area. In this regard, the radio node can be configured to selectively radiate a subset of the RF reference beams based on a determined location(s) of the UE(s) in the coverage area, thus making it possible to reduce computational complexity and power consumption of the radio node.
US11728873B2

A method of wireless communication may include a UE and a base station. The base station may transmit at least one BFD-RS to the UE and the UE may receive at least one BFD-RS from a base station. The UE may transmit an aperiodic BFI report to the base station prior to a beam failure detection. The base station may determine that an early beam failure occurred and initiate a beam failure recovery in response to receiving the aperiodic BFI report from the UE.
US11728869B2

Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a user equipment (UE) may determine, based at least in part on at least one of a plurality of conditions being met, to switch from a static analog beamforming codebook to a dynamic analog beamforming beam weight calculation for selecting beam weights for communications between the UE and a base station. The UE may select the beam weights for the communications using the dynamic beam weight calculation. The UE may communicate, using the beam weights, with the base station. Numerous other aspects are described.
US11728865B2

Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a user equipment (UE) may determine whether a flag is enabled or is disabled, the flag indicating whether channel state information (CSI) associated with a secondary discontinuous reception (DRX) group is permitted to be transmitted outside of an active time associated with a primary DRX group. The UE may selectively transmit the CSI associated with the secondary DRX group in an uplink communication associated with the primary DRX group based at least in part on whether the flag is enabled or is disabled. Numerous other aspects are provided.
US11728858B1

This patent application describes systems, devices, and methods for element-level self-calculation of phased array vectors by a beam forming ASIC using interpolation and a look-up table for calculation of phase setting values such as for fast beam steering.
US11728856B2

Certain aspects of the present disclosure provide techniques for user equipment (UE) antenna panel distribution reporting. Particular aspects provide a method performed by a user equipment (UE), which generally includes determining a set of antenna panels of the UE for uplink antenna panel selection based on at least one criterion and transmitting a report to a base station (BS) including an indication of the determined set of antenna panels of the UE.
US11728844B2

Methods, circuitries, and systems for transmitting data upstream between a first device and a second device and downstream between the second device and the first device are disclosed. A method includes determining an upstream crosstalk effect for an upstream channel and determining a downstream crosstalk effect for a downstream channel. The crosstalk effect includes near end crosstalk from a third device that is non-co-located with respect to the first device and the second device. A data rate of an upstream transmission or downstream transmission is adjusted based on the upstream crosstalk effect and the downstream crosstalk effect.
US11728842B2

Methods, systems, and devices for wireless communication are described to support increasing a sidelink feedback channel reliability. A second user equipment (UE) may transmit a sidelink message to a first UE, and the first UE may provide feedback for the sidelink message via an associated feedback opportunity. The first UE may perform frequency hopping from one symbol to another during the feedback opportunity, may transmit the feedback using multiple physical resource blocks (PRBs) within one symbol of the feedback opportunity, or both. A pattern for frequency hopping, or for the multiple PRBs, or both, may be defined or determined by a base station, the first UE, the second UE, or any combination thereof. In some cases, a pattern for frequency hopping or for PRB bundling may be defined or preconfigured at the first UE, the second UE, or both.
US11728837B2

Methods and devices addressing design of wideband LNAs with gain modes are disclosed. The disclosed teachings can be used to reconfigure RF receiver front-end to operate in various applications imposing stringent and conflicting requirements. Wideband and narrowband input and output matching with gain modes using a combination of the same hardware and a switching network are also disclosed. The described methods and devices also address carrier aggregation requirements and provide solutions that can be used both in single-mode and split-mode operations.
US11728833B2

Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a user equipment (UE) may receive one or more indications of parameters associated with one or more downlink communications transmitted to one or more additional UEs. The UE may receive a downlink communication, including applying digital post distortion (DPoD) correction based at least in part on measurements of the one or more downlink communications transmitted to the one or more additional UEs and the one or more indications of the parameters. Numerous other aspects are described.
US11728828B2

A method and system for decoding low density parity check (“LDPC”) codes. An LDPC code decoder includes LDPC decoding circuitry comprising a Q message generator and a P sum adder array. The Q message generator combines an R message from a previous iteration with a P message to produce a Q message. The P sum adder array adds the P message to a difference of an R message from a current iteration and the R message from the previous iteration to produce an updated P message.
US11728824B2

