摘要:
A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DESK* QMEEEAVRLFIEVVLK* NGGPSSGAPPPSK-NH2 (1) *-LSK* QMEEEAVRLFIEWLK* NGGPSSGAPPPSK-NH2 (2) *-SK* QMEEEAVRLFIEWLK* NGGPSSGAPPPSK-NH2 (3) *-K* QMEEEAVRLFIEWLK* NGGPSSGAPPPSK-NH2 (4), wherein *- indicates that an α-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.
摘要:
To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2 (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.
摘要:
Provided is a radioactive labeled compound capable of detecting a secondary mutation of an epidermal growth factor receptor, where the compound is represented by Formula (1) or a pharmaceutically acceptable salt thereof, where R1, R2, and Y are as defined.
摘要:
Provided is a radioactive labeled compound capable of detecting a secondary mutation of an epidermal growth factor receptor, where the compound is represented by Formula (1) or a pharmaceutically acceptable salt thereof, where Y, L1, R1 and R2 are as defined.
摘要:
A peptide that can be used as an imaging probe for GLP-1R is provided. In an embodiment, a polypeptide is represented by the following formula (3); (Sequence ID No. 3) Xaa1-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg- Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser (3) where Xaa1 represents an aspartic acid in which a —Y—X′ group binds to an α-amino group, X′ includes a chelating site and a radioactive metal nuclide chelated by the chelating site, the chelating site being diethylenetriaminepentaacetic dianhydride (DTPA) or 1,4,7-triazacyclononnane-N,N′,N″-triacetic acid (NOTA), and Y represents a linker including a group selected from the group consisting of —CH2—(C6H4)—, —NH—C(═S)—, —NH—(CH2)5—C(═O)—, and a combination thereof.
摘要:
Provided is a radioactive labeled compound capable of detecting a secondary mutation of an epidermal growth factor receptor, where the compound is represented by Formula (1) or a pharmaceutically acceptable salt thereof, where Y, L1, R1 and R2 are as defined.
摘要:
Provided is a radioactive labeled compound capable of detecting a secondary mutation of an epidermal growth factor receptor, where the compound is represented by Formula (1) or a pharmaceutically acceptable salt thereof, where R1, R2, and Y are as defined.
摘要:
A peptide that can be used as an imaging probe for GLP-1R is provided. In an embodiment, a polypeptide is represented by the following formula (3); (Sequence ID No. 3) Xaa1-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg- Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser (3) where Xaa1 represents an aspartic acid in which a —Y—X′ group binds to an α-amino group, X′ includes a chelating site and a radioactive metal nuclide chelated by the chelating site, the chelating site being diethylenetriaminepentaacetic dianhydride (DTPA) or 1,4,7-triazacyclononnane-N,N′,N″-triacetic acid (NOTA), and Y represents a linker including a group selected from the group consisting of —CH2—(C6H4)—, —NH—C(═S)—, —NH—(CH2)5—C(═O)—, and a combination thereof.
摘要:
Provided is a medicament comprising the compound represented by the following general formula (1) or a salt thereof: In the formula, R1, R2, R3, R4, R5, X1, X2, and X3 are defined. Methods for producing various radioactive compounds are also provided.
摘要:
Provided is a compound represented by general formula (1) or a salt thereof as well as a medicine containing the compound or the salt. In the formula, R1, R2, R3, R4, R5, X1, X2, and X3 are defined.