Abstract:
An object of the invention is to provide an equol-containing fermented soybean hypocotyl material that is useful for foods, pharmaceutical preparations, cosmetic products, etc.The equol-containing fermented soybean hypocotyl material of the invention is obtained by fermenting soybean hypocotyls using at least one microorganism having an equol-producing ability by utilizing at least one daidzein compound selected from the group consisting of diadzein glycosides, daidzein, and dihydrodaidzein.
Abstract:
According to one embodiment, a display apparatus includes signal lines, and pixels. Each of the pixels includes a pixel electrode and a pixel control switch, and being classified into any of pixel groups. Each of the pixel groups includes a memory, and a sensor circuit which is configured to provide data for a detection signal to the memory when detecting the input information. The pixel control switch is configured to switch the voltage level of the pixel electrode in accordance with data for the display signal input via the signal line and the data for the detection signal input from the memory.
Abstract:
A microscope apparatus capable of removing liquid from an observation field of view of a dry objective lens, when an immersion objective lens is switched to the dry objective lens, is provided. The microscope apparatus includes a specimen XY stage on which a specimen is placed, a dry objective lens and an immersion objective lens that collect light from the specimen, a movable revolver that selectively disposes one of these objective lenses at a position facing the specimen, and a control unit that controls the specimen XY stage and movable revolver such that the relative positions in the XY direction are changed until the immersion objective lens is disposed at a non-observation region of the dry objective lens, prior to switching of these objective lenses.
Abstract:
Manual operation means controls a motion of an operation target character in accordance with operation data outputted from an input device. Automatic motion control means controls the motion of the operation target character in accordance with a series of pieces of operation data which are prepared in advance. Game control means performs a first process when a first condition is satisfied as a result of control of the motion of the operation target character by the manual operation means only in a predetermined interval in a game in progress, performs a second process which is different from the first process when a second condition is satisfied, and executes the first when the control of the motion is performed by the automatic motion control means in at least a part of the interval regardless of whichever condition is satisfied.
Abstract:
A pretensioner (1) for a seat belt system (7) of an automobile includes a gas generator (2), a gas pipe (3), a piston (5) and a coupling mechanism (6). The gas generator is adapted to generate a high-pressure gas when a shock occurs in the automobile due to a collision, a sudden stop, etc. The gas pipe is formed to receive therein the gas generator. The gas pipe is adapted to guide the high-pressure gas released from the gas generator to the piston. The piston is adapted to be moved or displaced by the pressure of the high-pressure gas guided by the gas pipe. The coupling mechanism is connected to each of the piston and a buckle (8) of the seat belt system (7). The coupling mechanism is adapted to wind up or pull a seat belt (9) in accordance with the movement of the piston to increase a restraining force of the seat belt.
Abstract:
The digital signal recording/reproducing apparatus inputs a digital signal having a control flag as to a temporary copy permission, and records the digital signal temporarily into a recording medium in accordance with conditions in the control flag, then reproducing the digital signal temporarily from the recording medium in accordance with the conditions in the control flag. The recording/reproducing of the temporary copy is permitted, depending on the following conditions: The recording medium's type, the reproducing point-in-time, the reproducing time-period, and the reproducing frequency. With this method employed, even in a program permitting no recording, the temporary recording/reproducing is permitted under a condition of being limited to the time-shift recording on the receiving side.
Abstract:
A test controller switches the operation of output stages in an integrated circuit between a normal operation mode and a test mode. The output stages are respectively connected to switch elements. A level shifter generates a switch signal for controlling activation and deactivation of the switch elements in accordance with the normal operation mode and the test mode.
Abstract:
A regulator circuit includes an output transistor that generates an output current in accordance with a control voltage that is applied to a control terminal of the output transistor. A differential amplifier provides feedback control of the control voltage in accordance with a level of the output current. A phase compensation circuit is connected to the differential amplifier and the control terminal of the output transistor. The phase compensation circuit adjusts an output impedance of the differential amplifier. The phase compensation circuit includes a variable resistor that decreases the output impedance of the differential amplifier when the output current increases.
Abstract:
A precursor of a molecular probe for imaging of pancreatic islets is provided. The precursor includes a polypeptide represented by any one of the following formulae (1) to (12), or a polypeptide having a homology with the foregoing polypeptide: *-DLSKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (1) *-LSKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (2) *-SKQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (3) *-KQMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (4) *-DLSK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (5) *-LSK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (6) *-SK*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (7) *-K*QMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (8) DLSK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (9) LSK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (10) SK*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (11) K*QMEEEAVRLFIEWLK*NGGPSSGAPPPS-NH2 (12)
Abstract:
Manual operation means controls a motion of an operation target character in accordance with operation data outputted from an input device. Automatic motion control means controls the motion of the operation target character in accordance with a series of pieces of operation data which are prepared in advance. Game control means performs a first process when a first condition is satisfied as a result of control of the motion of the operation target character by the manual operation means only in a predetermined interval in a game in progress, performs a second process which is different from the first process when a second condition is satisfied, and executes the first when the control of the motion is performed by the automatic motion control means in at least a part of the interval regardless of whichever condition is satisfied.