An analog circuit including a voltage regulator, at least one analog-to-digital convertor (ADC), at least one comparator and a multiplexer is provided. The voltage regulator generates an output voltage. The at least one ADC generates at least one digital signal. The multiplexer is configured to conduct the at least one comparator to either the voltage regulator or the at least one ADC. When the voltage regulator is triggered, the multiplexer conducts the at least one comparator to the voltage regulator, and the voltage regulator generates the output voltage according to an output of the at least one comparator. When the at least one ADC is triggered, the multiplexer conducts the at least one comparator to the at least one ADC, and the at least one ADC generates the at least one digital signal according to the output of the at least one comparator.
US11728817B2

The present invention relates to data communication and electrical circuits. More specifically, embodiments of the present invention provide a clock and data recovery (CDR) architecture implementation for high data rate wireline communication links. In an embodiment, a CDR device includes a phase detector, a loop filter, and a fractional-N PLL. The fractional-N PLL generates output clock signal based on output of the loop filter. There are other embodiments as well.
US11728811B2

A key reuse circuit is provided, a key component is used to generate a DC voltage and a startup-trigger-signal according to a user input, the switch circuit generates a key trigger signal according to the DC voltage, the control circuit reverses a level of an enable-regulation-signal when a time duration of the key trigger signal is longer than or equal to a preset time duration, or determines a key value of the key component when the time duration of the key trigger signal is shorter than the preset time duration, the power on/off regulation circuit generates a voltage-conversion-enable-signal according to the startup-trigger-signal and an enable-regulation-signal having a first level, the buck circuit generates a first voltage according to the power voltage and the voltage-conversion-enable-signal and stops generating the first voltage when the voltage-conversion-enable-signal is terminated, so that reuse of a general key in the key matrix is realized.
US11728802B2

A drive circuit includes a plurality of first control wirings, a plurality of first balance resistors, a first common wiring, a first switch, a plurality of second control wirings, a plurality of second balance resistors, a second common wiring, a second switch, a sensor configured to detect a fault in controlled switches, and a controller configured to control opening and closing of the first switch when the sensor detects no fault, and control opening and closing of the second switch when the sensor detects the fault.
US11728799B2

A delay measurement circuit includes a first skew circuit disposed proximate to a first bonding pad configured to receive a first clock signal having a first frequency. The delay measurement circuit includes a second skew circuit disposed proximate to a second bonding pad configured to receive a second clock signal having a second frequency. The first and second skew circuits each have a first mode of operation as zero-delay-return path and a second mode of operation as a synchronized pass path. The delay measurement circuit includes a pair of conductive traces coupled to the first skew circuit, another pair of conductive traces coupled to the second skew circuit, a time-to-digital converter circuit, and a switch circuit configured to selectively couple the time-to-digital converter circuit to the first skew circuit via the pair of conductive traces and the second skew circuit via the other pair of conductive traces.
US11728796B2

An inverted group delay circuit is provided. The inverted group delay circuit can offset a group delay between a pair of signals. In a non-limiting example, the inverted group delay circuit can be configured to offset a group delay (e.g., negative group delay) between a time-variant voltage and a time-variant envelope of an analog signal. More specifically, the inverted group delay circuit can output an inverted time-variant voltage having an opposing phase and time-adjusted relative to the time-variant voltage to thereby offset the group delay between the time-variant voltage and the time-variant envelope. As such, the inverted group delay circuit can be provided in a power management integrated circuit (PMIC) to improve timing alignment between a time-variant voltage(s) and a time-variant analog signal(s) at a power amplifier(s), thus helping to reduce potential amplitude distortion when the analog signal(s) is amplified by the power amplifier(s).
US11728794B2

A data receiving circuit is provided. The data receiving circuit includes a first transistor, a second transistor, a third transistor, and a latch circuit. The first transistor has a gate configured to receive an input signal. The latch circuit is configured to output an output signal in response to the input signal. The second transistor has a gate configured to receive a first signal and a drain connected to the latch circuit. The third transistor has a gate configured to receive the first signal and a drain connected to the latch circuit. The second transistor and the third transistor are configured to provide a current to the latch circuit in response to the first signal.
US11728793B1

A four-stage gated ring oscillator having four gated amplifiers configured in a ring topology and comprising a first pair of gated amplifiers, controlled by a first phase of an two-phase input clock, interleaved with a second pair gated amplifiers, controlled by a second phase of the two-phase input clock; and two cross-coupling latches configured to provide cross-coupling between the first pair of gated amplifiers and the second pair of gated amplifiers.
US11728791B2

