摘要:
Provided is a medicament comprising the compound represented by the following general formula (1) or a salt thereof: In the formula, R1, R2, R3, R4, R5, X1, X2, and X3 are defined. Methods for producing various radioactive compounds are also provided.
摘要:
Provided is a compound represented by general formula (1) or a salt thereof as well as a medicine containing the compound or the salt. In the formula, R1, R2, R3, R4, R5, X1, X2, and X3 are defined.
摘要:
It is intended to provide a radioactive compound that has higher selectivity for CYP11B2 than that for CYP11B1, exhibits highly selective accumulation in the adrenal gland compared with blood and organs adjacent to the adrenal gland, and permits commercial supply. The present invention provides a radioactive quinolinone derivative represented by the predetermined general formula or a salt thereof.
摘要:
A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DESK* QMEEEAVRLFIEVVLK* NGGPSSGAPPPSK-NH2 (1) *-LSK* QMEEEAVRLFIEWLK* NGGPSSGAPPPSK-NH2 (2) *-SK* QMEEEAVRLFIEWLK* NGGPSSGAPPPSK-NH2 (3) *-K* QMEEEAVRLFIEWLK* NGGPSSGAPPPSK-NH2 (4), wherein *- indicates that an α-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.
摘要:
Provided is a radioactive labeled compound capable of detecting a secondary mutation of an epidermal growth factor receptor, where the compound is represented by Formula (1) or a pharmaceutically acceptable salt thereof, where Y, L1, R1 and R2 are as defined.
摘要:
Provided is a radioactive labeled compound capable of detecting a secondary mutation of an epidermal growth factor receptor, where the compound is represented by Formula (1) or a pharmaceutically acceptable salt thereof, where R1, R2, and Y are as defined.
摘要:
A peptide that can be used as an imaging probe for GLP-1R is provided. In an embodiment, a polypeptide is represented by the following formula (3); (Sequence ID No. 3) Xaa1-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg- Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser (3) where Xaa1 represents an aspartic acid in which a —Y—X′ group binds to an α-amino group, X′ includes a chelating site and a radioactive metal nuclide chelated by the chelating site, the chelating site being diethylenetriaminepentaacetic dianhydride (DTPA) or 1,4,7-triazacyclononnane-N,N′,N″-triacetic acid (NOTA), and Y represents a linker including a group selected from the group consisting of —CH2—(C6H4)—, —NH—C(═S)—, —NH—(CH2)5—C(═O)—, and a combination thereof.
摘要:
Provided is a radioactive labeled compound capable of detecting a secondary mutation of an epidermal growth factor receptor, where the compound is represented by Formula (1) or a pharmaceutically acceptable salt thereof, where R1, R2, and Y are as defined.
摘要:
Provided is a radioactive labeled compound capable of detecting a secondary mutation of an epidermal growth factor receptor, where the compound is represented by Formula (1) or a pharmaceutically acceptable salt thereof, where Y, L1, R1 and R2 are as defined.
摘要:
To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2 (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.