摘要:
Provided herein are compounds comprising peptides that bind Bfl-1. Also provided are compositions containing these peptides and methods of using such peptides in the treatment of cancer that include administering to a subject one of the peptides.
摘要:
The present disclosure provides methods for gene editing in stem cells. The methods generally involve modifying the stem cells by increasing the level of an apoptosis regulator in the stem cells; and introducing into the modified stem cells a genome editing composition.
摘要:
The invention provides compositions and methods for inhibiting protein- protein interactions with cap-binding protein 80 (CBP80). In one embodiment, the invention provides compositions comprising linear and macrocylic peptides. In one embodiment, the invention provides methods for treating cancer, heart disease, autoimmune disorders, obesity, diabetes, or chronic inflammation disorders associated with the PGC1 family of co-activators.
摘要:
The present invention relates to an activator of beclin 1-Vps 34 complex for use in the treatment and/or prevention of a bone growth disorder. The activator may be a polypeptide, a polynucleotide, a vector, a host cell or a small molecule. In particular the activator may be a Beclin 1 peptide or a fragment or a derivative thereof, a mTORC1 inhibitor or a BH3 mimetic. The present invention also relates to pharmaceutical composition comprising said activator.
摘要:
This disclosure describes chimeric antigen receptors for expression in a Natural Killer (NK) cell, pharmaceutical compositions that include NK cells (and/or iPSCs) modified to express a chimeric antigen receptor, and methods involving such chimeric antigen receptors. Generally, the chimeric antigen receptor includes an ectodomain that includes an antigen recognition region, a transmembrane domain linked to the ectodomain, and an endodomain linked to the transmembrane domain. The endodomain can include a signaling peptide that activates an NK cell.
摘要:
The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders
摘要:
The present disclosure provides novel compositions and methods suitable for specifically eliminating target cells (e.g., cancer cells) without affecting non-target cells (e.g., non-cancer cells). For example, CRISPR system and the compositions of the present disclosure can be employed to specifically introduce a suicidal gene into a cancer cell in the loci of a cancer-specific target sequence, which as a result of chromosomal re-arrangement or translocation in a cancer cell presents a cancer specific sequence for a guide RNA and CAS to be recognized and such sequence is absent in a non-cancer cell. Consequently, the specific introduction of the composition(s) to cancer-specific site(s) and integration of suicide gene in the target genome, which is inapplicable to normal cells for lack of the site(s), leads to selective elimination of cancer cells but not non-cancer cells, and therefore render novel therapeutic methods and compositions for cancer treatment.
摘要:
T cell receptors (TCRs) that have higher affinity for the Survivin antigen are provided. The high affinity TCRs were engineered through the generation of mutational libraries of TCRs in a single-chain format, followed by selection for improved stability and affinity on the surface of yeast (i.e. directed evolution). In embodiments, the engineered TCRs can be used in soluble form for targeted delivery in vivo, or as genes introduced into T cells in an adoptive T cell setting.
摘要:
The present invention relates to short peptides based on the amino acids sequence of the N-terminal domain of the human mitochondrial protein voltage-dependent anion channel 1 (VDAC) and to peptide conjugates further comprising a cell permeability enhancing moiety. The peptides, peptide conjugates and pharmaceutical composition comprising same are useful for treating diseases characterized by cell hyperproliferation or resistance to cell death, particularly cancer.
摘要:
The present application relates to the field of immunology, more particularly to diseases and disorders characterized by insufficient numbers of Foxp3 positive regulatory T cells (T regs ). The mechanisms of the homeostatic processes that regulate the Treg numbers were studied, and it was found that Mcl-expression is critical for Treg survival. As most studies aiming at increasing T reg numbers to modulate immunity only achieve a transient increase, this finding has important therapeutic consequences: combined Mcl-1 and Foxp3 expression results in a stable population of T reg cells; enhancing T reg numbers will result in clinical improvement in many severe immune disorders.