A switch control circuit and a switch control method are provided. The switch control circuit includes a load, an inductor, a control switch, and a sensing resistance connected in series to an input power source; an integrator that integrates a sensing voltage and a load current setting voltage to generate an integrated signal; a comparator that compares the integrated signal and a bias voltage; a switch driver that controls the control switch based on an output of the comparator and an output of an off time controller; and a gate sensor that outputs, to the integrator, a gate sensing signal that senses a time when an input of a gate terminal of the control switch becomes a low level. An integration operation is started from a position in which the integrated signal is located lower than the bias voltage, when an input of the gate terminal becomes a high level.
US11728783B2

An acoustic wave device includes a (111)-oriented silicon substrate, a silicon nitride layer, a silicon oxide layer, a lithium tantalate layer, and an IDT electrode on the lithium tantalate layer. When the wavelength determined by the electrode finger pitch of the IDT electrode is λ, the thickness of the silicon nitride layer, SiN [λ], the thickness of the silicon oxide layer, SiO2 [λ], the thickness of the lithium tantalate layer, LT [λ], and one of the Euler angles of the lithium tantalate layer, LTθ [deg.], are thicknesses and an angle in ranges in which the phase of a first higher-order mode is about −20° or less.
US11728776B2

The present disclosure discloses a switched capacitor amplifier apparatus for improving level-shifting. An amplifier includes input terminals and output terminals. Two capacitor circuits correspond to signal input terminals and signal output terminals and each includes a sampling capacitor circuit, a load capacitor and a level-shifting capacitor. The sampling capacitor circuit samples an input signal from one of the signal input terminals to one of the input terminals. An electrical charge neutralizing capacitor is coupled between the output terminals. The load capacitor and the level-shifting capacitor are charged according to an output from one of the output terminals in an estimation period. The level-shifting capacitor charges the load capacitor in a level-shifting period to generate an output signal at one of the signal output terminals. The electrical charge neutralizing capacitor receives and provides electrical charges from the output terminals to the level-shifting capacitor respectively in the estimation period and the level-shifting period.
US11728771B2

A circuit apparatus includes an oscillation circuit that generates an oscillation signal, a first buffer circuit that outputs a first clock signal based on the oscillation signal, a second buffer circuit that outputs a second clock signal based on the first clock signal, a first terminal electrically couplable to a first node via which the first buffer circuit outputs the first clock signal, and a second terminal electrically coupled to a second node via which the second buffer circuit outputs the second clock signal, and the rise period of the first clock signal is shorter than the rise period of the second clock signal.
US11728767B2

A forecast engine is configured to analyze aerial and/or satellite images depicting a geographic area to identify the existence of solar panels within the geographic area at different times. Based on the installation time of each solar panel, the forecast engine estimates the solar power generation capacity of the solar panel. The forecast engine also analyzes meteorological data, including weather forecasts, to estimate a level of insolation at each solar panel within the geographic area across a range of times. The forecast engine can then determine the total amount of solar power generation within the given geographic area at a particular time using the solar power generation capacity of each solar panel and the level of insolation at each solar panel at the particular time.
US11728766B2

An integrated photovoltaic (PV) panel-water sorption layer system that includes a PV panel having a front face that is configured to receive solar light for generating electrical current, and a back face that is opposite to the front face; and an atmospheric water harvesting device attached to the back face of the PV panel. The atmospheric water harvesting device is configured to cool down the PV panel by evaporating absorbed atmospheric water based on heat received from the PV panel.
US11728757B2

A system and a method for controlling temperature inside electrical and electronics systems. The method includes sensing temperature of an inverter section by a temperature sensor, the inverter section including one or more electronic components. The method also includes determining, by a microcontroller, a temperature zone based on the sensed temperature and transmit a command to an inverter based on the temperature zone. The method further includes controlling speed of a compressor by an inverter based on the command.
US11728753B2

According to some embodiments, a method for controlling a motor comprises generating a stall threshold based on a torque generating current parameter associated with the motor. A motor stall condition is identified based on a torque generating voltage parameter associated with the motor violating the stall threshold. Operation of the motor is adjusted responsive to identifying the motor stall condition.
US11728751B2

