Abstract:
The present invention relates to assay methods used for detecting the presence of PIF, and to PIF peptides identified using this assay. In particular, the present invention relates to flow cytomery assays for detecting PIF. It is based, at least in part, on the observation that flow cytometry using fluorescently labeled antilymphocyte and anti-platelet antibodies demonstrated an increase in rosette formation in the presence of PIF. It is further based on the observation that flow cytometry demonstrated that monoclonal antibody binding to CD2 decreased in the presence of PIF. The present invention further relates to PIF peptides which, when added to Jurkat cell cultures, have been observed to either (I) decrease binding of anti-CD2 antibody to Jurkat cells; (ii) increase expression of CD2 in Jurkat cells; or (iii) decrease Jurkat cell viability. In additional embodiments, the present invention provides for ELISA assays which detect PIF by determining the effect of a test sample on the binding of anti-CD2 antibody to a CD2 substrate.
Abstract:
The present invention provides nucleotide and amino acid sequences that identify and encode a new protein with homology to pregnancy-associated plasma protein-A (PAPP-A). We denote this protein PAPP-A2. The cDNA encoding PAPP-A2 was derived from human placenta. The present invention also provides for antisense molecules to the nucleotide sequences which encode PAPP-A2, expression vectors for the production of purified PAPP-A2, antibodies capable of binding specifically to PAPP-A2, hybridization probes or oligonucleotides for the detection of PAPP-A2-encoding nucleotide sequences, genetically engineered host cells for the expression of PAPP-A2, use of the protein to produce antibodies capable of binding specifically to the protein, methods for screening for pathologies in pregnant and non-pregnant patients that are based on detection of PAPP-A2 antigen in human body fluids or PAPP-A2-encoding nucleic acid molecules, use of the protein to screen for agents that alter the protease activity of PAPP-A2, use of the protein as a therapeutic target for such agents, and use of the protein as a therapeutic agent in relevant pathological states. Methods for screening for altered focal proliferation states in pregnant and/or non-pregnant patients, which include detecting levels of PAPP-A2, are also described. The present invention also provides the identification of a natural substrate of PAPP-A2, insulin-like growth factor binding protein (IGFBP)-5.
Abstract:
A method for preventing or for treating cancer in a mammal, where the cancer cells express at least a part of an alpha fetoprotein molecule at the cell surface, the method comprising the step of creating an immune response in the mammal to at least part of the amino acid sequence of an alpha fetoprotein molecule, where the immune response comprises activating alpha fetoprotein peptide specific T lymphocytes against the cancer cells. A composition for preventing or for treating cancer comprising a peptide having at least part of the sequence of alpha fetoprotein.
Abstract:
The present invention relates to a method for diagnosing a tumor in a patient said method comprising measuring the concentration of Progesterone-Induced Immunomodulatory Protein (PIBF) or a derivative thereof or a fragment thereof in the sample taken from the patient, and to the use of an anti-PIBF antibody, PIBF or a derivative thereof or a fragment thereof, and a polynucleotide encoding PIBF, respectively, as an anti-tumor medicine.
Abstract:
The invention relates to antibiotically effective peptides, which are purified out of human and animal tissue extracts for the purpose of medically and commercially using them as medicaments. The peptides can be proteolytically produced by using biotechnological and recombinant methods, chemical synthesis, and from corresponding precursor proteins. The antibiotically effective peptides can be used in a suitable galenic preparation as medicaments/animal medicaments and foodstuff additives.
Abstract:
Adenovirus vectors replication specific for cells expressing α-fetoprotein (AFP) and their methods of use are provided. By providing for a transcriptional initiating regulation dependent upon AFP expression, virus replication is restricted to target cells expressing AFP, particularly hepatocellular carcinoma cells. The adenovirus vectors can be used to detect and monitor samples for the presence of AFP-producing cells as well as to kill selectively malignant cells producing AFP.
Abstract:
This invention encompasses a composition for killing target cells, such as tumor cells. The composition comprises a first and a second adenoviral vector that have complementary function and are mutually dependent on each other for replication in a target cell. One of said adenoviral vectors has a target cell-activated promoter or a functional deletion that controls and limits propagation of the adenoviral vectors in the target cells which directly or indirectly kills the target cells. One of the adenoviral vectors comprises a gene encoding a protein which is expressed in the target cells and can induce anticancer immune responses. The target cells may be hepatoma, breast cancer, melanoma, colon cancer, or prostate cancer cells, for example. The vectors of this invention may also be utilized to treat other diseases such as restenosis, in which case the target cell may be a vascular smooth muscle cell, for example.
Abstract:
Adenovirus vectors replication specific for cells expressing alpha -fetoprotein (AFP) and their methods of use are provided. By providing for a transcriptional initiating regulation dependent upon AFP expression, virus replication is restricted to target cells expressing AFP, particularly hepatocellular carcinoma cells. The adenovirus vectors can be used to detect and monitor samples for the presence of AFP-producing cells as well as to kill selectively malignant cells producing AFP.
Abstract:
The production of anti-sera to small peptides or polypeptides which cross react with uteroglobin is disclosed giving rise to diagnostic and detection as well as immunocontraceptive methods. In particular, a method for controlling the fertility of a female mammal, especially a feral mammal such as wild rabbits, is described. This method comprises administering to a mammal a peptide or polypeptide which stimulates an immune response, said response including production of elements which bind uteroglobin and reduce fertility of said female mammal. Peptides or polypeptides which may be used in the method include peptides or polypeptides comprising (a) uteroglobin or a fragment thereof, a peptide or polypeptide derived from uteroglobin, or a variant or peptide mimetic of any of these, and (b) a carrier protein. This may be applied in a conventional vaccine formulation, including using viral vaccine vectors. Preferably, they are formulated into compositions which are suitable for oral administration. Novel peptide or polypeptides for use in the method, their production and other aspects are also described and claimed.
Abstract:
A process for the detection of cpn10 in serum or other biological fluids including the steps of (i) raising antibody to cpn10; (ii) reacting said antibody with a sample of biological fluid suspected of containing cpn10; and (iii) detecting the presence of cpn10 in said sample by a signal amplification resulting from production of a cpn10-antibody complex. There is also provided a process for promotion of cell growth or immunosuppression including the step of administration of cpn10 to a mammalian subject. There is also provided recombinant cpn10 having the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD.