摘要:
An apparatus for shaping plastic preforms into plastic containers, including a plurality of blow molding stations which each have a cavity in which the plastic preforms can be shaped into plastic containers. The blow molding stations are arranged on a movable carrier and each have a stretching rod which stretches the plastic containers in their longitudinal direction by a movement in a stretching direction. A fluid-actuated drive device is provided for driving the stretching rod in the stretching direction. The apparatus includes a guide cam which is arranged in a stationary manner and by means of which the stretching rod can be moved counter to the stretching direction as a function of a movement of the blow molding station. At least one portion of the guide cam is adjustable and, for example, by virtue of this adjustment a dependency of the movement of the stretching rod on the movement of the blow molding station can be varied.
摘要:
A method for blow molding containers in blow molds of a device operated with the recovery of air from the blow molds, where operation is accomplished consecutively in a preblow stage with a low pressure and at least two further blow stages with respective higher pressures, and where subsequently, in a recovery phase with several pressure stages, air is fed from the respective blow mold, air from the blow mold is first fed into the volumes allocated to the preblow stage, with priority over a feeding at least into the volume allocated to the pressure stage following the preblow stage. Further, a blow control and a control means for the pressure in the volume, where the blow control has a program section for primarily feeding air first into the volume, and possibly for limiting the pressure in the volume to a multiple of the pressure.
摘要:
A conveyance device, particularly relating to a shaking pocket star wheel for conveying containers, with a carrier, a reception element and a reception opening for the conveyed material. The reception element is fixed against the force of a spring in a manner so it can be withdrawn and swiveled about an axis of rotation. To simplify the construction of the conveyance device, and to make the design more universal and operationally reliable, a spring is arranged in such a manner that the force is applied substantially at a right angle to the conveyance direction.
摘要:
Process of manufacture, and method of use of a carrier-supported catalyst with transition metal phthalocyanines for the oxidizing treatment of exhaust gases which gases contain volatile compounds containing oxygen and/or nitrogen, which catalyst can be obtained by charging a carrier with at least one transition metal phthalocyanine and activation of the charged carrier with (i) a gas mixture which contains nitrogen oxide and/or oxygen, at temperatures between room temperature and 500.degree. C., or with (ii) a solution which contains nitric acid and/or an oxidation agent.
摘要:
A method and an apparatus for the economical production of containers from thermoplastic material with a blow moulding machine (3) are disclosed. For shaping the containers at least one first pressure channel (21) is provided, supplying a first pressure. Likewise at least one second pressure channel (22) is provided, supplying a second pressure, wherein the first pressure is lower than the second pressure. The air in the first pressure compartment (21) is used for the pre-blowing or for other blowing steps of the containers. The air in the second pressure compartment (22) is used for the final blowing of the containers. The final blown containers are vented into the first pressure compartment (21). A control unit is provided which maintains an essentially constant pressure in the first pressure compartment during the pre-blowing and the venting into the first pressure compartment. A pressure level of the external pressure reservoir (20) can be adjusted accordingly.
摘要:
A blowing machine used to produce containers of correctly temperatured preforms in blowing stations including correctly temperatured blow molds, having functional get-up components such as at least electric servomotors assigned to at least the blowing stations to control and/or monitor secondary functions of functional get-up components during production. In order to bring at least some of said functional get-up components for secondary functions to the correct temperature, an electrically operated, controllable liquid temperature control system is supplied by at least one temperature control device and is integrated into the blowing machine and guided through the functional get-up components.
摘要:
Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.
摘要:
Cyclobutane-1,2-dicarboxylic esters of the formula: ##STR1## in which R.sup.1 is a C.sub.1-8 -alkyl group, an optionally substituted mono- or bicyclic cycloaliphatic group having 3 to 10 ring carbon atoms, an optionally substituted aryl or arylalkyl group or an optionally substituted saturated heterocyclic group and R.sup.2 is either C.sub.1-4 -alkyl or both radicals R.sup.2 together form a group of the formula --(CH.sub.2).sub.n --(n is 2 to 4), are prepared from the corresponding maleic or fumaric esters and ketene acetals in the presence of a Lewis acid and a sterically hindered base. The reaction is stereoselective when optically active maleic or fumaric esters are employed. The cyclobutane-1,2-dicarboxylic esters (I), in particular those having trans configuration, are intermediates in the synthesis of pharmaceutically active compounds.
摘要:
An apparatus for shaping plastic preforms into plastic containers, including a plurality of blow moulding stations which each have a cavity in which the plastic preforms can be shaped into plastic containers. The blow moulding stations are arranged on a movable carrier and each have a stretching rod which stretches the plastic containers in their longitudinal direction by a movement in a stretching direction. A fluid-actuated drive device is provided for driving the stretching rod in the stretching direction. The apparatus includes a guide cam which is arranged in a stationary manner and by means of which the stretching rod can be moved counter to the stretching direction as a function of a movement of the blow moulding station. At least one portion of the guide cam is adjustable and, for example, by virtue of this adjustment a dependency of the movement of the stretching rod on the movement of the blow moulding station can be varied.
摘要:
A method for blow molding containers in blow molds of a device operated with the recovery of air from the blow molds, where operation is accomplished consecutively in a preblow stage with a low pressure and at least two further blow stages with respective higher pressures, and where subsequently, in a recovery phase with several pressure stages, air is fed from the respective blow mold, air from the blow mold is first fed into the volumes allocated to the preblow stage, with priority over a feeding at least into the volume allocated to the pressure stage following the preblow stage. Further, a blow control and a control means for the pressure in the volume, where the blow control has a program section for primarily feeding air first into the volume, and possibly for limiting the pressure in the volume to a multiple of the pressure.