A controller is adapted to be coupled to a brushless direct current (DC) motor and includes an analog-to-digital converter (ADC), a computing device, and a driver. The ADC is configured to receive an analog back electromotive force (BEMF) waveform from the brushless DC motor and sample the analog BEMF waveform to produce a digital BEMF waveform. The computing device is coupled to the ADC and is configured to receive the digital BEMF waveform and determine a position and a speed of the rotor based on the digital BEMF waveform. The driver is coupled to the ADC and the computing device and is configured to receive the position and the speed of the rotor and provide a drive signal based on the position and the speed of the rotor of the brushless DC motor.
US11728750B2

A vibration actuator that is capable of reducing difference of vibration velocities when a contact member is driven using a plurality of vibrators includes a vibrator device and the contact member, which moves relative to the vibrator device. The vibrator device includes the plurality of vibrators, which are connected in series, and a plurality of inductors, which are connected in parallel to the respective vibrators.
US11728749B2

The disclosure provides a single-stage isolated bidirectional converter and a control method thereof. The converter includes: a first full-bridge circuit unit, a half-bridge circuit unit, a second full-bridge circuit unit, a phase-shift inductor unit, a transformer and a filter capacitor. The transformer includes a first winding and a second winding, and the first winding is provided with a center tap. The center tap is connected to the first port, two ends thereof are connected to the midpoints of the two bridge arms of the first full-bridge circuit unit through the phase-shift inductor unit, and two ends of the second winding are connected to the midpoints of the two bridge arms of the second full-bridge circuit unit. Two ends of the first full-bridge circuit unit are connected to two ends of the half-bridge circuit unit; two ends of the half-bridge circuit unit are connected to two ends of the filter capacitor.
US11728742B2

A power conversion apparatus capable of supplying a required reactive power while dynamically changing a dead band near 0 reactive current and maintaining a balance of DC voltage is provided. The power conversion apparatus including a three-level converter, a PWM controller for the three-level converter, an input current detector of the three-level converter, a coordinate converter that converts the current into a d-axis and q-axis current feedback, the reactive power control unit that controls a reactive power and outputs an reactive current reference, a d-axis current control unit having a dead band part for setting the d-axis current reference with hysteresis characteristics in the q-axis current feedback, and outputs the d-axis voltage reference, a q-axis current control unit that outputs a q-axis voltage reference based on the q-axis current reference, an inverse coordinate converter that outputs a three-phase AC voltage command based on the d-axis and q-axis voltage reference.
US11728737B2

An apparatus may include an electric power converter and pre-charge circuitry. The electric power converter may include a first circuit, a second circuit and an energy transfer device. The first circuit may be connected to a power supply. The second circuit may be connected to a load. The energy transfer device may have a first side connected to the first circuit and a second side connected to the second circuit. The pre-charge circuitry may be connected to a capacitor of the first circuit. The capacitor may be connected to the first side of the energy transfer device. The pre-charge circuitry may be configured to charge the capacitor during a pre-charge mode of the electric power converter. The electric power converter may be configured to exit the pre-charge mode and enter an energy transfer mode responsive to a charge level of the capacitor reaching a threshold pre-charge level.
US11728736B2

A flyback converter includes a synchronous rectifier switch transistor controlled by a controller. The controller cycles the synchronous rectifier switch transistor to lower an output voltage by transferring energy from a secondary-side output capacitor to a primary-side input capacitor.
US11728735B2

A converter using a planar transformer includes an input device that receives a first voltage, a transformer including a first planar transformer and a second planar transformer that reduce the first voltage, and an output device that outputs the first voltage as a second voltage, wherein the first voltage is greater than the second voltage, and the input device provides a current to a primary winding coil of each of the first planar transformer and the second planar transformer through a first current path and a second current path in which current directions are different with each other, and includes a plurality of inductors connected in parallel with the primary winding coil of each of the first planar transformer and the second planar transformer.
US11728734B2

The present invention suppresses influence of control due to the delay time in voltage switching between a plurality of different voltages. A DC/DC converter comprises: a main circuit including a switching circuit; a control unit that performs discrete control by discrete control toward a command value; and a switching signal generation unit that generates a switching signal that drives the switching circuit. The control unit calculates the pulse width ΔT(k) of the switching signal having the delay time Td as a parameter as an operation amount of discrete control performed every control period Ts. The switching signal generation unit generates a switching signal based on the pulse width ΔT(k) obtained by the calculation in the control unit. The main circuit switches the voltage level by driving the switching circuit based on the switching signal of the switching signal generation unit.
US11728729B1

