摘要:
In a dynamic drive circuit for light-emitting diodes, at least one of the rise and fall times of the current flowing through the light-emitting diode is elongated to reduce the higher harmonic components contained in the current.
摘要:
A biological observation apparatus includes a light source that radiates illumination light onto an observation region that includes a biological specimen; a CCD that acquires a macro image of the observation region; a light source that radiates excitation light onto the biological specimen; a micro-image acquisition unit that acquires a micro image of the biological specimen; an identification-information storing unit that stores identification information of the biological specimen; a biological-specimen specifying unit that extracts identification information of the biological specimen by performing image processing on the macro image, and specifies a biological specimen for which the extracted identification information corresponds to the identification information stored in the identification-information storing unit; and a pan controller that moves a capturing range of the micro-image acquisition unit such that the biological specimen is included in the viewing range of the micro image.
摘要:
A precursor of a molecular probe for imaging of pancreatic islets is provided. The precursor includes a polypeptide represented by any one of the following formulae (1) to (12), or a polypeptide having a homology with the foregoing polypeptide: *-DLSKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (1) *-LSKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (2) *-SKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (3) *-KQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (4) *-DLSK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (5) *-LSK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (6) *-SK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (7) *-K*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (8) DLSK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (9) LSK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (10) SK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (11) K*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (12)
摘要:
Example systems and methods relate to a video game in which multiple players each supply inputs to a respective input device to control a corresponding game character in a game world. Movements and actions of each game character are controlled in accordance with a first game character control operation during the playing of the video game. If one or more conditions is satisfied by one of the players, the one player's game character is protected from harm in the game world. Movements and actions of the protected game character are controlled in accordance with a second game character control operation. The protecting of the one player's game character is stopped in response to one or more protecting stopping conditions, whereby the game character is again controllable in accordance with the first game character control operation. If all game characters are protected, current playing of the video game ends.
摘要:
In one embodiment, a liquid crystal display device having a plurality of pixels includes a first substrate having an insulating substrate, a first detection element extending in a first direction above the insulating substrate, a second detection element extending in a second direction crossing the first direction and an insulating film provided between the first and second detection circuits. A second substrate is arranged opposing to the first substrate so as to hold a liquid crystal layer therebetween. A detection circuit is provided on the first substrate to detect change of electrostatic capacitance between the first and second detection elements. At least one of the first and second detection elements is an element required for operating the liquid crystal layer.
摘要:
A main player operates a controller while viewing a monitor game image displayed on a monitor. A sub player operates a terminal device while viewing a terminal game image displayed on an LCD of the terminal device. A game image that is substantially identical to the monitor game image viewed by the main player is displayed on the LCD. By touching a touch panel provided on a screen of the LCD of the terminal device, the sub player can generate various events at a position in a game world corresponding to a touched position.
摘要:
An object of the invention is to simplify the setting of a printing condition when printing an object displayed by a browser. The invention is an information processing method in an image forming apparatus capable of printing an object displayed by a browser that includes the steps of searching, if a printing instruction is input, storage unit in which a printing condition of an object when printed is stored in association with a storage location of the object (step S702), reading a printing condition corresponding to a storage location of an object being displayed when the printing instruction was input, based on a result of the search in step S702 (step S703), and printing the object being displayed, based on the printing condition read in step S703 (steps S704, S705).
摘要:
A liquid crystal display device includes first and second display panels each including scan lines arranged in a row direction, signal lines arranged in a column direction, and pixels arranged in a matrix at intersections of the first scan lines and the first signal lines. The first display panel and the second display panel are set in a non-display mode and in a display mode, respectively. Shift registers and buffer circuits connected to respective groups of scan lines sequentially drive respective group of scan lines in the first display panel during a vertical blanking time of the second display panel. The pixels of the first display panel are driven to refresh by writing an image signal for a black display in the first display panel.
摘要:
An object of the invention is to provide an equol-containing fermented soybean hypocotyl material that is useful for foods, pharmaceutical preparations, cosmetic products, etc.The equol-containing fermented soybean hypocotyl material of the invention is obtained by fermenting soybean hypocotyls using at least one microorganism having an equol-producing ability by utilizing at least one daidzein compound selected from the group consisting of diadzein glycosides, daidzein, and dihydrodaidzein.
摘要:
Example systems and methods relate to a multi-player video game in which multiple players each supply inputs to a respective input device to control a corresponding game character in a scrolling-type game world displayed on a display screen. A first predetermined input supplied by one of the players to the respective input device protects the one player's game character from harm in the game world and the protected game character moves based on the scrolling/non-scrolling state of the game world in accordance with the movement of one or more unprotected characters. The protecting of the one player's game character is stopped in response to one or more protecting stopping conditions, whereby the game character is again controllable by the one player in response to inputs to the respective input device.