摘要:
A tracheal tube ventilation apparatus to more effectively remove expired gases. In one preferred embodiment, one or more leak holes are created in the side walls of an endotracheal tube so that expired gases can leak out of the endotracheal tube above the larynx, such as into the back of the mouth (i.e., oropharynx). Each leak hole might advantageously have a diameter between 0.5 and 4.0 mm. In another preferred embodiment, a tube is attached to a proportionately larger leak hole (e.g., up to 8.0 mm) so that the expired gases can be directed away from the leak hole to a specific location, such as directed out of the mouth. In the case of mechanically controlled ventilation, a positive end expiratory pressure can be applied to this tube to mechanically assist with the process of exhaling. In each of these embodiments, it is preferred, but not required, that the endotracheal tube be an ultra-thin walled, two stage tube so as to further assist in the reduction of resistance to the flow of oxygen/air.
摘要:
This invention is directed toward a multideterminant human immunodeficiency virus type 1 (HIV-1) peptide which comprises a covalently linked T-helper (Th) lymphocyte epitope, cytotoxic T-lymphocyte (CTL) epitope, and an epitope capable of eliciting a neutralizing antibody response (AbN), wherein said peptide has the following amino acid sequence: KQIINMWQEVGKAMYAPPISGQIRRIHIGPGRAFYTTKN. This peptide has the further characteristic of evoking all three of these immune responses in hosts having a broad range of major histocompatibility complex (MHC) types. This peptide is useful as an immunogen to generate broad immune responses in a host, to assess immune responses in virally infected hosts, and as a diagnostic reagent to detect viral infection.
摘要:
The present invention provides a method for treating the inflammatory response of an established colitis in a subject with inflammatory bowel disease (IBD), comprising administering to a subject diagnosed with an established colitis from an IBD an amount of an antibody to interleukin-12 effective in reducing the colitis-inducing effect of interleukin-12. Also provided is a method for screening a substance for its effectiveness in reducing the inflammatory response of an established colitis comprising obtaining an animal having an established colitis; administering the substance to an animal; and assaying the animal for an effect on interleukin-12 which results in the reduction of the inflammatory response of the colitis, an amount of reduction of the inflammatory response greater than the amount of reduction produced by the administration of antibodies against interferon-gamma or tumor necrosis factor-alpha indicating an effective substance. Additionally, the present invention provides a method for screening a substance for its effectiveness in preventing inflammatory bowel disease comprising administering the substance to an animal susceptible to colitis; subjecting the animal to a treatment that will induce a colitis; assaying the animal for the development of a colitis; and comparing the effectiveness of the substance in preventing development of a colitis to the effectiveness of antibodies to interferon-gamma or tumor necrosis factor-alpha in preventing development of a colitis, a substance more effective in preventing the development of a colitis than antibodies to interferon-gamma or tumor necrosis factor-alpha indicating an effective substance.
摘要:
The present invention provides a composition that can be administered to a mammal to cause immunoprotection in the mammal against a pathogenic organism that has an immunodominant epitope. The composition includes a modified form of the antigen in which the immunodominant epitope is located. In this modified form, the immunodominant epitope is immunodampened by any of a number of techniques. Examples of immunodampening techniques include addition of N-linked glycosylation sites, change of the net charge on the epitope, and substitution with a tolerated sequence. The composition also includes a pharmacologically acceptable carrier.
摘要:
The present invention provides compositions and methods for the treatment of cancer in a subject wherein compounds of formula I defined herein in combination with paclitaxel or other modified taxane analogs provide enhanced anticancer effects over the effects achieved with the individual compounds.
摘要:
The present invention is directed to radiolabeled N-substituted-6-iodo-3,14-dihydroxy-4,5.alpha.-epoxymorphinans, intermediates for producing the same, and a process for the preparation and methods of detecting opioid receptors.The radioimaging agent of the present invention has the following formula: ##STR1## wherein I is selected from the group consisting of .sup.123 I and .sup.125 I; and where R is alkyl, cycloalkylloweralkyl or allyl.
摘要:
An instrument for measuring laser energy in the visible range and which determines when the optical energy exceeds the accessible emission limit for a Class I laser. The instrument employs a photoelectric detector and a filter for a range of 476 to 633 nm. The instrument measures the optical energy as a function of time and compares the measured value with the accessible emission limit for a Class I laser at various critical points in time. A 3-digit engineering-notation display format is used to output the computed time at which the laser energy exceeds the Class I limit, as well as the total energy measured in 10 seconds. The instrument is adapted to measure either CW laser radiation, pulsed laser radiation, or each pulse of laser radiation, computes and applies a correction factor for optical error conditions or variations between optical detectors, and measures and compensates for background energy. Mode and scale information, and sensed data, are read into a micro computer and are read out on a LCD display.
摘要:
Recombinant respiratory syncytial virus (RSV) having the position of genes shifted within the genome or antigenome of the recombinant virus are constructed by insertion, deletion or rearrangement of genes or genome segments within the recombinant genome or antigenome and are useful for eliciting an anti-RSV immune response. Shifting the position of genes in this manner provides for a selected increase or decrease in expression of the gene. In one embodiment, expression of RSV glycoproteins is upregulated by shifting one or more glycoprotein-encoding genes to a more promoter-proximal position. Genes of interest for manipulation to create gene position-shifted RSV include any of the NS1, NS2, N, P, M, SH, M2(ORF1), M2(ORF2), L, F or G genes or a genome segment that may be part of a gene or extragenic. Additional mutations and nucleotide modifications are provided within gene position-shifted RSV to yield desired phenotypic and structural effects.
摘要:
The present invention provides vaccine compositions of attenuated respiratory syncytial virus (RSV). More particularly, the attenuated virus may be a derivative of RSV which has been incompletely attenuated by cold-passage or introduction of mutations which produce virus having a temperature sensitive (ts) or cold adapted (ca) phenotype. The invention also provides methods for stimulating the immune system of an individual to induce protection against respiratory syncytial virus by administration of attenuated RSV. The invention also provides pure cultures of attenuated RS virus, wherein the virus has been more completely attenuated by the further derivatization of previously identified incompletely attenuated ts or cp mutants.
摘要:
The sequences of a pair of human proteins, trichohyalin and transglutaminase-3, in addition to the sequence of the mouse transglutaminase-3 protein, have been discovered. The enzyme transglutaminase-3 is used to cross-link the structural protein trichohyalin in order to form a gel.