A semiconductor package includes a VLSI semiconductor die and one or more output circuits connected to supply power to the die mounted to a package substrate. The output circuit(s), which include a transformer and rectification circuitry, provide current multiplication at an essentially fixed conversion ratio, K, in the semiconductor package, receiving AC power at a relatively high voltage and delivering DC power at a relatively low voltage to the die. The output circuits may be connected in series or parallel as needed. A driver circuit may be provided outside the semiconductor package for receiving power from a source and driving the transformer in the output circuit(s), preferably with sinusoidal currents. The driver circuit may drive a plurality of output circuits. The semiconductor package may require far fewer interface connections for supplying power to the die. Multi-output POL circuits may be used in conjunction with on-chip rail-selection and regulation circuitry to further improve efficiency. A three-stage power conversion system includes off-package, on-package and on-chip conversion stages.
US11728721B2

A voltage converter powers a load. The voltage converter includes a first power converter and a second power converter. The first power converter produces an intermediate voltage and a first output current derived from an input voltage. The first power converter supplies the intermediate voltage to the second power converter. The second power converter produces a second output current based on the intermediate voltage received from the first power converter. An output node of the voltage converter outputs a sum of the first output current and the second output current to produce an output voltage.
US11728716B2

A stator assembly and a center disk spindle double-rotor motor, includes a stator carrier and a winding core body; a through slot is formed in an end surface of the stator carrier in a penetrating manner; and the winding core body is arranged in the through slot. The center disk spindle double-rotor motor includes a transmission shaft, a stator assembly and rotor assemblies; the stator assembly is arranged on the transmission shaft; the transmission shaft can rotate relative to the stator assembly; the transmission shaft is fixedly provided with the rotor assemblies on two sides of the stator assembly. The whole center disk spindle double-rotor motor uses a double-rotor structure; and by means of the stator assembly of a specific structure, and in combination with the rotor assembly, the motor has beneficial effects of high efficiency, high power, large torque, low loss, light mass, good heat dissipation and the like.
US11728706B2

An electric motor assembly includes a stator and a rotor configured to rotate relative to the stator. The stator includes a stator core including a yoke that has a ring shape and a plurality of teeth radially coupled to an inner surface of the yoke, a stator coil that is wound around the stator core, and an insulator disposed between the stator core and the stator coil. The insulator includes a yoke insulator that is coupled to the yoke with a first coupling tolerance defined between the yoke insulator and the plurality of tooth insulators, and a plurality of tooth insulators that are coupled to the plurality of teeth, respectively, with a second coupling tolerance defined between the yoke and the plurality of teeth. The first coupling tolerance is less than the second coupling tolerance.
US11728705B2

A rotating electrical machine is equipped with a stator including a stator winding and a stator core with slots. The stator winding includes phase coils each of which is wound in the slots and connected at an end to a phase terminal and at the other end to a neutral point. The phase coils are each made up of unit coils connected in series between a corresponding one of the phase terminals and the neutral point and connected together using connecting conductors. Each of the phase coils includes two or more reversing connecting conductors each of which orients a direction in which the connecting conductor extends from the (i+1)th unit coil to the (i+2)th unit coil to be opposite to that in which the connecting conductor extends from the ith unit coil to the (i+1)th unit coil. This coil layout ensures a desired degree of electrical insulation in the stator.
US11728702B2

A rotor for an electric machine includes pairs of magnets with a bridge region therebetween. Lamination that comprise the rotor may define openings in the bridge region between the magnets of each of the pairs. A clip may be installed in the openings and a bonding material may fill the remainder of the bridge region.
US11728701B2

This canned motor (10) is provided with a rotor (14); a cylindrical rotor can (42) that houses the rotor (14); an end plate (40) that covers an opening of the rotor can (42) in the axial direction and is joined to the rotor can (42); a rotating shaft (16) that passes through the rotor (14) and the end plate (40); and an annular wall (46) that surrounds the outer circumference of the rotating shaft (16), is joined to or integrated with the end plate (40), and is joined to the entire circumference of the rotating shaft (16) at an end thereof in the axial direction. The thickness of the end plate (40) is larger than the thickness of the annular wall (46).
US11728698B2

Embodiments of a small brushless motor include a two-pole rotor and a stator having four slots into which electrical coils are placed. Additional embodiments of a small brushless motor include a two-pole rotor and stator having eight slots into which four, six, or eight electrical coils are placed. The stator may include a means for limiting cogging. The small brushless motor having a high torque constant, low coil resistance, low coil inductance, and high thermal conductivity is provided.
Patent Agency Ranking