摘要:
A new method of anchoring a growing peptide chain during chemical synthesis to a solid-phase support is devised. Novel amino acid derivatives and peptide derivatives, both unbonded and bonded to a solid-phase support, are also provided.
摘要:
Method of peptide synthesis, comprising the steps of a. synthesizing a peptide linked to a solid phase which peptide comprises at least one cysteine, homo- or nor-cysteine residue, which cysteine is protected in its side chain by a S-tert.butyl-sulphenyl group b. either coupling N-terminally a further amino acid having a 3,3′-dithio-(1-carboxy-propyl)-propionyl-radical on its Nα or deprotecting the Nα of the N-terminal amino acid and reacting the free Nα with 3,3′-dithio-propionic acid imide to yield the corresponding Nα-3,3′-dithio-(1-carboxy-propyl)-propionamide or deprotecting the Nα of the N-terminal amino acid and reacting the free Nα with a compound of formula IV R7-S—S—[CH2]2—COOH IV wherein R7 is aryl-, including heteronuclear aryl, or is aralkyl-, alkylaryl- or alkyl-, which may be further substituted with halogeno, amido, ester, carboxy or ether, and c. reacting the peptide with a S-tert.Butyl-sulphenyl-protection group removing reagent, and d. cyclizing the peptide by means of disulfide bond formation, preferably cyclizing the peptide in the presence of air and/or oxygen.
摘要:
A single-stage process is described for the preparation of primary aliphatic polyamines of the formula in which R1 and R2 independently of one another are hydrogen, methyl, ethyl or aminomethyl, by reaction of polyalcohols on a Co/Ni catalyst with supercritical ammonia in the presence of hydrogen.
摘要:
Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.
摘要:
Optically active 1-(p-methoxybenzyl)-1,2,3,4,5,6,7,8-octahydroisoquinoline having the formula (I) is prepared by asymmetric hydrogenation of the corresponding 3,4,5,6,7,8-hexahydro-compound or of the new 1-(p-methoxybenzyl)-3,4,5,6,7,8-hexahydroisoquinoline dihydrogenated phosphate in the present of chiral iridium-phosphine complexes. This product is an intermediate product in the synthesis of cough-relieving dextromethorphanne and analgesic levorphanol. ##STR1##
摘要:
A process including preparing a polyurethane in the presence of a catalyst which is a bicyclic amidine of the formula: wherein A is selected from the group consisting of —CR1R2—CR3R4—CR5R6—, —CR1R2—CR3R4—CR5R6—CR7R8—, and —CR1R2—CR3R4—CR5R6—CR7R8—CR9R10—, wherein the substituents in A are in each case numbered starting from the nitrogen atom, and B is selected from the group consisting of —CR11R12—CR13R14—, —CR11R12—CR15R16—CR13R14—, and —CR11R12—CR15R16—CR17R18—CR13R14—, and R1 to R18 are, in each case independent of one another, hydrogen, C1-C4-alkyl, aryl, or C1-C4-alkyl that is substituted with hydroxyl, amino, C1-C4-alkylamino or mercapto, with the proviso that at least one of the substituents R1 to R18 is (1) hydroxyl, (2) amino, (3) C1-C4-alkylamino, (4) mercapto, (5) C1-C4-alkyl substituted with hydroxyl, (6) C1-C4-alkyl substituted with amino, (7) C1-C4-alkyl substituted with C1-C4-alkylamino, (8) C1-C4-alkyl substituted with mercapto, and (9) at least two of (1) to(8).